Basic Information | |
---|---|
Family ID | F063907 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 129 |
Average Sequence Length | 41 residues |
Representative Sequence | MRKRLITPTPENIRTRGEGWLDVERAAVVEVTSEDK |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 129 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 79.07 % |
% of genes near scaffold ends (potentially truncated) | 94.57 % |
% of genes from short scaffolds (< 2000 bps) | 90.70 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.22 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.116 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.605 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.457 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.287 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.62% Coil/Unstructured: 84.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 129 Family Scaffolds |
---|---|---|
PF04366 | Ysc84 | 8.53 |
PF01022 | HTH_5 | 3.88 |
PF02518 | HATPase_c | 3.10 |
PF00118 | Cpn60_TCP1 | 2.33 |
PF00691 | OmpA | 2.33 |
PF00072 | Response_reg | 1.55 |
PF04041 | Glyco_hydro_130 | 1.55 |
PF08281 | Sigma70_r4_2 | 1.55 |
PF02470 | MlaD | 1.55 |
PF13545 | HTH_Crp_2 | 1.55 |
PF00313 | CSD | 1.55 |
PF01965 | DJ-1_PfpI | 1.55 |
PF11896 | GlgE_dom_N_S | 1.55 |
PF08238 | Sel1 | 0.78 |
PF00719 | Pyrophosphatase | 0.78 |
PF13458 | Peripla_BP_6 | 0.78 |
PF07484 | Collar | 0.78 |
PF07879 | PHB_acc_N | 0.78 |
PF00027 | cNMP_binding | 0.78 |
PF13620 | CarboxypepD_reg | 0.78 |
PF00270 | DEAD | 0.78 |
PF11737 | DUF3300 | 0.78 |
PF02371 | Transposase_20 | 0.78 |
PF08308 | PEGA | 0.78 |
PF12706 | Lactamase_B_2 | 0.78 |
PF13591 | MerR_2 | 0.78 |
PF00877 | NLPC_P60 | 0.78 |
PF03631 | Virul_fac_BrkB | 0.78 |
PF13384 | HTH_23 | 0.78 |
PF07589 | PEP-CTERM | 0.78 |
PF00498 | FHA | 0.78 |
PF00166 | Cpn10 | 0.78 |
PF00990 | GGDEF | 0.78 |
PF00483 | NTP_transferase | 0.78 |
PF03725 | RNase_PH_C | 0.78 |
PF04185 | Phosphoesterase | 0.78 |
COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
---|---|---|---|
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 8.53 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 2.33 |
COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 1.55 |
COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.78 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.78 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.78 |
COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.78 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.78 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.78 |
COG5394 | Polyhydroxyalkanoate (PHA) synthesis regulator protein, binds DNA and PHA | Signal transduction mechanisms [T] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.12 % |
Unclassified | root | N/A | 34.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10073182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1677 | Open in IMG/M |
3300000955|JGI1027J12803_106057167 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300000955|JGI1027J12803_108574517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
3300001661|JGI12053J15887_10275839 | Not Available | 828 | Open in IMG/M |
3300005174|Ga0066680_10025832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3270 | Open in IMG/M |
3300005457|Ga0070662_100259863 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300005467|Ga0070706_100213420 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
3300005537|Ga0070730_10167639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1481 | Open in IMG/M |
3300005559|Ga0066700_10586997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300005561|Ga0066699_10340608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1071 | Open in IMG/M |
3300005576|Ga0066708_10805273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
3300005614|Ga0068856_102055144 | Not Available | 581 | Open in IMG/M |
3300005834|Ga0068851_10022042 | All Organisms → cellular organisms → Bacteria | 3098 | Open in IMG/M |
3300005841|Ga0068863_100160177 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
3300006028|Ga0070717_10724876 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 904 | Open in IMG/M |
3300006028|Ga0070717_10994256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300006047|Ga0075024_100537784 | Not Available | 618 | Open in IMG/M |
3300006059|Ga0075017_100742717 | Not Available | 756 | Open in IMG/M |
3300006175|Ga0070712_101053636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
3300006175|Ga0070712_101939810 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300006176|Ga0070765_100306640 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
3300006871|Ga0075434_100805856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
3300009038|Ga0099829_11487230 | Not Available | 559 | Open in IMG/M |
3300009101|Ga0105247_10423889 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300009137|Ga0066709_104059780 | Not Available | 532 | Open in IMG/M |
3300009176|Ga0105242_10545418 | Not Available | 1111 | Open in IMG/M |
3300009632|Ga0116102_1030214 | Not Available | 1812 | Open in IMG/M |
3300010048|Ga0126373_10931494 | Not Available | 933 | Open in IMG/M |
3300010335|Ga0134063_10095950 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300010361|Ga0126378_10469673 | Not Available | 1373 | Open in IMG/M |
3300010373|Ga0134128_12048258 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300010375|Ga0105239_10267757 | Not Available | 1921 | Open in IMG/M |
3300010376|Ga0126381_103100454 | Not Available | 658 | Open in IMG/M |
3300010376|Ga0126381_104670938 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300011120|Ga0150983_16653345 | Not Available | 554 | Open in IMG/M |
3300012200|Ga0137382_11313711 | Not Available | 510 | Open in IMG/M |
3300012201|Ga0137365_10337151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1115 | Open in IMG/M |
3300012206|Ga0137380_11398457 | Not Available | 584 | Open in IMG/M |
3300012208|Ga0137376_10365093 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
3300012211|Ga0137377_10409923 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300012353|Ga0137367_10501646 | Not Available | 855 | Open in IMG/M |
3300012359|Ga0137385_10708033 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300012923|Ga0137359_10839859 | Not Available | 794 | Open in IMG/M |
3300012944|Ga0137410_11114811 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
3300013307|Ga0157372_10762829 | Not Available | 1125 | Open in IMG/M |
3300016294|Ga0182041_10465219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1089 | Open in IMG/M |
3300016294|Ga0182041_10532500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1023 | Open in IMG/M |
3300016319|Ga0182033_10728881 | Not Available | 869 | Open in IMG/M |
3300016341|Ga0182035_10232528 | Not Available | 1478 | Open in IMG/M |
3300016357|Ga0182032_10896535 | Not Available | 753 | Open in IMG/M |
3300016387|Ga0182040_11520415 | Not Available | 569 | Open in IMG/M |
3300016404|Ga0182037_10003825 | All Organisms → cellular organisms → Bacteria | 8202 | Open in IMG/M |
3300016404|Ga0182037_10072995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2382 | Open in IMG/M |
3300016445|Ga0182038_11809012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria | 551 | Open in IMG/M |
3300017924|Ga0187820_1004857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3117 | Open in IMG/M |
3300017927|Ga0187824_10080037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1035 | Open in IMG/M |
3300017929|Ga0187849_1230034 | Not Available | 713 | Open in IMG/M |
3300018006|Ga0187804_10404834 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300018028|Ga0184608_10378964 | Not Available | 617 | Open in IMG/M |
3300018433|Ga0066667_10047656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2562 | Open in IMG/M |
3300018468|Ga0066662_11911913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia atlantica | 621 | Open in IMG/M |
3300018468|Ga0066662_12611346 | Not Available | 534 | Open in IMG/M |
3300020581|Ga0210399_10372382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1192 | Open in IMG/M |
3300020583|Ga0210401_10067376 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3372 | Open in IMG/M |
3300021171|Ga0210405_10210486 | Not Available | 1541 | Open in IMG/M |
3300021171|Ga0210405_10257117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1382 | Open in IMG/M |
3300021560|Ga0126371_11662077 | Not Available | 763 | Open in IMG/M |
3300022557|Ga0212123_10155901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1754 | Open in IMG/M |
3300022557|Ga0212123_10798993 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300022731|Ga0224563_1008972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
3300024288|Ga0179589_10273259 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300025419|Ga0208036_1026907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1111 | Open in IMG/M |
3300025906|Ga0207699_11125083 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300025910|Ga0207684_10153185 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
3300025936|Ga0207670_11744192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
3300026088|Ga0207641_10309590 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
3300026301|Ga0209238_1091643 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
3300026314|Ga0209268_1123849 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300026316|Ga0209155_1016774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 3119 | Open in IMG/M |
3300026324|Ga0209470_1336540 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300026557|Ga0179587_10491878 | Not Available | 804 | Open in IMG/M |
3300026890|Ga0207781_1016486 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300026934|Ga0207816_1033222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300027014|Ga0207815_1006855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1523 | Open in IMG/M |
3300027063|Ga0207762_1012153 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
3300027330|Ga0207777_1063199 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300027824|Ga0209040_10504429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300027857|Ga0209166_10230795 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300027889|Ga0209380_10796694 | Not Available | 536 | Open in IMG/M |
3300028047|Ga0209526_10690455 | Not Available | 644 | Open in IMG/M |
3300030967|Ga0075399_11251652 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300031057|Ga0170834_100069157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 631 | Open in IMG/M |
3300031231|Ga0170824_114100161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 886 | Open in IMG/M |
3300031543|Ga0318516_10225492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1083 | Open in IMG/M |
3300031543|Ga0318516_10773723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria | 543 | Open in IMG/M |
3300031561|Ga0318528_10075384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → unclassified Candidatus Melainabacteria → Candidatus Melainabacteria bacterium | 1743 | Open in IMG/M |
3300031573|Ga0310915_11056567 | Not Available | 565 | Open in IMG/M |
3300031679|Ga0318561_10682341 | Not Available | 565 | Open in IMG/M |
3300031708|Ga0310686_105664094 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
3300031708|Ga0310686_113920359 | All Organisms → cellular organisms → Bacteria | 3548 | Open in IMG/M |
3300031713|Ga0318496_10126560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1385 | Open in IMG/M |
3300031715|Ga0307476_10256089 | Not Available | 1279 | Open in IMG/M |
3300031719|Ga0306917_11296878 | Not Available | 563 | Open in IMG/M |
3300031720|Ga0307469_10474186 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300031723|Ga0318493_10016480 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 3170 | Open in IMG/M |
3300031744|Ga0306918_11278335 | Not Available | 565 | Open in IMG/M |
3300031753|Ga0307477_10634031 | Not Available | 719 | Open in IMG/M |
3300031770|Ga0318521_10441089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
3300031819|Ga0318568_10983616 | Not Available | 521 | Open in IMG/M |
3300031823|Ga0307478_10888355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 746 | Open in IMG/M |
3300031880|Ga0318544_10326273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → unclassified Candidatus Melainabacteria → Candidatus Melainabacteria bacterium | 596 | Open in IMG/M |
3300031890|Ga0306925_10644276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1114 | Open in IMG/M |
3300031896|Ga0318551_10115882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1439 | Open in IMG/M |
3300031897|Ga0318520_10555226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → unclassified Candidatus Melainabacteria → Candidatus Melainabacteria bacterium | 712 | Open in IMG/M |
3300031910|Ga0306923_10520420 | Not Available | 1343 | Open in IMG/M |
3300031912|Ga0306921_11056113 | Not Available | 913 | Open in IMG/M |
3300031942|Ga0310916_10910713 | Not Available | 737 | Open in IMG/M |
3300031954|Ga0306926_10339195 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
3300032008|Ga0318562_10100684 | Not Available | 1640 | Open in IMG/M |
3300032042|Ga0318545_10047028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1453 | Open in IMG/M |
3300032042|Ga0318545_10107478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Candidatus Melainabacteria → unclassified Candidatus Melainabacteria → Candidatus Melainabacteria bacterium | 980 | Open in IMG/M |
3300032059|Ga0318533_10502444 | Not Available | 889 | Open in IMG/M |
3300032068|Ga0318553_10035160 | All Organisms → cellular organisms → Bacteria | 2420 | Open in IMG/M |
3300032076|Ga0306924_11280869 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300032091|Ga0318577_10093998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1398 | Open in IMG/M |
3300032174|Ga0307470_10212541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1246 | Open in IMG/M |
3300032261|Ga0306920_101721983 | Not Available | 887 | Open in IMG/M |
3300032261|Ga0306920_102820888 | Not Available | 661 | Open in IMG/M |
3300032261|Ga0306920_103171858 | Not Available | 616 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.73% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.30% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.43% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.33% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.33% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.55% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.55% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.55% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.55% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.55% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.55% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.55% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.55% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.78% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
3300026934 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 10 (SPAdes) | Environmental | Open in IMG/M |
3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100731821 | 3300000567 | Peatlands Soil | MRKRLITPAPESIRARGEGWLDVERAAVVEVTSEDKGFPIELAFGSEDARG |
JGI1027J12803_1060571672 | 3300000955 | Soil | MRKRLITPTPENIQTRGQGWLDVERAAVVEVTSEDAECPVESAFSSGD |
JGI1027J12803_1085745171 | 3300000955 | Soil | MRKRLITPTPENIRTRGEGWLDVERAALVEVTSEDQDFP |
JGI12053J15887_102758391 | 3300001661 | Forest Soil | MRKRLIDSTPESMRTRGEGWLDIQSAAVVEVTSEDPNCP |
Ga0066680_100258323 | 3300005174 | Soil | LCMRKRLITPTQGTVRSRGEGWLDVERAAIVEITSEDKKFPG* |
Ga0070662_1002598631 | 3300005457 | Corn Rhizosphere | MRKRLIAETSDIVRPRVEDWLDVERTAVVEVTSEDKDHPVEY |
Ga0070706_1002134203 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRLITATPETVRSRGEGWLDVERAAVVQITSEDKHFPV* |
Ga0070730_101676393 | 3300005537 | Surface Soil | MRKRLITPTEENIPIRAEGSLDIERAAVLEVTSEDKDFPVESAFVSGD |
Ga0066700_105869971 | 3300005559 | Soil | MRTRLIIPTPETVRSRAERWLDVERAAVVEITSEEKGYPVESAFVSGE |
Ga0066699_103406081 | 3300005561 | Soil | MRKRLITPTQGTVRSRGEGWLDVERAAIVEITSEDKKFPG* |
Ga0066708_108052731 | 3300005576 | Soil | MRKRLITPTPESIRTRAESWLDVERAAIVEVTSEDKDCPVESAFVSGD |
Ga0068856_1020551442 | 3300005614 | Corn Rhizosphere | MRKRLITATAEAIGTRGEGWLDIERAAVVEVTSEEGDY |
Ga0068851_100220421 | 3300005834 | Corn Rhizosphere | MRKRLIAETSDIVRPRVEDWLDVERTAVVEVTSEDKDHPVEYAFSPAEAA |
Ga0068863_1001601771 | 3300005841 | Switchgrass Rhizosphere | MRKRFIAPTPEAARPHGEGWLDINRTAVVEITSEEEGFPIES |
Ga0070717_107248761 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRLITPTQDNIRTRGEGWLDVERAAVVEFTSED |
Ga0070717_109942561 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRLITPTQGTVRSHGKGWLDVERAAMVEITSEE |
Ga0075024_1005377843 | 3300006047 | Watersheds | MRKQLIPPTPETVRPYGEGWLDLERAAAVEVTSEEE |
Ga0075017_1007427173 | 3300006059 | Watersheds | MRKRLITPTPESIRAHGEDWLDVEQAAVVEVTSEDKDF |
Ga0070712_1010536361 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKRLITATAERPRTLGQGWLDLERAAVVEVTSED |
Ga0070712_1019398101 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRLVTPTAERIRARGEGIDVERAAVVEVTSEDKDFP |
Ga0070765_1003066401 | 3300006176 | Soil | MRKRLITPTPEHIWTRCENWLDVEHAAAVEVTSEDKDYPVESAF |
Ga0075434_1008058562 | 3300006871 | Populus Rhizosphere | MRKRLITPTPENIQTHREGWLDVERVAIVEITSED |
Ga0099829_114872302 | 3300009038 | Vadose Zone Soil | MRKRLITAPTPETVPSRGKGWLDLERTAVVEVTSEDKDYP |
Ga0105247_104238891 | 3300009101 | Switchgrass Rhizosphere | LGCMRKRLIAPTPVRIRARGEGGLDVERAAVVEVTS* |
Ga0066709_1040597802 | 3300009137 | Grasslands Soil | MRKRLITSTPENIRTQSEGWLDVEHAAVVEVTSEDAQ |
Ga0105242_105454181 | 3300009176 | Miscanthus Rhizosphere | MRKRLIAPTPVRIRARGEGGLDVERAAVVEVTSEDKDFP |
Ga0116102_10302142 | 3300009632 | Peatland | MRKRLITPTPERVRPHGEGWLDLERAAAVEVSSEEED |
Ga0126373_109314943 | 3300010048 | Tropical Forest Soil | MRKRLITPTEKNIRTRSVGWLDVERAALVEVNSEE |
Ga0134063_100959501 | 3300010335 | Grasslands Soil | MRNRLVTPTLETVRSSGEAWLEIEGAAIVEITSEEKDYQVESAVV |
Ga0126378_104696731 | 3300010361 | Tropical Forest Soil | MRKRLIPPPSETIRGHRGDGLDVERAAIVEVTSEDKNFPVESAFG |
Ga0134128_120482582 | 3300010373 | Terrestrial Soil | MRKRLITPTTENIPSPTEGWLDVGRVAVVEVTSEDQEFPVESAFVSEEAE |
Ga0105239_102677572 | 3300010375 | Corn Rhizosphere | MRKRLLDSTPESIRARSEGWLDIESAAVVEVTSED |
Ga0126381_1031004541 | 3300010376 | Tropical Forest Soil | MRKRFITPTAESIRTRGQGWLDVERAAVVEVTSEDKDFPVESVF |
Ga0126381_1046709381 | 3300010376 | Tropical Forest Soil | MRKRFITPIAESIRTRGQGWLDVERAAVVEVTSEDKDFPVESVFVSGDE |
Ga0150983_166533451 | 3300011120 | Forest Soil | MRKRLITPPAESIRTRGEGWLDVERAAVVEVTSEDKDFP |
Ga0137382_113137111 | 3300012200 | Vadose Zone Soil | MRKRLITPTPERIRARGEGWLDVERSAVVEVTSEDKDFPVELAFGSD |
Ga0137365_103371511 | 3300012201 | Vadose Zone Soil | MRKRLITPTPETIPSRGEGRLDLEGTAVVEVTSEEKDHPV |
Ga0137380_113984571 | 3300012206 | Vadose Zone Soil | MRKRLITAPTPETVPSRGEGWLDLERTAVVEVTSEDKD |
Ga0137376_103650931 | 3300012208 | Vadose Zone Soil | MRKRLITPTPANIRTRGDGWLDVERAAVVEVTSEDEDCPVESAFGS |
Ga0137377_104099231 | 3300012211 | Vadose Zone Soil | MRKRLITAPTPETVSSRGEGWLDLERTAVVEVTSE |
Ga0137367_105016461 | 3300012353 | Vadose Zone Soil | MRKRLITPTQETVRSRGEGWLDVERAAMVEITSED |
Ga0137385_107080332 | 3300012359 | Vadose Zone Soil | MRKRLVTPTLETVRSSGEAWLDIEGAAIVEITSEEKDYPV |
Ga0137359_108398591 | 3300012923 | Vadose Zone Soil | MRKRLIDSTPASIRARGEGWLDIESAAVVEVTSEDRNWPVESAFVSG |
Ga0137410_111148112 | 3300012944 | Vadose Zone Soil | MRKQLITPRPETVRSRSESWLDIERAAMVEITSEDRNFPI |
Ga0157372_107628292 | 3300013307 | Corn Rhizosphere | MRKRLIAPTPVRIRARGEGGLDVERAAVVEVTSEDKDFPVELAFGSEDAPGSRAAAPGVQ |
Ga0182041_104652193 | 3300016294 | Soil | MRKRLITPSEENIRTRSVGWLDVERAAVVEVTSEESDHPVE |
Ga0182041_105325003 | 3300016294 | Soil | MRKRLIDSTAEPLGTPGQGWLDLERAAVVEVTSEDEHFPVESAF |
Ga0182033_107288813 | 3300016319 | Soil | MRKRLITPTAETIRTRGEGWLDVERNAVVEVTSEDED |
Ga0182035_102325283 | 3300016341 | Soil | MRKRLIPPPSETIRALRGDGLDVERAAIVEVTSEDKNFPVESAFGSRDLPGWHAA |
Ga0182032_108965353 | 3300016357 | Soil | MRKRLITPTPENIRTRDEGWLDLERAAVVEVTSEDKDFP |
Ga0182040_115204151 | 3300016387 | Soil | MRKRLITSTSERIRTRGEGWLDVERAAVVEFTSEDTD |
Ga0182037_100038251 | 3300016404 | Soil | MRKRLITSPPETVRPHCEGWLDLERAAVVEVTSEEEGF |
Ga0182037_100729951 | 3300016404 | Soil | MRKRLITPTAETIRTRGEGWLDVERNAVVEVTSEDEDYPVESAFASEDARG |
Ga0182038_118090122 | 3300016445 | Soil | MRKRFITPIAESIRTRGQGWLDVERAAVVEVTSEDKDFPVESV |
Ga0187820_10048577 | 3300017924 | Freshwater Sediment | MRKRLITPPAETIRACAGGGIDIERAAVVEVTSEDKDFPIESAFVSVDSR |
Ga0187824_100800371 | 3300017927 | Freshwater Sediment | MCMRKRIITPTAETIRSREEGWLEVERAAIVEITSDDKDFPVEWVFSSG |
Ga0187849_12300341 | 3300017929 | Peatland | MRKRLITPTPERVRPHGEGWLDLERAAAVEVSSEEEDY |
Ga0187804_104048341 | 3300018006 | Freshwater Sediment | MRKRLISSTPERVRPHGEGWLDLERAAAVEVSSEEE |
Ga0184608_103789642 | 3300018028 | Groundwater Sediment | MRKRLITPTPETVRSRGEGWLEIERVAIVEITSEEKDYP |
Ga0066667_100476561 | 3300018433 | Grasslands Soil | MRKRLIDSPPESIQARGDGRLYIESAAVVEVTSEDRNWPVESA |
Ga0066662_119119131 | 3300018468 | Grasslands Soil | HMRKRLITPTPETVRSRGEGWLDVERAAIVLRRDDS |
Ga0066662_126113461 | 3300018468 | Grasslands Soil | MRKRLITPTPEVIQSRGEGWLDIARAAVVEFSSEDNDY |
Ga0210399_103723822 | 3300020581 | Soil | MRKRLITPTPEHIRTRGEDWLDVERAPVVEVTSEDS |
Ga0210401_100673766 | 3300020583 | Soil | MRKRLITATAERSRTRGEGWLDVERAAVVEVTSEDKDF |
Ga0210405_102104864 | 3300021171 | Soil | MRKRLITATAERSRTRGEGWLDVERAAVVEVTSED |
Ga0210405_102571171 | 3300021171 | Soil | MRKQLIPPTSETVRPHGEGWLDLERAATVEVTSEEEN |
Ga0126371_116620771 | 3300021560 | Tropical Forest Soil | MRKRLIDPTAERFGTLGQGWLDLERAAVVEVTSEDEH |
Ga0212123_101559014 | 3300022557 | Iron-Sulfur Acid Spring | MRKRLITPTQEAVRPSGEGWLDVERAAVFEFTSEDKD |
Ga0212123_107989931 | 3300022557 | Iron-Sulfur Acid Spring | MRKRPIAPATESARNHRESWLDVERAAVVEVTSEDPDYPIELALVSEGSRG |
Ga0224563_10089723 | 3300022731 | Soil | MRKRLITPTQGTVRSRGEGWLDVERAAMVEITSEEKDYP |
Ga0179589_102732593 | 3300024288 | Vadose Zone Soil | MRKRLITPTPETVRSRGEGWLDVERAAMVELTSEQK |
Ga0208036_10269071 | 3300025419 | Peatland | MRKRLITPTPETVRPHGDGWLNLERTAAVEVTSEEENFPV |
Ga0207699_111250831 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRLVTPTAERIRARGEGWLDVERAAVVEVTSEDKNFP |
Ga0207684_101531851 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKRLITATPETVRSRGEGWLDVERAAVVQITSEDKHFPV |
Ga0207670_117441921 | 3300025936 | Switchgrass Rhizosphere | MRKRLIAETSDIVRPRVEDWLDVERTAVVEVTSEDKDHPVEYAFS |
Ga0207641_103095902 | 3300026088 | Switchgrass Rhizosphere | MRKRFIAPTPEAARPHGEGWLDINRTAVVEITSEEEGSPI |
Ga0209238_10916433 | 3300026301 | Grasslands Soil | MRKRLVTPTLETVRSSGEAWLDIERAAIVEITSEEKDYPVESAFV |
Ga0209268_11238492 | 3300026314 | Soil | MRKRLVTPTLETVQSSGEAWLDIEGAAIVEITSEEK |
Ga0209155_10167745 | 3300026316 | Soil | MRNRLVTPTLETVRSSGEAWLDIERAAIVEITSEEKDYPVESAFVLGEA |
Ga0209470_13365401 | 3300026324 | Soil | MRKRLITPTPETVRSRAEGWLDVERAAIVEITSEE |
Ga0179587_104918781 | 3300026557 | Vadose Zone Soil | MRKRLIDSTPESIRTRGEGWLDIESAAVVEVTSEDPDCPGES |
Ga0207781_10164862 | 3300026890 | Tropical Forest Soil | MRKRLITPTEENIRTRSVGCLDVERAAVVEVTSEESD |
Ga0207816_10332222 | 3300026934 | Tropical Forest Soil | MRKRLITPTEENIRTRSVGWLDVERAAVVEVTSEENDQPVESAFVLGDA |
Ga0207815_10068553 | 3300027014 | Tropical Forest Soil | MRKRLITPTEENIRTRSVGCLDVERAAVVEVTSEESDHPVESAFVLGDAP |
Ga0207762_10121534 | 3300027063 | Tropical Forest Soil | MRKRLITPTEENIRTRSVGWLGVERAAVVEVTSEENDYPVESA |
Ga0207777_10631991 | 3300027330 | Tropical Forest Soil | MRKRLITPTEENIRTRSVGWLGVERAAVVEVTSEENDYPVESAFVLG |
Ga0209040_105044291 | 3300027824 | Bog Forest Soil | MRKRLISPTPDNMRTRGEGWLDVERAAAVVEVTSEDKD |
Ga0209166_102307951 | 3300027857 | Surface Soil | MRKRLITPTEENIPIRAEGSLDIERAAVLEVTSEDKDF |
Ga0209380_107966942 | 3300027889 | Soil | MRKRLITPTPERVRTCGEGWLDVEHAAAVEVTSEDKD |
Ga0209526_106904551 | 3300028047 | Forest Soil | MRKRLITPTRESIATHDEDWLDVERTAVVEVTSEDE |
Ga0075399_112516522 | 3300030967 | Soil | MRKRLITPTPENIRTRGEGWLDVERAAVVEVTSEDK |
Ga0170834_1000691572 | 3300031057 | Forest Soil | MRKRLIDPTAERPGTLGQGWLDLERAAVVEVTSEDK |
Ga0170824_1141001611 | 3300031231 | Forest Soil | MRKRLITPTPESIRTRGDSWLDVEQQAVVEVTSEDKNYPVESAFVS |
Ga0318516_102254923 | 3300031543 | Soil | MRKRLITPTEENTRTRSAGWLDVERAAVVEVTSEESDHPV |
Ga0318516_107737232 | 3300031543 | Soil | MRKRFITPIAESIRTRGQGWLDVQRAAVVEVTSEDKDF |
Ga0318528_100753845 | 3300031561 | Soil | MRKRFITPTAESIRTRGQGWLDVERAAVVEVTSEDKDFPVESVFVSGDE |
Ga0310915_110565671 | 3300031573 | Soil | MRKRLIPPPSETIRALRGDGLDVERAAIVEVTSEEKNFPVESAFGSRD |
Ga0318561_106823411 | 3300031679 | Soil | MRKRLITPTAERLGTLGQGWLDLERAAVVEVTSEDEHFPV |
Ga0310686_1056640941 | 3300031708 | Soil | MRKRLITPTTETVRPDAGGWLDLEHAAVVEVTSEAEGFPVES |
Ga0310686_1139203595 | 3300031708 | Soil | MRKRLTTPTQENIRTRSEGWLDFERAAVVEVTSEDQDYPVEGAFGSAEAPG |
Ga0318496_101265601 | 3300031713 | Soil | MRKRLITPTEENILTRSVCWLDVERAAVVEVTSEE |
Ga0307476_102560893 | 3300031715 | Hardwood Forest Soil | MRKRLIVQAPKLRTRSGLDLEHAAVVEVTSEDKDFPVESAFASEEARGWRA |
Ga0306917_112968782 | 3300031719 | Soil | MRKRLITSTSERIRTRGEGWLDVERAAVVEFTSEDTDYPIEAAFVSG |
Ga0307469_104741863 | 3300031720 | Hardwood Forest Soil | RKRLITTTPESIRTRGESWLDVEQQAVVEVKAEDKDYPVESAFVSEDARG |
Ga0318493_100164807 | 3300031723 | Soil | MRKRLITPTSEPLGTQGGLDLEREAVVEVTSEDEH |
Ga0306918_112783351 | 3300031744 | Soil | MRKRLITPTAERLGTLGQGWLDLERAAVVEVTSEEEHFPV |
Ga0307477_106340311 | 3300031753 | Hardwood Forest Soil | VNGSKLGSVRKRLIDPTAERPGTLAEGWLDLERAAVVEVTSEDNDF |
Ga0318521_104410891 | 3300031770 | Soil | MRKRLITPTAERLGTLGQGWLDLERAAVVEVTSEDEHFPVE |
Ga0318568_109836162 | 3300031819 | Soil | MRKRLIDSTAEPLGTPGQGWLDLERAAVVEVTSEDE |
Ga0307478_108883551 | 3300031823 | Hardwood Forest Soil | MRKRLITPTAENIRTRGEGWLDVERAAVVEVTSEDKDFPVESAFAFEDAR |
Ga0318544_103262731 | 3300031880 | Soil | MRKRFITPTAESIRTRGQGWLDVERAAVVEVTSEDKDFPVESVFVS |
Ga0306925_106442761 | 3300031890 | Soil | MRKRFITPTAESIRTRGQGWLDVERAAVVEVTSEDKDFPVESVFVSGD |
Ga0318551_101158823 | 3300031896 | Soil | MRKRLITPSEENIRTRSVGWLDVERAAVVEVTSEES |
Ga0318520_105552261 | 3300031897 | Soil | MRKRFITPTAESIRTRGQGWLDVEHAAVVEVTSEDEDFPLESVFVS |
Ga0306923_105204202 | 3300031910 | Soil | MRKRLITSTSERIRTRGEGWLDVERAAVVEFTSEDTDYPI |
Ga0306921_110561132 | 3300031912 | Soil | MRKRLITPTEENIWTRSVGWLDVECAALVEVTSEENDHPVESAFV |
Ga0310916_109107131 | 3300031942 | Soil | MRKRLIDSTAEPLGTPGQGWLDLERAAVVEVTSEDERYP |
Ga0306926_103391951 | 3300031954 | Soil | MRKRLITPTEENIRTRSVGWLDVERAAVVEVTSEENDQPVE |
Ga0318562_101006841 | 3300032008 | Soil | MRKRLITPTSEPLGTQGGLDLEREAVVEVTSEDEHFPVES |
Ga0318545_100470283 | 3300032042 | Soil | MRKRLITPTEENILTRSVCWLDVERAAVVEVTSEESDHPV |
Ga0318545_101074781 | 3300032042 | Soil | MRKRFITPIAESIRTRGQGWLDVQRAAVVEVTSEDKDFPVESVF |
Ga0318533_105024441 | 3300032059 | Soil | MRKRLITPTAETIRTRGEGWLDVERNAVVEVTSEDEDYPVESAFASED |
Ga0318553_100351606 | 3300032068 | Soil | MRKRLITPTEENIRTRSVGWLDVERAAVVEVTSEESDRPVES |
Ga0306924_112808692 | 3300032076 | Soil | MRKRLITPTSGRIRPCGEGWLDVERAAVVEFTSEDTDHPIEA |
Ga0318577_100939981 | 3300032091 | Soil | MRKRLITPTAEPLGALGQVWLDLERAAVVEVTSEDEHF |
Ga0307470_102125413 | 3300032174 | Hardwood Forest Soil | MRKRLIAPTPETIRARGEGWLDIERTAVVEVTSEDKN |
Ga0306920_1017219831 | 3300032261 | Soil | MRKRLITPTAERLGTLGQGWLDLERAAVVEVTSEEE |
Ga0306920_1028208881 | 3300032261 | Soil | MRKRLIPPPSETIRARRGDGLDVERAAIVEVTSEDKNFPVESAF |
Ga0306920_1031718582 | 3300032261 | Soil | MRKRLITSTSERIRTRGEGWLDVEHAAVVEFTSEETDYPIEAAF |
⦗Top⦘ |