NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064139

Metagenome / Metatranscriptome Family F064139

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064139
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 48 residues
Representative Sequence HAFVHGLTFGMRVSAVICLGGALAAAALIRKYRHAEQAQPLAEAA
Number of Associated Samples 114
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 85.27 %
% of genes from short scaffolds (< 2000 bps) 79.84 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.519 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(17.829 % of family members)
Environment Ontology (ENVO) Unclassified
(28.682 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.163 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 58.90%    β-sheet: 0.00%    Coil/Unstructured: 41.10%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF00440TetR_N 31.01
PF13560HTH_31 28.68
PF13977TetR_C_6 23.26
PF12844HTH_19 1.55
PF07883Cupin_2 0.78
PF01381HTH_3 0.78
PF03109ABC1 0.78
PF01676Metalloenzyme 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.52 %
UnclassifiedrootN/A22.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c0678956Not Available569Open in IMG/M
3300000956|JGI10216J12902_109636736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300000956|JGI10216J12902_117357108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium719Open in IMG/M
3300004114|Ga0062593_101176661All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300004479|Ga0062595_101727708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium590Open in IMG/M
3300005093|Ga0062594_102854302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300005172|Ga0066683_10444590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300005184|Ga0066671_10057531All Organisms → cellular organisms → Bacteria1997Open in IMG/M
3300005186|Ga0066676_10761388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300005186|Ga0066676_11166729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300005187|Ga0066675_10094524All Organisms → cellular organisms → Bacteria1959Open in IMG/M
3300005187|Ga0066675_11305410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300005332|Ga0066388_107333337Not Available554Open in IMG/M
3300005341|Ga0070691_10344637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium826Open in IMG/M
3300005435|Ga0070714_100055968All Organisms → cellular organisms → Bacteria3372Open in IMG/M
3300005438|Ga0070701_10160541All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300005446|Ga0066686_10921228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300005451|Ga0066681_10506162All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300005451|Ga0066681_10510716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium741Open in IMG/M
3300005455|Ga0070663_101106210Not Available693Open in IMG/M
3300005540|Ga0066697_10333004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium887Open in IMG/M
3300005547|Ga0070693_100725432Not Available730Open in IMG/M
3300005556|Ga0066707_10954078All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300005598|Ga0066706_10594448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia879Open in IMG/M
3300005614|Ga0068856_100838572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium938Open in IMG/M
3300005840|Ga0068870_10455257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium844Open in IMG/M
3300005842|Ga0068858_100799558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium920Open in IMG/M
3300005843|Ga0068860_100389095All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300006032|Ga0066696_10883934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300006049|Ga0075417_10262005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium831Open in IMG/M
3300006163|Ga0070715_10589594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium650Open in IMG/M
3300006237|Ga0097621_100052498All Organisms → cellular organisms → Bacteria3321Open in IMG/M
3300006755|Ga0079222_10687492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium806Open in IMG/M
3300006755|Ga0079222_10722255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300006755|Ga0079222_12285332Not Available539Open in IMG/M
3300006806|Ga0079220_10649994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300006845|Ga0075421_100417776All Organisms → cellular organisms → Bacteria1607Open in IMG/M
3300006854|Ga0075425_100647614All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300006881|Ga0068865_100632529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium908Open in IMG/M
3300007076|Ga0075435_100301759All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300009012|Ga0066710_103021660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium654Open in IMG/M
3300009012|Ga0066710_103378718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300009137|Ga0066709_102683790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium664Open in IMG/M
3300009174|Ga0105241_10109335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2211Open in IMG/M
3300009553|Ga0105249_10461407All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300010303|Ga0134082_10066819All Organisms → cellular organisms → Bacteria1395Open in IMG/M
3300010303|Ga0134082_10183245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium853Open in IMG/M
3300010326|Ga0134065_10392151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300010329|Ga0134111_10057684All Organisms → cellular organisms → Bacteria1423Open in IMG/M
3300010335|Ga0134063_10462606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300010375|Ga0105239_10469271All Organisms → cellular organisms → Bacteria1429Open in IMG/M
3300010403|Ga0134123_13406291Not Available514Open in IMG/M
3300011119|Ga0105246_11810898Not Available584Open in IMG/M
3300012198|Ga0137364_11196469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300012356|Ga0137371_10016455All Organisms → cellular organisms → Bacteria5679Open in IMG/M
3300012362|Ga0137361_11022394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300012514|Ga0157330_1087248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300012904|Ga0157282_10008841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1757Open in IMG/M
3300012938|Ga0162651_100070832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300012984|Ga0164309_10831910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300012984|Ga0164309_10947133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium705Open in IMG/M
3300012988|Ga0164306_10219685All Organisms → cellular organisms → Bacteria1345Open in IMG/M
3300013102|Ga0157371_10783822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300014969|Ga0157376_11992895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300015356|Ga0134073_10032446All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300015356|Ga0134073_10266168Not Available598Open in IMG/M
3300015357|Ga0134072_10264735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium625Open in IMG/M
3300015373|Ga0132257_101324179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium915Open in IMG/M
3300017654|Ga0134069_1217526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium656Open in IMG/M
3300019789|Ga0137408_1262248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3331Open in IMG/M
3300020006|Ga0193735_1018527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2165Open in IMG/M
3300020170|Ga0179594_10131316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium918Open in IMG/M
3300021080|Ga0210382_10252258All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium772Open in IMG/M
3300021080|Ga0210382_10541435Not Available516Open in IMG/M
3300021344|Ga0193719_10081087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriales incertae sedis → Clostridiales Family XVII. Incertae Sedis1410Open in IMG/M
3300024055|Ga0247794_10000114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10699Open in IMG/M
3300024187|Ga0247672_1071789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300025899|Ga0207642_10152887All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300025906|Ga0207699_10783843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium700Open in IMG/M
3300025908|Ga0207643_10423199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium844Open in IMG/M
3300025934|Ga0207686_10090846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2015Open in IMG/M
3300026285|Ga0209438_1112487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium792Open in IMG/M
3300026300|Ga0209027_1082071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1184Open in IMG/M
3300026312|Ga0209153_1095636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1111Open in IMG/M
3300026316|Ga0209155_1007749All Organisms → cellular organisms → Bacteria4754Open in IMG/M
3300026805|Ga0207507_103961Not Available558Open in IMG/M
3300027717|Ga0209998_10180946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300027909|Ga0209382_10813345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium993Open in IMG/M
3300027909|Ga0209382_11661626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300028380|Ga0268265_12404068Not Available533Open in IMG/M
3300028708|Ga0307295_10013400All Organisms → cellular organisms → Bacteria1962Open in IMG/M
3300028711|Ga0307293_10132534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium793Open in IMG/M
3300028716|Ga0307311_10026483All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300028717|Ga0307298_10111082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium783Open in IMG/M
3300028755|Ga0307316_10182447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium753Open in IMG/M
3300028771|Ga0307320_10237596Not Available717Open in IMG/M
3300028784|Ga0307282_10148241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1110Open in IMG/M
3300028807|Ga0307305_10173351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium995Open in IMG/M
3300028811|Ga0307292_10240197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium751Open in IMG/M
3300028812|Ga0247825_11064022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium589Open in IMG/M
3300028819|Ga0307296_10035081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2647Open in IMG/M
3300028819|Ga0307296_10310130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium861Open in IMG/M
3300028875|Ga0307289_10056126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1579Open in IMG/M
3300028884|Ga0307308_10308422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium758Open in IMG/M
3300030511|Ga0268241_10028375Not Available1129Open in IMG/M
3300031731|Ga0307405_11782164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300031824|Ga0307413_10412817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1061Open in IMG/M
3300031939|Ga0308174_11560373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300031995|Ga0307409_100608722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1081Open in IMG/M
3300031995|Ga0307409_102427555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium553Open in IMG/M
3300032205|Ga0307472_102514400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300032421|Ga0310812_10157259All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300034172|Ga0334913_037825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1037Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil13.18%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.10%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.10%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.33%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.55%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.55%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012380Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026300Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026805Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-A (SPAdes)EnvironmentalOpen in IMG/M
3300027717Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_067895613300000033SoilHAFVHGLTFGMRVSAVICLGGALAAAALIRKYRHAEQAQPLAEAA*
JGI10216J12902_10963673623300000956SoilVHGLTFAMKVSALICFGAAIAAAVLVRRYRHAEPTEQTAELAA*
JGI10216J12902_11735710813300000956SoilAPPQAFVDGLTFGMRVSAAICFGAAIAAAVLVRRYRHADSSHPVEAAA*
Ga0063454_10193664923300004081SoilQVGVALGIGIMGAIIANRATAARHGGASGPEAFVHGLTFGMRVSAVICFGAAIAAAALVRRYSHVEQAERPLEAAA*
Ga0062593_10117666123300004114SoilGADPPHAFVHGLTFGMRVSAAICLGGAIAAVALIRKVRHAEQVQPLAEAA*
Ga0062595_10172770813300004479SoilVDGLTFAMKVSAGICLAAAIAAAVLVRKYRHAEDQSRPVEAAA*
Ga0062594_10285430213300005093SoilFIPKVGPPPQAFVYGLTFGMKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA*
Ga0066683_1044459013300005172SoilAGADPPHAFVHGLTFGMRVSAVICLGGAFAAAALIRQYRHAEQAQPLAEAA*
Ga0066671_1005753133300005184SoilTFGMRVSAVICLGGAVAAAALVRNYRHAEEEETRLAEAA*
Ga0066676_1076138813300005186SoilPPHAFVHGLTFGMRVSALICLGAAVAAAVLVRKYRHAEQAQPLAEAA*
Ga0066676_1116672923300005186SoilAAHGGPPPQAFVYGLTFGMRVSAVICLGAAVTAAALVRRYRHVEESERALEAAA*
Ga0066675_1009452413300005187SoilGGASGPQAFVDGLTFAMKVSAGICFAAAIAAAVLVRKYRHAEDQGQPVEVAA*
Ga0066675_1130541023300005187SoilGGASPPEAFVHGLTFAMKVSALICFGAAISATVLVRKYRHAEESEQPAELAA*
Ga0066388_10733333713300005332Tropical Forest SoilAARHAGADPAHAFVHGLTFAMRVSALICFGAAIAAALLVRKIRHPAEQTQPLAEAA*
Ga0070691_1034463733300005341Corn, Switchgrass And Miscanthus RhizosphereHAFVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA*
Ga0070692_1044065523300005345Corn, Switchgrass And Miscanthus RhizosphereLGIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAVALIRNYRHAEQAQPLAEAA*
Ga0070714_10005596863300005435Agricultural SoilRAGADPSHAFVHGLTFGMRVSAVICLGGALAAALLIRQYRQADQVQTLAEAA*
Ga0070701_1016054133300005438Corn, Switchgrass And Miscanthus RhizospherePHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0066686_1092122813300005446SoilLRAGDDGPHAFVHGLTFGMRVSAVICFGAAIAAAVLVRKYQHAEQAQPLAEAA*
Ga0066681_1050616213300005451SoilAFVHGLTFAMRVSAVICLGGAVAAAVLVRKYRHAEQAQPLAEAA*
Ga0066681_1051071613300005451SoilDPAHAFVHGLTFAMRVSGLICFGAALAAAVLVRKVRHAEQAQPLAEAA*
Ga0070663_10110621013300005455Corn RhizosphereGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA*
Ga0070698_10109884413300005471Corn, Switchgrass And Miscanthus RhizosphereAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0070697_10035229233300005536Corn, Switchgrass And Miscanthus RhizosphereVGVALGIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0068853_10241220013300005539Corn RhizosphereVALGIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0066697_1033300413300005540SoilMRVSALICFGAAVAAALLVRKVRHADEQAQPVAEAA*
Ga0070696_10045608833300005546Corn, Switchgrass And Miscanthus RhizosphereRQVGVALGIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0070693_10072543223300005547Corn, Switchgrass And Miscanthus RhizosphereITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0066707_1095407813300005556SoilGADPPHAFVHGLTFGMRVSALICLGAAVAAAVLVRKYRHAEQAQPLAEAA*
Ga0066706_1059444813300005598SoilAGADPPHAFVHGLTFGMRVSAVICLGGAVAAAALIRKYRYAEQAQPLAEAA*
Ga0068856_10083857213300005614Corn RhizosphereVYGLTFGMKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA*
Ga0068861_10078500723300005719Switchgrass RhizosphereGIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0068870_1045525723300005840Miscanthus RhizosphereMKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA*
Ga0068858_10079955833300005842Switchgrass RhizosphereFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0068860_10038909523300005843Switchgrass RhizosphereGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0066696_1088393423300006032SoilGMRVSAAICFGAAIAAAVLVRRYRHAESGQPVEVGA*
Ga0075417_1026200523300006049Populus RhizosphereHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA*
Ga0070715_1058959423300006163Corn, Switchgrass And Miscanthus RhizosphereVYGLTFGMKVSAGICFGAAIAAATLVRKYRHAESGQAVEVAA*
Ga0097621_10005249813300006237Miscanthus RhizosphereLTFGMKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA*
Ga0079222_1068749213300006755Agricultural SoilAFVYGLTFGMKVSAAICFAAAVAAATLVRRYRHADASTPVEAAA*
Ga0079222_1072225523300006755Agricultural SoilAVVYGLPFGLKVSAGLCFGAAIAAATLVRKYRHAEAGQPVEVGA*
Ga0079222_1228533213300006755Agricultural SoilEAYVYGLTVAMKVSAAICFGAAIAAATLVRRYRHAESSAREVEVAA*
Ga0079220_1064999413300006806Agricultural SoilPPQAFVHGLTFGMRVSAAICLGAALAAAVLVRQYRHADAEQRRPVAEAA*
Ga0075421_10041777633300006845Populus RhizosphereLTFAMKVSALICLGGAVAAAVLIRRYRHADSSQPVEVAA*
Ga0075425_10064761413300006854Populus RhizosphereFVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA*
Ga0068865_10063252913300006881Miscanthus RhizosphereGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0075435_10030175913300007076Populus RhizosphereFVYGLTYGMKVSAAICFAAAIAAAVLVRKYRHAEDVPALEVAA*
Ga0066710_10302166023300009012Grasslands SoilGLTFGMRVSAVICLGGAVAAAALVRKYRHAEQAQPLAEAA
Ga0066710_10337871823300009012Grasslands SoilMKVSAVICFGAAIAAAALVRKYRHAEEASQPAEIAA
Ga0066709_10268379023300009137Grasslands SoilGLTFGMRVSAVICLGGAVAAAALVRKYRHAEQAQPLAEAA*
Ga0105241_1010933513300009174Corn RhizosphereGMKVSAAICFAAAVAAATLVRRYRHADASTPVEAAA*
Ga0105242_1010542543300009176Miscanthus RhizosphereIAIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0105249_1046140723300009553Switchgrass RhizosphereRAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0134082_1006681913300010303Grasslands SoilVHGLTFGMRVSALICLGAAVAAAVLVRKYRHAEQAQPLAEAA*
Ga0134082_1018324513300010303Grasslands SoilDRPHAFVHGLTFAMRVSALICFGAALAAAVLVRKVRHAEQAQPLAEAA*
Ga0134065_1039215113300010326Grasslands SoilARGGASPPEAFVHGLTFAMKVSALICFGAAIAAAVLVRRYRHAEPSEQPVELAA*
Ga0134111_1005768413300010329Grasslands SoilREAAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA*
Ga0134063_1046260623300010335Grasslands SoilAGDDGPHAFVHGLTFGMRVSAVICFGAAIAAAVLVRKYQHAEQAQPLAEAA*
Ga0105239_1046927123300010375Corn RhizosphereHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQPQPLAEAA*
Ga0134123_1340629113300010403Terrestrial SoilGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0105246_1181089813300011119Miscanthus RhizosphereGADPPHAFVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA*
Ga0137364_1119646923300012198Vadose Zone SoilVHGLTFAMRVSAAICLGAAIVAATLVRRYRHVEASQPLEAAA*
Ga0137387_1010139913300012349Vadose Zone SoilGAFITYREAAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA*
Ga0137371_1001645523300012356Vadose Zone SoilMRVSAVICFAAAVAAAALVRKYRHAEQAQPLAEAA*
Ga0137361_1102239413300012362Vadose Zone SoilEAAALRAGADPPHAFVHGLTSGMRVSAAICLGGAVVAALLIRQYRQVDQVQPLAEAA*
Ga0134047_125720423300012380Grasslands SoilVVNRAAAAARDGTSPPEAFVHGLTFAMKVSALICFGAAVAAAVLVRKYQHGEASKSKPAELAA*
Ga0157330_108724813300012514SoilAFVHGLTFAMKVSALICLGGAIAAGVLIRRYRHAESSQPVEVAA*
Ga0157282_1000884133300012904SoilTFAMKISALICLGGGIAAAALIRRYRHADSSQPVEVAA*
Ga0162651_10007083213300012938SoilPEAFVHGLTFGMKVSAAICLGGAIAAAALVRRYRHAESSQAAEAPA*
Ga0164301_1185205713300012960SoilGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLPEAA*
Ga0164309_1083191023300012984SoilLRAGADLPHAFVHGLTVGMRVSAVICLGGAAVAALLIRQYRQADQVQPLAEAA*
Ga0164309_1094713313300012984SoilAAGGASPPEAFVPGLTFAMRVSAAICFGAAIIAATLVRRYRHADSSLPLEATA*
Ga0164306_1021968533300012988SoilAFVHGLTFGMRVSAVICFGGAIAAATLVRRYRHAEASQPLEAAA*
Ga0157371_1078382213300013102Corn RhizosphereMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA*
Ga0157376_1199289513300014969Miscanthus RhizosphereASHGGPAPEAFVYGLTFGMKVSAAICFAAAVAAATLVRRYRHADASTPVEAAA*
Ga0134073_1003244633300015356Grasslands SoilAALRAGDDGPHAFVHGLTFGMRVSAVICFGAAIAAAVLVRKYRHAEQAQPLAEAA*
Ga0134073_1026616813300015356Grasslands SoilGADQPHAFVHGLTFAMRVSALICFGAALAAAVLVRKVRHAEQAQPLAEAA*
Ga0134072_1026473523300015357Grasslands SoilDGLTFAMKVSAGICFAAAIAAAVLVRRYRHAEESGQPVEAAA*
Ga0132257_10132417923300015373Arabidopsis RhizospherePPPQAFVYGLTFGLKVSAGICFGAAIAAATLVRKYRHAESGQAVEVAA*
Ga0134069_121752613300017654Grasslands SoilAAAARGGASPPEAFVHGLTFAMKVSALICFGAAIAAAVLVRRYRHAEPSEQPVELAA
Ga0137408_126224843300019789Vadose Zone SoilAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA
Ga0193735_101852713300020006SoilIAIMGAIIANRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA
Ga0179594_1013131623300020170Vadose Zone SoilMRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA
Ga0210381_1009459223300021078Groundwater SedimentIMGAIITNRETAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA
Ga0210382_1025225813300021080Groundwater SedimentEAAALRAGDDGPHAFVHGLTFGMRVSAVICLGGALAAAVLVRKYRHAEQAQPLAEAA
Ga0210382_1054143513300021080Groundwater SedimentGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA
Ga0193719_1008108733300021344SoilGLTFAMRVSAVICFAGALAAALLVRQYRQADQTQALAEPA
Ga0247794_10000114133300024055SoilLTFAMKISALICLGGAIAAAALIRRYRHADSSQPVEVAA
Ga0247672_107178913300024187SoilLHAGASPQQAFVDGLTFGMRVSAAICLAAAVAAAVLVRRYRHAEEESSRPVEVAA
Ga0207642_1015288713300025899Miscanthus RhizosphereDPPHAFVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA
Ga0207699_1078384313300025906Corn, Switchgrass And Miscanthus RhizosphereTFGMKVSAGICFGAAIAAATLVRKYRHAESGQAVEVAA
Ga0207643_1042319913300025908Miscanthus RhizosphereMKVSAGICFGAAIAAATLVRKYRHAEAGQPVEVGA
Ga0207646_1021193813300025922Corn, Switchgrass And Miscanthus RhizosphereMGAIITNREAAALRAGADPSHAFVHGLTFGMRVSAVICLGGALAAALLIRQYRQADQVQTLAEAA
Ga0207686_1009084613300025934Miscanthus RhizosphereADPPHAFVHGLTFAMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA
Ga0207670_1171520413300025936Switchgrass RhizosphereGMRVSAVICLGAAVAAATLVRRYRHSEASTPVEAAA
Ga0209438_111248713300026285Grasslands SoilDPPHAFVHGLTFGMRVSAVICLGGALAAAALIRKYRYAEQAQPLAEAA
Ga0209027_108207113300026300Grasslands SoilPQAFVYGLTFGMRVSAVICLGAAVAAATLVRRYRHVEESERALEAAA
Ga0209153_109563623300026312SoilTFGMRVSAVICLGGAVAAAALVRNYRHAEEEETRLAEAA
Ga0209155_100774983300026316SoilMRVSALICFGAALAAAVLVRKVRHAEQAQPLAEAA
Ga0207507_10396113300026805SoilLTFGMRVSAVICLGGAVAAAALIRKYRHVEQVQPLAEAA
Ga0209998_1018094623300027717Arabidopsis Thaliana RhizosphereHGLTFAMKISALICLGGAIAAAALIRRYRHADSSQPVEVAA
Ga0209382_1081334523300027909Populus RhizospherePPEAFVHGLTFAMKVSALICLGGAVAAAVLIRRYRHADSSQPVEVAA
Ga0209382_1166162613300027909Populus RhizosphereEAFVHGLTFAMRVSAAICLGAAIVAATLVRRYRHVEASQPLEAAA
Ga0268265_1240406813300028380Switchgrass RhizospherePPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA
Ga0307295_1001340033300028708SoilARAGADPPHAFVHGLTFGMRVSAIICLAGALAALALIRKQQPFEQSEALLEAA
Ga0307293_1013253413300028711SoilIITNREAAALRGGADPPHAFVHGLTFGMRVSAVICFAGALAAALLVRQYRQADQTQALAEPA
Ga0307311_1002648323300028716SoilGMRVSAVICLGGALAAVALIRKYRYAEQAQPLAEAA
Ga0307298_1011108223300028717SoilTFGMRVSAAICFGGALAAAILVRRYRHADAGHPVEAAA
Ga0307316_1018244713300028755SoilAAAADGASPPQAFVHGLTFGMRVSAVICFGAAIAAATLVRRYRHADASQPLEAAA
Ga0307320_1023759623300028771SoilAAARAGADPPHAFVHGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA
Ga0307282_1014824113300028784SoilGLTFGMRVSAAICFGGALAAAILVRRYRHADAGHPVEAAA
Ga0307305_1017335113300028807SoilPPHAFVHGLTFGMRVSAVICFAGALAAALLVRQYRQADQTQALAEPA
Ga0307292_1024019713300028811SoilGLTFGMKVSAAICFGAAIAAAVLVRKYRHAEESSQPVEVAA
Ga0247825_1106402223300028812SoilTYAMRVSALICFGAAIVAATLVRRYRHVEASQPVEAAA
Ga0307296_1003508133300028819SoilGASPPEAFVHGLTFGMRVSAAICFGGALAAAILVRRYRHADAGHPVEAAA
Ga0307296_1031013013300028819SoilGLTYGMRVSAVICLGGALAAALLVRKYRHADQPQPLAEAA
Ga0307289_1005612633300028875SoilPPEAFVHGLTFGMRVSAAICFGGALAAAILVRRYRHADAGRPVEAAA
Ga0307308_1019468223300028884SoilGVALGIAIMGAIITNREAAAARGGADPPHAFVHGLTFGMRVSAVICLGGALAAAVLVRKYRHAEQAQPLAEAA
Ga0307308_1030842213300028884SoilLTFGMRVSAVICFAGALAAALLVRQYRQADQTQALAEPA
Ga0268241_1002837523300030511SoilAMRVSALICFGAAIAAAVLVRKVRHAEQQAQPLAEAA
Ga0307405_1178216423300031731RhizosphereSAHEGASPPEAFVHGLTFAMKVSAAICLGAAIAAAVLVRRYRHAESSQPAEAAA
Ga0307473_1094083223300031820Hardwood Forest SoilGIAIMGAIITNRVAAALRAGADPSHAFVHGLTFGMRVSAVICLGGALAAALLIRQYRQADQVQTLAEAA
Ga0307413_1041281713300031824RhizosphereSPPEAFVHGLTFAMKVSAVICFGAAIAAAVLVRRYRHAESSQPAEAAA
Ga0308174_1156037323300031939SoilLTFGMRVSAVICFGAAVVAATLIRRYRHADASRPVEAEAAA
Ga0307409_10060872213300031995RhizosphereSQPQAFVDGLTFAMKVSAVICFAAAIAAAVLVRRYRHAEEAQPLEAAA
Ga0307409_10242755523300031995RhizosphereEGASPPEAFVHGLTFAMKVSAAICLGAAIAAAVLVRRYRHAESSQPAEAAA
Ga0307472_10251440013300032205Hardwood Forest SoilMRVSAVICLGGAAAAAVLIRKYRHVEQAQPLAEAA
Ga0310812_1015725923300032421SoilGLTFGMRVSAVICLGGALAAAALIRNYRHAEQAQPLAEAA
Ga0334913_037825_9_1163300034172Sub-Biocrust SoilMRVSAAICFCAAIAAAVLVRRYRHVESSHPAEAAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.