NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F063916

Metagenome / Metatranscriptome Family F063916

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F063916
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 44 residues
Representative Sequence RAIPVGVIEISDQQTRFVPITDRKKLTGAVLAGIGFGMWLGWRRRR
Number of Associated Samples 116
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.69 %
% of genes near scaffold ends (potentially truncated) 92.25 %
% of genes from short scaffolds (< 2000 bps) 90.70 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.922 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.279 % of family members)
Environment Ontology (ENVO) Unclassified
(24.806 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.364 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 31.08%    β-sheet: 0.00%    Coil/Unstructured: 68.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF01554MatE 5.43
PF00072Response_reg 2.33
PF00581Rhodanese 2.33
PF00069Pkinase 2.33
PF02735Ku 1.55
PF12222PNGaseA 1.55
PF08238Sel1 0.78
PF02812ELFV_dehydrog_N 0.78
PF13519VWA_2 0.78
PF13432TPR_16 0.78
PF04055Radical_SAM 0.78
PF07498Rho_N 0.78
PF13022HTH_Tnp_1_2 0.78
PF07228SpoIIE 0.78
PF00903Glyoxalase 0.78
PF12732YtxH 0.78
PF00578AhpC-TSA 0.78
PF12705PDDEXK_1 0.78
PF03050DDE_Tnp_IS66 0.78
PF03544TonB_C 0.78
PF00982Glyco_transf_20 0.78
PF13360PQQ_2 0.78
PF11154DUF2934 0.78
PF02954HTH_8 0.78
PF01558POR 0.78
PF00144Beta-lactamase 0.78
PF04945YHS 0.78
PF07494Reg_prop 0.78
PF02321OEP 0.78
PF07676PD40 0.78
PF00990GGDEF 0.78
PF00166Cpn10 0.78
PF10012DUF2255 0.78
PF01553Acyltransferase 0.78
PF02518HATPase_c 0.78
PF01070FMN_dh 0.78
PF07311Dodecin 0.78
PF01068DNA_ligase_A_M 0.78
PF16925TetR_C_13 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 9.30
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 1.55
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.55
COG2367Beta-lactamase class ADefense mechanisms [V] 0.78
COG3292Periplasmic ligand-binding sensor domainSignal transduction mechanisms [T] 0.78
COG3360Flavin-binding protein dodecinGeneral function prediction only [R] 0.78
COG3436TransposaseMobilome: prophages, transposons [X] 0.78
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.78
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.78
COG0334Glutamate dehydrogenase/leucine dehydrogenaseAmino acid transport and metabolism [E] 0.78
COG0380Trehalose-6-phosphate synthase, GT20 familyCarbohydrate transport and metabolism [G] 0.78
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.78
COG1014Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunitEnergy production and conversion [C] 0.78
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.78
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.78
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.78
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.78
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.92 %
UnclassifiedrootN/A10.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZ032L002G5L0TAll Organisms → cellular organisms → Bacteria526Open in IMG/M
3300001100|JGI12703J13194_108548All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300002245|JGIcombinedJ26739_100627289All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300002245|JGIcombinedJ26739_101007313All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300003505|JGIcombinedJ51221_10256123All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300004092|Ga0062389_100091195All Organisms → cellular organisms → Bacteria2656Open in IMG/M
3300004633|Ga0066395_10179077All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300005175|Ga0066673_10588298All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005184|Ga0066671_10233854All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300005334|Ga0068869_100209559All Organisms → cellular organisms → Bacteria → Acidobacteria1540Open in IMG/M
3300005468|Ga0070707_101222052All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005518|Ga0070699_101078179All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300005534|Ga0070735_10487676All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300005534|Ga0070735_10800724Not Available555Open in IMG/M
3300005541|Ga0070733_10444841All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300005542|Ga0070732_10720017All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300005555|Ga0066692_10968134All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005556|Ga0066707_10721222All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005559|Ga0066700_10706509All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300005575|Ga0066702_10053465Not Available2179Open in IMG/M
3300005586|Ga0066691_10078512All Organisms → cellular organisms → Bacteria1823Open in IMG/M
3300006028|Ga0070717_10028614All Organisms → cellular organisms → Bacteria4462Open in IMG/M
3300006102|Ga0075015_100082036All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300006175|Ga0070712_100711965All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300006176|Ga0070765_100686597All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300006358|Ga0068871_101913582All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300006800|Ga0066660_10214102All Organisms → cellular organisms → Bacteria1480Open in IMG/M
3300009012|Ga0066710_101862677All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300009038|Ga0099829_11054046All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300009101|Ga0105247_10497305Not Available888Open in IMG/M
3300009177|Ga0105248_10723954All Organisms → cellular organisms → Bacteria → Acidobacteria1123Open in IMG/M
3300009521|Ga0116222_1165958Not Available951Open in IMG/M
3300009523|Ga0116221_1310387All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300009525|Ga0116220_10253748All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium768Open in IMG/M
3300009700|Ga0116217_10584038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300010048|Ga0126373_12621724All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300010361|Ga0126378_12826156All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300010376|Ga0126381_102066944All Organisms → cellular organisms → Bacteria → Acidobacteria820Open in IMG/M
3300010376|Ga0126381_102554170All Organisms → cellular organisms → Bacteria → Acidobacteria731Open in IMG/M
3300010397|Ga0134124_10224478All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300011269|Ga0137392_10412261All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300012200|Ga0137382_11255421All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300012202|Ga0137363_11087747All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300012917|Ga0137395_10473488All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium901Open in IMG/M
3300012918|Ga0137396_10242582All Organisms → cellular organisms → Bacteria → Acidobacteria1328Open in IMG/M
3300012930|Ga0137407_11519389All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300013105|Ga0157369_10279485All Organisms → cellular organisms → Bacteria1739Open in IMG/M
3300013306|Ga0163162_10408667Not Available1490Open in IMG/M
3300014495|Ga0182015_10943321All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300014501|Ga0182024_10701221All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300014654|Ga0181525_10075815Not Available1877Open in IMG/M
3300016445|Ga0182038_11157875All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300017924|Ga0187820_1327853All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300017928|Ga0187806_1045161All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300017937|Ga0187809_10085653All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300017972|Ga0187781_10177260All Organisms → cellular organisms → Bacteria1501Open in IMG/M
3300018021|Ga0187882_1388626All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300018023|Ga0187889_10423006All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300018062|Ga0187784_10772069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium767Open in IMG/M
3300018085|Ga0187772_10437374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium915Open in IMG/M
3300020580|Ga0210403_10002695All Organisms → cellular organisms → Bacteria15873Open in IMG/M
3300020580|Ga0210403_10762846All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300020580|Ga0210403_11031174Not Available642Open in IMG/M
3300020581|Ga0210399_10450375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1072Open in IMG/M
3300020582|Ga0210395_10388621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1050Open in IMG/M
3300020582|Ga0210395_11328426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300021168|Ga0210406_11014779All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300021402|Ga0210385_10296158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1198Open in IMG/M
3300021406|Ga0210386_10179150All Organisms → cellular organisms → Bacteria1786Open in IMG/M
3300021407|Ga0210383_11629404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodopila → Rhodopila globiformis530Open in IMG/M
3300021420|Ga0210394_10715685All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium877Open in IMG/M
3300021432|Ga0210384_10428685All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1191Open in IMG/M
3300021433|Ga0210391_10707166All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300021559|Ga0210409_10583443All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300021559|Ga0210409_11269229All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300021560|Ga0126371_13828083All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300022528|Ga0242669_1101263All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300022557|Ga0212123_10213509All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300022724|Ga0242665_10146231All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium743Open in IMG/M
3300022733|Ga0224562_1017490All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300025320|Ga0209171_10104576All Organisms → cellular organisms → Bacteria → Acidobacteria1726Open in IMG/M
3300025321|Ga0207656_10277141All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300025612|Ga0208691_1048150All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300025898|Ga0207692_11061470All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300025922|Ga0207646_10538829All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1050Open in IMG/M
3300026552|Ga0209577_10439535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium916Open in IMG/M
3300027559|Ga0209222_1043000All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300027605|Ga0209329_1111985All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans599Open in IMG/M
3300027643|Ga0209076_1088386All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300027667|Ga0209009_1123310All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300027729|Ga0209248_10045111All Organisms → cellular organisms → Bacteria → Acidobacteria1358Open in IMG/M
3300027825|Ga0209039_10111460Not Available1165Open in IMG/M
3300027842|Ga0209580_10262352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii860Open in IMG/M
3300027889|Ga0209380_10494052All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300027895|Ga0209624_10126167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1683Open in IMG/M
3300027895|Ga0209624_10771607All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium632Open in IMG/M
3300027986|Ga0209168_10655028Not Available500Open in IMG/M
3300028020|Ga0265351_1007103All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium902Open in IMG/M
3300028379|Ga0268266_10006448All Organisms → cellular organisms → Bacteria → Acidobacteria10745Open in IMG/M
3300028379|Ga0268266_10086823All Organisms → cellular organisms → Bacteria2735Open in IMG/M
3300028381|Ga0268264_10602325All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300028536|Ga0137415_10153045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2142Open in IMG/M
3300028745|Ga0302267_10269340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300029636|Ga0222749_10570422All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300029882|Ga0311368_10034642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4752Open in IMG/M
3300029956|Ga0302150_10271346All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300030509|Ga0302183_10401098All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300030815|Ga0265746_1014596All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300030991|Ga0073994_12358989All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300031049|Ga0074036_10779255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1096Open in IMG/M
3300031128|Ga0170823_14940047All Organisms → cellular organisms → Bacteria1190Open in IMG/M
3300031231|Ga0170824_127868696All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300031233|Ga0302307_10208630All Organisms → cellular organisms → Bacteria → Acidobacteria1007Open in IMG/M
3300031236|Ga0302324_100274392All Organisms → cellular organisms → Bacteria2608Open in IMG/M
3300031708|Ga0310686_110451997All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300031711|Ga0265314_10366863Not Available788Open in IMG/M
3300031716|Ga0310813_10550157All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300031718|Ga0307474_10164967Not Available1676Open in IMG/M
3300031718|Ga0307474_10426797All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300031718|Ga0307474_10679466All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300031740|Ga0307468_101704796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300031754|Ga0307475_10412568All Organisms → cellular organisms → Bacteria1085Open in IMG/M
3300031962|Ga0307479_10076867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3231Open in IMG/M
3300031962|Ga0307479_10110624Not Available2672Open in IMG/M
3300032001|Ga0306922_10478045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1329Open in IMG/M
3300032180|Ga0307471_104185836All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300032515|Ga0348332_11645103All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300032828|Ga0335080_11412565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.28%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil6.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.20%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.65%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.10%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.33%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.55%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.55%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.55%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.55%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.78%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.78%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.78%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.78%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300001100Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022733Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027559Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028020Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031049Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_095636502170459003Grass SoilGGGARAIPVGFIEVSDQQARFVPITDRKKLAGAAAIGIGLGMWLGWRRRR
JGI12703J13194_10854813300001100Forest SoilVRTIPVGVIEVSDQPTRFVPITDRKKLTGAVLASIGLGMLLGWRRRR*
JGIcombinedJ26739_10062728913300002245Forest SoilGVIEVSDQQTRFIPITSRKKMAGAVFVGSLLGIFLGWRKRR*
JGIcombinedJ26739_10100731313300002245Forest SoilIEVSDQQTRFIPITNRKKMAGVALAGTLLGIVLSWRKRR*
JGIcombinedJ51221_1025612313300003505Forest SoilVRAIPVGVIEISEQRTCFVPITDRKKLTGAVVTGIGLGILLGWRSRRR*
Ga0062389_10009119533300004092Bog Forest SoilTIPVGVIEISDQPTRFIPITSRKKLAAAIVGGILFGLLFARRRRR*
Ga0066395_1017907723300004633Tropical Forest SoilIRAVPVGVIEVSSNQPTRFVPITDRKKLGAAAMAGIVVGMWLGWRRRR*
Ga0066673_1058829813300005175SoilGVVRAVPVGVFEVGSHGTRFVSITERRKLASVLATGVALGMWLGWRRRH*
Ga0066671_1023385433300005184SoilIEVSSQPTRFVPISDRKKLTAAVFLGLGLGMLLGFRRRR*
Ga0068869_10020955933300005334Miscanthus RhizosphereAVPVGVIEVSIHQTRFVPITDRRKLTGALLAGIGLGMWLGWRRRR*
Ga0070707_10122205223300005468Corn, Switchgrass And Miscanthus RhizosphereVPVGVIEVSEQHTCFVPITDRKKLTGALLAGIAFGMWLGWRRLR*
Ga0070699_10107817923300005518Corn, Switchgrass And Miscanthus RhizosphereHAVPVGVVEVSDQQTRFVPISDRKKLTGMLLLGVGMGMWLNRRRRS*
Ga0070735_1048767613300005534Surface SoilRTCFVPITDRKKLTGAVVTGIGLGILLGWRSRRR*
Ga0070735_1080072423300005534Surface SoilVGVVEVSAQNTRFVPISDRKKLAGAVALGALLGVP*
Ga0070733_1044484113300005541Surface SoilVIEISDQQTCFVPITDRKKLTGALLAGIGFGMWLGWRNRR*
Ga0070732_1072001723300005542Surface SoilAIPVGVIEVSDQQTRFVPITDHKKLAGAVLAGIGLGMWLGWRRRR*
Ga0066692_1096813413300005555SoilVGVIEISDQQTRFVQITDRKKLTGAILAGIGLGMWLG*
Ga0066707_1072122223300005556SoilVGVIEVSDQQTRFVPISDRKKLTGVLLLGVGLGMWLGYRR*
Ga0066700_1070650923300005559SoilVGVIEISDQQTRFVPITDRKKLTGAVLVGIGLGMFLGWRRRH*
Ga0066702_1005346543300005575SoilQQTRFVPITDRKKLTGAVLVGIGLGMFLGWRRRH*
Ga0066691_1007851233300005586SoilVRAIPVGVIEISDQQTRFVPITDRKKLTGAVLAGIGFGMWLGWRRRGRGV*
Ga0070717_1002861483300006028Corn, Switchgrass And Miscanthus RhizosphereGGGARAIPVGVIEVSEQPTRFVPITDRKKLTGAVLVGIGLGLWLGWRRRKFNS*
Ga0075015_10008203613300006102WatershedsVRAVPVGVIEISDHPTRFVPVTDRKKLAGAVLVGIGLGVWLGWRRWR*
Ga0070712_10071196513300006175Corn, Switchgrass And Miscanthus RhizosphereEVSNQQTRFVPISDKRKLVGAVLAGISFGIWWGWRRHR*
Ga0070765_10068659713300006176SoilRAIPVGVIEISDQQTSFVPITDRKKLTGAVLAGIGLGVLLGWRTRR*
Ga0068871_10191358213300006358Miscanthus RhizospherePVGVIEISDQQTRFVPITDRKKLTGAVVVGIGLGLWLGWRRRH*
Ga0066660_1021410233300006800SoilRAVPVGVIEVSDQPTRFVPISDRKKLTGAVLVGLALGMLMSLRRR*
Ga0066710_10186267723300009012Grasslands SoilVIEISDQQTRFVPITDRKKLTGAVLAGIGLGVWLGWRRWR
Ga0099829_1105404613300009038Vadose Zone SoilVIEVSDQQTRFVPISDRKKLTGVLLLGVGLGMWLGHRR*
Ga0105247_1049730513300009101Switchgrass RhizosphereEVSNQQTRFIPITDRRKLAGALLAGIGFGMWLGWRRRR*
Ga0105248_1072395423300009177Switchgrass RhizosphereGAVRAVPVGVIEVSIHQTRFVPITDRRKLTGALLAGIGLGMWLGWRRRR*
Ga0116222_116595813300009521Peatlands SoilGVVEISDQQTCFVPITSRKKLAVAVLAGIVLGIWVGWRRRG*
Ga0116221_131038733300009523Peatlands SoilGARTVPVGVIEISDQPTCFVPITDRKKLTEALLAGIGFGMWLGWRNRR*
Ga0116220_1025374823300009525Peatlands SoilVRAVPVGVIEISDQQTCFVPITDRKKLTGAVLAGIGLGVLLGWRARR*
Ga0116217_1058403813300009700Peatlands SoilEGGGGAGGVRAVPVGVIEISDQPTRFVPISNHKKLTGAVLAGIGFGMLLGWRRR*
Ga0126373_1262172413300010048Tropical Forest SoilGVIEISDHQTRFVPITDRRKLSAAILIGAGFGMWLARSRRH*
Ga0126378_1282615613300010361Tropical Forest SoilGVQAVPIGVIEVSKQQTRFVPITDRKKLGGAVLAGMVLGMFWRWQRRH*
Ga0126381_10206694423300010376Tropical Forest SoilVEVSEQQTRFVPISDRKKLTAAAFGGIVLGMWLGWRRRR*
Ga0126381_10255417013300010376Tropical Forest SoilSKQQTRFVPISDRKKLSAAVLTGMVIGMFWRWRRRH*
Ga0134124_1022447833300010397Terrestrial SoilGGGVRAIPVGVIEVSHQSTRFIPITDRKKLTGAVLAGIGVGIWLAWTRRR*
Ga0137392_1041226113300011269Vadose Zone SoilVIEISDQQFRFVPITDSKKLTGAVLAGIGFGMWLGWRRRR*
Ga0137382_1125542113300012200Vadose Zone SoilQQTRFVPITDRKRLAGAVLAGIGLGMWLGWRRRR*
Ga0137363_1108774713300012202Vadose Zone SoilQQTRFVPITDRKKMTGALLAGIGFGMWLGWRRHR*
Ga0137395_1047348833300012917Vadose Zone SoilRAVPVGIIEISDQQTRFVPITDRKKLAAATLVGIGLGMWLGWCRRR*
Ga0137396_1024258213300012918Vadose Zone SoilRAIPVGVIEISDQQTRFVPITDRKKLTGAVLAGIGFGMWLGWRRRR*
Ga0137407_1151938923300012930Vadose Zone SoilGVRAIPVGVIEISDQQTRFVPITDRKKLTGAVLAGIGLGMWLGWRRRR*
Ga0157369_1027948543300013105Corn RhizospherePVGVIEVSHQQTRFVPITDRKKLTGTLLAGIGLGMWLAWSRRR*
Ga0163162_1040866723300013306Switchgrass RhizosphereVIEVSNQQTRFIPITDRRKLAGALLAGIGFGMWLGWRRRR*
Ga0182015_1094332123300014495PalsaRAVPVGVIEISEQRTCFVPVTDRKKLAGAVVAGIGLGILLSWRSRRR*
Ga0182024_1070122113300014501PermafrostEVSDQQTRFVPITDRKRFAGAVLAGIGLGMLLGWRRRR*
Ga0181525_1007581523300014654BogGGARVVPLGVIEISEQQTTFVPITSRKKLTGVLLGGIGLGMLLGWRRLRSR*
Ga0182038_1115787513300016445SoilSAQQTRFVPISDQKKLGSVLLAGIGLGLLMAWRRKR
Ga0187820_132785313300017924Freshwater SedimentPVGVVEVSDQQTRFVPINDRKKVAGAIAMGVGLGIFLAWRRRR
Ga0187806_104516143300017928Freshwater SedimentGGGVRTVPVGVIEISDQPTCFVPITDRKKLTGALLAGIGFGMWLGWRNRR
Ga0187809_1008565313300017937Freshwater SedimentGGGARTVPVGVIEISDQPTCFVPITDRKKLTGALLAGIGFGMWLGWRNRR
Ga0187781_1017726023300017972Tropical PeatlandEISGQATRFVPISDRKKLTGAVVAGIGLGLWLGWRRRR
Ga0187882_138862613300018021PeatlandRAIPVGVIEISDQQETRFVPITDRKKLTGAILAGIGLGMWLGWRRRR
Ga0187889_1042300633300018023PeatlandIDISDQQETRCVPITDRKKLTGAILAGIGLGMWLGWRRRR
Ga0187784_1077206923300018062Tropical PeatlandGGGGARAIPVGVIEISDQQTRFVPITDRKKLTAATVAGIGLGIWLSWRRRH
Ga0187772_1043737423300018085Tropical PeatlandIPVGVIEISDQQTRFVPITDRKKLTAATVAGIGLGIWLSWRRRH
Ga0210403_10002695173300020580SoilVGVIEVSDQQTRFVPITDRKKLTGAVLTGIGLGMFLGWRRRR
Ga0210403_1076284613300020580SoilRAVAVGVIEVSDRQTRFVPITDRKRLAGAVLVGIGLGMLLGWRRRR
Ga0210403_1103117413300020580SoilEISEHQTRFIPITSRKKLTGAVIAGILLGISFGWRRRRR
Ga0210399_1045037523300020581SoilVGVIEISDQPTCFVPITDRKKLTGAAVAGIGLGILLGWRSRRR
Ga0210395_1038862113300020582SoilVGVIEISDLRTCFVPITDRKKLTGAVLAGVGLGILLGWSARR
Ga0210395_1088862413300020582SoilSARSEGRGGVGGVRAIPVGVIEVSDQQIHFVPITDRKRLAGAVLAGIGLGMLLGWRRRH
Ga0210395_1132842623300020582SoilGGGGAVRAVPIGVIEISDQPARFVPISNHKKLTAAVLAGIGFGMLMGWRRRR
Ga0210406_1101477913300021168SoilQTRFVPITDRKKLTGAVLAGIVLGMWVGWRRVRRH
Ga0210385_1029615823300021402SoilIPVGVIEISDQHTCFIPITSRKKLAGAIVVGALLGIFLGWRRRRR
Ga0210386_1017915013300021406SoilIPVGVIEVTDQHTRFIPITSSKKLAGFVLAGALLGMIFGRRKRR
Ga0210383_1162940413300021407SoilEGGGGGCGVRAVPVGVIDVSDQGTVFVPITSRHKLAGAVVAGVGLGIFLSWRRRKK
Ga0210394_1071568513300021420SoilPVGVIEISEQRTCFVPITDRKKLTGAVVAGIGLGILLGWRSRRR
Ga0210384_1042868523300021432SoilVSTGQTRFVPITSRKKLVAASFGGIVVGALIGWLGRRR
Ga0210391_1070716623300021433SoilISDQQTSFVPITDRKKLTGAVLAGIGLGVLLGRRRRR
Ga0210409_1058344313300021559SoilGGVRAIPVGVIEISDQQTRFVPITDRTKLTGAVLAGIGLGMWLGWRRRG
Ga0210409_1126922913300021559SoilPVGVIEISEQRTCFVPITDRKKLTGAVVTGIGLGILLGWRSRRR
Ga0126371_1382808323300021560Tropical Forest SoilAIPVGVIEISDLQTRFVPITDRKKLTAAAVAGIGLGIWLSWRRRH
Ga0242669_110126323300022528SoilGGGGAGVRAIPVGVIEISDQHTCFIPITSRKKLAGAIVVGALLGIFLSWRRRRR
Ga0212123_1021350943300022557Iron-Sulfur Acid SpringARAIPVGVIEISDLRTCFVPITDRKKLTGAVLAGVGLGILLVWSARR
Ga0242665_1014623123300022724SoilGGAVRAVPIGVIEISDQPARFVPISNHKKLTAAVLAGIGFGMLMGWRKRR
Ga0224562_101749013300022733SoilGVRAIPVGVIEISDHPTSFVPITDRKKLTGAVLAGIGLGILLGWRTRR
Ga0209171_1010457653300025320Iron-Sulfur Acid SpringPIGVIEVSDQQTRFVPITDRKRLAGAVLAGIGLGMLLGWRRRR
Ga0207656_1027714113300025321Corn RhizosphereAVPVGVIEVSNQQTRFVPITDRKKLTGALLAGIGFGMWLAWSRRR
Ga0208691_104815013300025612PeatlandVRAIPVGVIEISDQQTRFIPITSRKKLTGAVVAGILLGISLGWRRRRR
Ga0207692_1106147023300025898Corn, Switchgrass And Miscanthus RhizosphereGGARAIPVGVIEVSEQPTRFVPITDRKKLTGAVLVGIGLGLWLGWRRRKFNS
Ga0207646_1053882943300025922Corn, Switchgrass And Miscanthus RhizosphereATPVGVIEISDQQTRFVPITDRKRLAGAVLAGIGLGIFLGWRRRR
Ga0209577_1043953523300026552SoilRAIPVGVIEISDQQTRFVPITDRKKLAGAILAGIGFGMWLGWRGGRR
Ga0209222_104300023300027559Forest SoilPVGVIEVSDQQTRFIPITSRKKMAGAVFVGSLLGIFLGWRKRR
Ga0209329_111198523300027605Forest SoilVQNLIAQQTRFVPITDRKKLTGAVLAGIGIGMWLGWRRRR
Ga0209076_108838613300027643Vadose Zone SoilGGGVRAIPVGVIEISDQQTRFVPITDRKKLTGAVLVGIGLGVWLGWRRRR
Ga0209009_112331013300027667Forest SoilGVIEVSDQQTRFVPITDRKRLAGAVLAGIGLGILLGWRRRH
Ga0209248_1004511143300027729Bog Forest SoilGCGGAGVRAIPVGVIEISDQQTRFIPITSRKKLAGAILGGILLGITLGWRRRRR
Ga0209039_1011146013300027825Bog Forest SoilPLGVIEVSAEQTRFVPITSRRKLAGALVAGVGFGILLAWRRLRSR
Ga0209580_1026235223300027842Surface SoilVIEISDHQTRFVPIATDRRKLAGAIATGIGMGLWLARLRR
Ga0209380_1049405223300027889SoilLAIPAGVMEISDQQTRFVPITDRKKLAGAVLAGISFGMWLGWRRRR
Ga0209624_1012616723300027895Forest SoilVGVIEIGDQQTRFVPITDRKKLTGAVLVGTGFGMRLGWRKRR
Ga0209624_1077160723300027895Forest SoilEISDRRTCFVPITDRKKLTGAVLAGVGLGILLGWSARR
Ga0209168_1065502823300027986Surface SoilVGVVEVSAQNTRFVPISDRKKLAGAVALGALLGVP
Ga0265351_100710323300028020SoilEVSDQHTRFVPITDRKRLVGAVLAGIGLGMWLGWRRRR
Ga0268266_10006448153300028379Switchgrass RhizosphereRAVPVGVIEVSNQQTRFVPITDRKKLTGALLAGIGFGMWLAWSRRR
Ga0268266_1008682363300028379Switchgrass RhizosphereGVIEVSHQQTRFVPITDRKKLTGTLLAGIGLGMWLAWSRRR
Ga0268264_1060232513300028381Switchgrass RhizosphereGVRAVPVGVIEVSNQPTRFVPITDRRKLTGAVLAGIGFGMWLGWRRRR
Ga0137415_1015304513300028536Vadose Zone SoilSDQQTRFVPITDRKTLTGAVLAGIGLGMWLGWRRRR
Ga0302267_1026934023300028745BogVRAIPVGVIEVSDQQTRFVPITDRKRFAGAVLAGIGLGMLLGWRRRR
Ga0222749_1057042213300029636SoilVRAVPVGVIEVSEQQTRFVPITDRKKLTGAVLAGIGFGMWVGWRRLRRHESVAQ
Ga0311368_1003464213300029882PalsaGAAVRTIPVGVIEVSDQQTRFIPITSRKKLAAAALVGTLLGISLGWRKRR
Ga0302150_1027134623300029956BogVIELSDQQTRFVPITDRKRFAGAVLAGIGLGMLLGWRRRR
Ga0302183_1040109813300030509PalsaPVGVIEVSDQQTRFIPITSRKKLAGAVFVGSLLGIFLGWRKRR
Ga0265746_101459623300030815SoilGVIDITEKETRFVPITDRKRLGGAVLVGVGLGMLLSWRRRR
Ga0073994_1235898913300030991SoilIEISDQQTRFVPITDRKKLTGVLLAGIGFGMWLGWNRRR
Ga0074036_1077925513300031049SoilAWAIPMGVIEVSDQQTRFVPITDRKRLAGAVLAGIGLGMLLGWRRRR
Ga0170823_1494004733300031128Forest SoilVSDQQTRFVPITDRKRLAGAVLVGIGLGMLLDWRRRR
Ga0170824_12786869613300031231Forest SoilGVIEVSDQQTRFVPITDRKRLAGAVLAGIGLGILLGWRRRR
Ga0302307_1020863013300031233PalsaGVIEISGQQTRFIPITSRKKLTGAVIAGILLGISLGWRRRRR
Ga0302324_10027439243300031236PalsaLRAIPVGVIEISGQQTRFIPITSRKKLTGAVIAGILLGISLGWRRRRR
Ga0310686_11045199713300031708SoilGVRAIPVGVIEVSDQQTRFIPITSRKKMAGALFAGSLLGIFLGWRRRR
Ga0265314_1036686313300031711RhizosphereTVPVGVIEISGQRTCFVPITDRKKLAGAILAGIGLGLWLGWRRRL
Ga0310813_1055015733300031716SoilGVRAVPVGVIEVSNQQTRFVPITDRKKLTGALLAGIGFGMWLAWSRRR
Ga0307474_1016496713300031718Hardwood Forest SoilGVIEVSQEQTRFIPITSRRKLAGAVFAGIVLGLTLSLRRRRH
Ga0307474_1042679723300031718Hardwood Forest SoilEGGSGGGGVLAIPAGVMEISDQQTRFVPITDRKKLAGAVLAGIGFGMWLGWRRRR
Ga0307474_1067946623300031718Hardwood Forest SoilRAVPVGVIEVSHQQTRFVPITDRKKLSGAVLAGIGLGMWLGWRRRR
Ga0307468_10170479613300031740Hardwood Forest SoilGGGVRAVPVGVIEVSDQQTRFVPITDRKKLTGAVLAGIGIGMWLSWHRRR
Ga0307475_1041256813300031754Hardwood Forest SoilVGVIEVSEQQTRFVPISDRKKLTGAVLAGIVFGMWMGWRGLRRH
Ga0307479_1007686773300031962Hardwood Forest SoilGVRAIPVGVIEVSDQQTRFVPITDRKKLTGAVLAGIGLGMFLGWRRRR
Ga0307479_1011062423300031962Hardwood Forest SoilMARAVPVGVVEVSKAANRFVPITDRKKLAGTLRTGIGLGILFGRRRRH
Ga0306922_1047804513300032001SoilGAGGVRAIPVGVIEVSNQQTRFVPITDRKKLTGAVLTGVGLGIWLGWRRRR
Ga0307471_10418583613300032180Hardwood Forest SoilVSNQQTRFVPISDKRKLVGAVLAGISFGIWWGWRRHR
Ga0348332_1164510323300032515Plant LitterAGVRAIPVGVIEVSDQQTRFIPITSRKKMAGAVFVGSLLGIFLGWRKRR
Ga0335080_1141256523300032828SoilGVRAVPVGVIEISNQPTRFVSINDKKKLTGAVIAGIGLGMWLGWRRRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.