NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064160

Metagenome / Metatranscriptome Family F064160

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064160
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 51 residues
Representative Sequence VKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSGGPRRDR
Number of Associated Samples 111
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 53.12 %
% of genes near scaffold ends (potentially truncated) 14.73 %
% of genes from short scaffolds (< 2000 bps) 58.14 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.372 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.279 % of family members)
Environment Ontology (ENVO) Unclassified
(51.938 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(55.814 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF12840HTH_20 6.20
PF04116FA_hydroxylase 3.88
PF13450NAD_binding_8 3.10
PF05187ETF_QO 3.10
PF00440TetR_N 1.55
PF00296Bac_luciferase 1.55
PF02817E3_binding 1.55
PF00561Abhydrolase_1 1.55
PF03538VRP1 0.78
PF01642MM_CoA_mutase 0.78
PF00497SBP_bac_3 0.78
PF00293NUDIX 0.78
PF03364Polyketide_cyc 0.78
PF027373HCDH_N 0.78
PF14417MEDS 0.78
PF04343DUF488 0.78
PF12680SnoaL_2 0.78
PF01196Ribosomal_L17 0.78
PF02771Acyl-CoA_dh_N 0.78
PF00486Trans_reg_C 0.78
PF03853YjeF_N 0.78
PF01040UbiA 0.78
PF00145DNA_methylase 0.78
PF00117GATase 0.78
PF01435Peptidase_M48 0.78
PF02583Trns_repr_metal 0.78
PF00890FAD_binding_2 0.78
PF13581HATPase_c_2 0.78
PF13420Acetyltransf_4 0.78
PF05974DUF892 0.78
PF01594AI-2E_transport 0.78
PF13738Pyr_redox_3 0.78
PF13471Transglut_core3 0.78
PF01625PMSR 0.78
PF01923Cob_adeno_trans 0.78
PF00743FMO-like 0.78
PF01370Epimerase 0.78
PF13524Glyco_trans_1_2 0.78
PF13419HAD_2 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 3.88
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 3.10
COG2440Ferredoxin-like protein FixXEnergy production and conversion [C] 3.10
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 1.55
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.55
COG0062NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domainNucleotide transport and metabolism [F] 0.78
COG0203Ribosomal protein L17Translation, ribosomal structure and biogenesis [J] 0.78
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 0.78
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.78
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 0.78
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.78
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.78
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.78
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.78
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.78
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.78
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.78
COG1937DNA-binding transcriptional regulator, FrmR familyTranscription [K] 0.78
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.78
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.78
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.78
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.78
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.37 %
UnclassifiedrootN/A11.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104483200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300001405|JGI20186J14852_1001398All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300002568|C688J35102_118830074Not Available602Open in IMG/M
3300002568|C688J35102_120677662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1338Open in IMG/M
3300002568|C688J35102_120987136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7185Open in IMG/M
3300002568|C688J35102_120988268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8430Open in IMG/M
3300002906|JGI25614J43888_10116537Not Available696Open in IMG/M
3300003320|rootH2_10207288All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300004643|Ga0062591_102036813All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300005329|Ga0070683_100009440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8344Open in IMG/M
3300005330|Ga0070690_100386754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1024Open in IMG/M
3300005332|Ga0066388_104164145Not Available737Open in IMG/M
3300005335|Ga0070666_10056798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2644Open in IMG/M
3300005337|Ga0070682_100000026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia191388Open in IMG/M
3300005354|Ga0070675_100000070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria59599Open in IMG/M
3300005365|Ga0070688_100000028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria67085Open in IMG/M
3300005367|Ga0070667_100699400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria938Open in IMG/M
3300005434|Ga0070709_11036936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales654Open in IMG/M
3300005436|Ga0070713_100000005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria201526Open in IMG/M
3300005437|Ga0070710_11426123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300005535|Ga0070684_100008294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter8116Open in IMG/M
3300005535|Ga0070684_100959710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300005544|Ga0070686_101482667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300005548|Ga0070665_100001275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia30231Open in IMG/M
3300005548|Ga0070665_101513085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300005577|Ga0068857_100265991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1575Open in IMG/M
3300005578|Ga0068854_100000268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria35449Open in IMG/M
3300005578|Ga0068854_101684923Not Available579Open in IMG/M
3300005587|Ga0066654_10686981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300005614|Ga0068856_100000136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia74026Open in IMG/M
3300005719|Ga0068861_100053572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium3070Open in IMG/M
3300005841|Ga0068863_100177894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2042Open in IMG/M
3300006163|Ga0070715_10256738All Organisms → cellular organisms → Bacteria → Proteobacteria916Open in IMG/M
3300006237|Ga0097621_100161549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1926Open in IMG/M
3300006804|Ga0079221_10118853All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1332Open in IMG/M
3300006881|Ga0068865_100000040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria72979Open in IMG/M
3300006881|Ga0068865_100343101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1208Open in IMG/M
3300009098|Ga0105245_10000117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria76863Open in IMG/M
3300009098|Ga0105245_10150534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2200Open in IMG/M
3300009174|Ga0105241_10080653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2547Open in IMG/M
3300009177|Ga0105248_10000037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria180751Open in IMG/M
3300009551|Ga0105238_12365053Not Available567Open in IMG/M
3300009840|Ga0126313_10051481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter2905Open in IMG/M
3300009840|Ga0126313_10301044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1254Open in IMG/M
3300009840|Ga0126313_10557744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300010335|Ga0134063_10525953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium595Open in IMG/M
3300010371|Ga0134125_10172639All Organisms → cellular organisms → Bacteria2409Open in IMG/M
3300010375|Ga0105239_10448224All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300010375|Ga0105239_10549379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1315Open in IMG/M
3300012496|Ga0157353_1032967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300012892|Ga0157294_10102275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300012929|Ga0137404_12167909All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300012955|Ga0164298_10796010All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012961|Ga0164302_10693253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium753Open in IMG/M
3300012961|Ga0164302_11707042Not Available528Open in IMG/M
3300012977|Ga0134087_10127102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1090Open in IMG/M
3300012988|Ga0164306_10066307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2246Open in IMG/M
3300013100|Ga0157373_10184721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1469Open in IMG/M
3300013102|Ga0157371_10004648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11895Open in IMG/M
3300013105|Ga0157369_10000051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria165672Open in IMG/M
3300013296|Ga0157374_10437460All Organisms → cellular organisms → Bacteria1308Open in IMG/M
3300013296|Ga0157374_10455796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1280Open in IMG/M
3300013306|Ga0163162_10311292All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300013307|Ga0157372_10000146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia77952Open in IMG/M
3300013308|Ga0157375_12770275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium586Open in IMG/M
3300014326|Ga0157380_10463486All Organisms → cellular organisms → Bacteria1220Open in IMG/M
3300014487|Ga0182000_10097425All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria981Open in IMG/M
3300014968|Ga0157379_11778515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300014969|Ga0157376_12590878Not Available547Open in IMG/M
3300015197|Ga0167638_1079480Not Available660Open in IMG/M
3300015200|Ga0173480_10073156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1600Open in IMG/M
3300015264|Ga0137403_10985766All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300015374|Ga0132255_105133318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300018433|Ga0066667_10519951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium983Open in IMG/M
3300018920|Ga0190273_10222040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1201Open in IMG/M
3300019356|Ga0173481_10247250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium801Open in IMG/M
3300019889|Ga0193743_1035870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2311Open in IMG/M
3300020061|Ga0193716_1066717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1630Open in IMG/M
3300020070|Ga0206356_10121768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3049Open in IMG/M
3300020081|Ga0206354_11297909Not Available686Open in IMG/M
3300020082|Ga0206353_10368780Not Available1010Open in IMG/M
3300020181|Ga0196958_10058522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1207Open in IMG/M
3300021339|Ga0193706_1000347All Organisms → cellular organisms → Bacteria28432Open in IMG/M
3300021339|Ga0193706_1089114All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300021363|Ga0193699_10085430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1261Open in IMG/M
3300022883|Ga0247786_1000480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6831Open in IMG/M
3300024055|Ga0247794_10004379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2991Open in IMG/M
3300024426|Ga0196960_10000054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria42593Open in IMG/M
3300025321|Ga0207656_10000285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria17446Open in IMG/M
3300025504|Ga0208356_1000005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia131014Open in IMG/M
3300025903|Ga0207680_10002080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9381Open in IMG/M
3300025905|Ga0207685_10217052Not Available907Open in IMG/M
3300025913|Ga0207695_10587833All Organisms → cellular organisms → Bacteria → Terrabacteria group994Open in IMG/M
3300025924|Ga0207694_11577223Not Available553Open in IMG/M
3300025926|Ga0207659_10000018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria156920Open in IMG/M
3300025927|Ga0207687_10000070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria77432Open in IMG/M
3300025927|Ga0207687_10087299All Organisms → cellular organisms → Bacteria2266Open in IMG/M
3300025928|Ga0207700_10000003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia500797Open in IMG/M
3300025938|Ga0207704_10000079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria58183Open in IMG/M
3300025938|Ga0207704_11000692All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300025941|Ga0207711_10000011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia518817Open in IMG/M
3300025944|Ga0207661_10000239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria36056Open in IMG/M
3300025986|Ga0207658_10453790All Organisms → cellular organisms → Bacteria1135Open in IMG/M
3300026067|Ga0207678_11149229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300026078|Ga0207702_10000202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria70333Open in IMG/M
3300026116|Ga0207674_11099927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium764Open in IMG/M
3300026118|Ga0207675_100076031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium3143Open in IMG/M
3300026142|Ga0207698_10002679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10595Open in IMG/M
3300026308|Ga0209265_1167685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300026319|Ga0209647_1025976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3518Open in IMG/M
3300027164|Ga0208994_1046588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300027895|Ga0209624_10007072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7379Open in IMG/M
3300028379|Ga0268266_10001389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria29082Open in IMG/M
3300028379|Ga0268266_10795391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium913Open in IMG/M
3300028712|Ga0307285_10000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria246966Open in IMG/M
3300028721|Ga0307315_10143089Not Available723Open in IMG/M
3300028754|Ga0307297_10044884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1346Open in IMG/M
3300028768|Ga0307280_10000021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria51932Open in IMG/M
3300028778|Ga0307288_10000004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia219644Open in IMG/M
3300028790|Ga0307283_10079882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium827Open in IMG/M
3300028876|Ga0307286_10261460Not Available635Open in IMG/M
3300030510|Ga0268243_1026695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300032080|Ga0326721_10000051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria96017Open in IMG/M
3300032205|Ga0307472_100017886All Organisms → cellular organisms → Bacteria3795Open in IMG/M
3300034000|Ga0334918_004875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1807Open in IMG/M
3300034172|Ga0334913_060134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300034173|Ga0334925_116913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300034687|Ga0334905_000676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4998Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.28%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.20%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere6.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.10%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.88%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.33%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.33%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil2.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.55%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.55%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.55%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.55%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.55%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.78%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.78%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Soil0.78%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001405Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015197Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020181Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10EnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300024426Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025504Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027164Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300030510Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2)EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034000Biocrust microbial communities from Mojave Desert, California, United States - 14HMCEnvironmentalOpen in IMG/M
3300034172Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMSEnvironmentalOpen in IMG/M
3300034173Biocrust microbial communities from Mojave Desert, California, United States - 21HNCEnvironmentalOpen in IMG/M
3300034687Soil microbial communities from Mojave Desert, California, United States - 1NOCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10448320013300000364SoilYGRVKLLLVPFAILAFILFLIVVGAIGLGVAFAVIYVFGRIWRLLNRGGPRLRS*
JGI20186J14852_100139833300001405Arctic Peat SoilVKFLLVPFAIVAFVLFLLLLGAIGLVVSMAVLSVSGRIWRLVMRR*
C688J35102_11883007423300002568SoilVKLLLIPFAILAFVLFLLVLGAIGFAVAFAVLAVLGRAWRLVSSGRPSRR*
C688J35102_12067766223300002568SoilVKLLFVPIAIVAFMIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARTR*
C688J35102_12098713673300002568SoilVKLLLIPVVIVAFVIFLLVLGAIGFAVAFGVLALLGRAWRLVAGGRHSR*
C688J35102_12098826853300002568SoilVKLILVPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLISGARPRPR*
JGI25614J43888_1011653723300002906Grasslands SoilVKFLLIPLGILAFVLFLLLLGAIGLAAAMSVLWVVGRVWRFVTGVGRARSA*
rootH2_1020728833300003320Sugarcane Root And Bulk SoilGRRRAPRSLVPSLLPSPLQDYAAVHILLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARTR*
Ga0062591_10203681323300004643SoilMVKVLLVPLAILAFVVFLLVLGAVGMAVSLAVLWVLGRVWRFVTRADRRDRRRQQT*
Ga0070683_10000944083300005329Corn RhizosphereLPLQDYGGVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYVCGAAWRLVAGGRRHNR*
Ga0070690_10038675423300005330Switchgrass RhizosphereLQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRDR*
Ga0066388_10416414513300005332Tropical Forest SoilVKLLLVPLAIVAFVVFLLVLGAIGFAVAFAVLAVLGRVWRLVTGGRRSP*
Ga0070666_1005679823300005335Switchgrass RhizosphereVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRDR*
Ga0070682_1000000261053300005337Corn RhizosphereVKLLLVPFAIVAFILFLLLLGAIGFAVAFAVLAVLGRAWRLVFRRAH*
Ga0070675_100000070553300005354Miscanthus RhizosphereVKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSRDPRRNR*
Ga0070688_100000028223300005365Switchgrass RhizosphereLKLLFVPIVVIAFVVFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGT*
Ga0070667_10069940023300005367Switchgrass RhizosphereVVKVLLVPLAILAFVVFLLVLGAIGMAVSLAVLWVFGRIWRFVSRVDRRDRRRQQT*
Ga0070709_1103693623300005434Corn, Switchgrass And Miscanthus RhizosphereVCVKFLLIPLAIVAFILFLLLLGAIGLVVAMGVLAFFGRIWRFVSGGSRGRTRSA*
Ga0070713_100000005443300005436Corn, Switchgrass And Miscanthus RhizosphereVKLLLIPLAIVAFVIFLLILGAIGLAVAFAVLYVLGKFWRLISRAGRPRRRRASA*
Ga0070710_1142612323300005437Corn, Switchgrass And Miscanthus RhizosphereLIPLAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRSRTR*
Ga0070684_10000829423300005535Corn RhizosphereVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYVCGAAWRLVAGGRRHNR*
Ga0070684_10095971023300005535Corn RhizosphereMAILAFVLFLLLLGAIGLAVSFAVLYVLGQAWRLVAGGRPRRR*
Ga0070686_10148266723300005544Switchgrass RhizosphereVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVIYVVGGAWRLVSGGRRRDR*
Ga0070665_10000127583300005548Switchgrass RhizosphereLQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRAS*
Ga0070665_10151308523300005548Switchgrass RhizosphereVKLLLVPLAVVAFVLFLLLLGAIGLAISFAVIYVVGGAWRLVTGGRRRNR*
Ga0068857_10026599123300005577Corn RhizosphereLQDYAGVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYAFGRAWRLVSRDPRPRR*
Ga0068854_100000268323300005578Corn RhizosphereVKLLLIPFAIVAFILFLLLLGAIGFAVAFAVLAVFGRAWRLVFRRSH*
Ga0068854_10168492323300005578Corn RhizosphereLQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAIAFAVIYVVGGAWRFVSGGRRRGR*
Ga0066654_1068698123300005587SoilDVKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGHARTHGTR*
Ga0068856_100000136333300005614Corn RhizosphereVKLLLIPFVVIAFVVFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARSGRSA*
Ga0068861_10005357233300005719Switchgrass RhizosphereVKVLFVPLAILAFVLFLLLLGAIGMAISMAVISAVGKLWRVASRADRRDRRRQQA*
Ga0068863_10017789423300005841Switchgrass RhizosphereVKLLFVPLAIVAFVLFLLVLGAIGLVVSMGVLAFFGKIWRVVMRR*
Ga0070715_1025673823300006163Corn, Switchgrass And Miscanthus RhizosphereVKLLLVPFAIVAFVLFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTS*
Ga0097621_10016154923300006237Miscanthus RhizosphereVKVLFVPLAILAFVLFLLVLGAIGMAISMAVISAFGKIWRVASRADRRDRRRQQA*
Ga0079221_1011885323300006804Agricultural SoilVKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARTR*
Ga0068865_100000040493300006881Miscanthus RhizosphereVKLLLIPFAILAFVIFLLVLGAIGFAVAFAVLAVLGRAWRLVSGGRPGRRRKAA*
Ga0068865_10034310123300006881Miscanthus RhizosphereVKLLFVPCAIVAFVLFLLLLGAIGLVVSMAVLAFFGKLWRLVMRR*
Ga0105245_10000117573300009098Miscanthus RhizosphereLKLLFVPILVIAFVVFLLVLGAIGFAVSFAVLAVLGRAWRLLSGGRSRGA*
Ga0105245_1015053423300009098Miscanthus RhizosphereVKLLLIPFAIVAFVLFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTG*
Ga0105241_1008065333300009174Corn RhizosphereVKLLLVPFAIVAFIFFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGH*
Ga0105248_100000371113300009177Switchgrass RhizosphereVKILFVPIVIVAFVLFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGA*
Ga0105238_1236505313300009551Corn RhizosphereLQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAIAFAVIYVVGGAWRFVSGGRRRAG*
Ga0126313_1005148143300009840Serpentine SoilMEDYGGVKLLFVPIVAVAFLIFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRPRRR*
Ga0126313_1030104423300009840Serpentine SoilVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVIYVVGGAWRLVAGGRRRNR*
Ga0126313_1055774423300009840Serpentine SoilVKVLFVPLAILAFIVFLLVLGTIGMAVSLAVLSVLGRLWRFVTGAKRRDRRRRQT*
Ga0134063_1052595313300010335Grasslands SoilSPESPVPSPLPLPLQDYAAVKLLLVPFAILAFVIFLLVLGAIGFAVAFAVLAVLGRAWRLVSGGRARTR*
Ga0134125_1017263933300010371Terrestrial SoilVKLLFVPFAIVAFVLFLLLLGAIGLVVSMGVLAFFGKIWRVVMRRY*
Ga0105239_1044822423300010375Corn RhizosphereVKFVLIPLGIVAFVLFLLMLGAIGLVAAMGVLSVFGRLWRVVMRR*
Ga0105239_1054937923300010375Corn RhizosphereVKLLLVPFAIVAFVLFLLLLGAIGFAVAFAVLAVLGRAWRLVFRGGGAR*
Ga0157353_103296723300012496Unplanted SoilVKLLLVPLAIFAFVLFLLVLGAIRLAVAFAVLAALGRAWRLAFRGRAPR*
Ga0157294_1010227513300012892SoilITCRSAAVGPITLQDYGGVKLLLVPLAIIAFVLFLLILGAIGLAISFAVLYVFSGAWRLVSGGRARGR*
Ga0137404_1216790923300012929Vadose Zone SoilVENRGVTLLLIPAAIVAFVLFLLLLGAIGLIVAMGVLWFFGRIWRLVMRR*
Ga0164298_1079601013300012955SoilVKLLLVPFAILAFIIFLIVVGAIGLGVAFAVIYVFGRIWRLLNRGGPRLRS*
Ga0164302_1069325323300012961SoilPIAIVAFVVFLLVLGAIGLAVAFAVLAVLGRLWRLVFRRGAAA*
Ga0164302_1170704223300012961SoilLPLQDYADVKLLLIPFAILAFVIFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSAGA*
Ga0134087_1012710223300012977Grasslands SoilVKLLLIPFAILAFVLFLLLLGAIGFAVAFAVLAVLGRAWRLVSGGRPSRR*
Ga0164306_1006630723300012988SoilVKLLFVPLAIVAFVLFLLLLGAIGLVISMGVLAFFGKVWRVIMRR*
Ga0157373_1018472123300013100Corn RhizosphereVKLLLIPFAILAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLISGGRPGRRRKTA*
Ga0157371_10004648133300013102Corn RhizosphereVHILLVPFAVVAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVAGGRARPR*
Ga0157369_100000511203300013105Corn RhizosphereLEDYGALKFLFVPIVVIAFVVFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGS*
Ga0157374_1043746013300013296Miscanthus RhizosphereVKLLFVPLAVVAFVLFLLVLGAIGLVVSVGVLAFFGKIWRVVMRR*
Ga0157374_1045579623300013296Miscanthus RhizosphereVKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRSGRRRKAA*
Ga0163162_1031129223300013306Switchgrass RhizosphereVVKVLLVPLAILAFVVFLLVLGAIGMAVSLAVLWVFGRVWRLISRADRRGRRRQQT*
Ga0157372_10000146643300013307Corn RhizosphereVKLLLIPFAIVAFILFLLLLGAIGFAVAFAVLAVFGRAWRLVFRRGH*
Ga0157375_1277027523300013308Miscanthus RhizosphereMKILFVPFAILAFLLFLLLLGAIGLAVATAVLAMLGRVWRFVMRR*
Ga0157380_1046348633300014326Switchgrass RhizosphereLPLQDYAGVKLLLVPLAILAFVFFLLVLGAIGLAISFAVIYVVGGAWRLVSGGRRRAG*
Ga0182000_1009742523300014487SoilVKLLFVPIVVAAFLVFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGA*
Ga0157379_1177851513300014968Switchgrass RhizosphereIIAFVVFLLILGAIGLAISFGILYVLGGAWRLVTGGRSRNR*
Ga0157376_1259087823300014969Miscanthus RhizosphereLQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRNR*
Ga0167638_107948023300015197Glacier Forefield SoilVKFLLVPFAIVAFVLFLLLLGAIGLLASMAVLSVFGRIWRLVMRR*
Ga0173480_1007315623300015200SoilVKLLLVPLAIIAFVLFLLILGAIGLAISFAVLYVFSGAWRLVSGGRARGR*
Ga0137403_1098576623300015264Vadose Zone SoilVTLLLIPAAIVAFVLFLLLLGAIGLIVAMGVLWFFGRIWRLVMRR*
Ga0132255_10513331823300015374Arabidopsis RhizosphereVKFLLVPFAIAAFVAFLLLLGAIGLVIAMTVLSAFGRLWRFLNRSGRRQRS*
Ga0066667_1051995123300018433Grasslands SoilVLPWVPSPLQDYAGVKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARAR
Ga0190273_1022204033300018920SoilVKFLLIPLAIIAFVLFLLILGAIGLAIAFGVIYVVGGAWRLVSGGRPARR
Ga0173481_1024725023300019356SoilAIIAFILFLLILGAIGLAISFAVLYVFGGAWRLISGGRARGR
Ga0193743_103587033300019889SoilVAKLLLIPFAVVAFVLFLLLLGAIGLTIALGVLWVFGRAWGLVSRGGRRRRS
Ga0193716_106671723300020061SoilVKVLLIPFAIVLFVLFLLLLGAIGLAVSMTVLSAFGRLWRLLNRSAQPRRS
Ga0206356_1012176843300020070Corn, Switchgrass And Miscanthus RhizosphereMAIAAFVVFLLVLGAIGLAISFAILYLLSGAWRLVSGLGRLGRTRSR
Ga0206354_1129790913300020081Corn, Switchgrass And Miscanthus RhizosphereFAIVAFILFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTS
Ga0206353_1036878023300020082Corn, Switchgrass And Miscanthus RhizosphereVKLLLVPFAIVAFILFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTS
Ga0196958_1005852223300020181SoilVKFLLIPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLLTGGRAGRR
Ga0193706_100034793300021339SoilVKFLLVPFAIVAFVAFLLLLGAIGLVIAMGVLAVFGRIWRLVMRR
Ga0193706_108911413300021339SoilAGGQSRRVKFLLVPFAILAFVLFLLLLGAIGLVIAMTVLSAFGRIWRLVMRR
Ga0193699_1008543023300021363SoilVKFLLVPFAIVALVLLLLLLGAIGLVVSMAVLTVFGKIWRLVMRR
Ga0247786_100048093300022883SoilLQDYAGVKLLLVPFAILAFVLFLLLLGAIGLAIAFAVLYVFGRAWRLVGGGPRRDR
Ga0247794_1000437933300024055SoilVKLLLIPFAVIAFVIFLLVLGAIGFAVAFSVLAVLGRGWRLVSGGRARTR
Ga0196960_10000054243300024426SoilVKFLLIPLAIIAFVIFLLILGAIGLAISFAVLYVFGRAWRLVTGGGPGRR
Ga0196960_1013853323300024426SoilFVLFLLVLGAIGLAISFGVIYVFGRIWRLITGGRPGRRGRGSAMS
Ga0207656_10000285203300025321Corn RhizosphereVKLLLIPFAIVAFILFLLLLGAIGFAVAFAVLAVFGRAWRLVFRRSH
Ga0208356_1000005443300025504Arctic Peat SoilVKFLLVPFAIVAFVLFLLLLGAIGLVVSMAVLSVSGRIWRLVMRR
Ga0207680_1000208043300025903Switchgrass RhizosphereVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRDR
Ga0207685_1021705223300025905Corn, Switchgrass And Miscanthus RhizosphereVKLLLVPFAIVAFVLFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTS
Ga0207695_1058783323300025913Corn RhizosphereVKLLFVPLAIVAFVLFLLVLGAIGLVVSMGVLAFFGKIWRVVMRR
Ga0207694_1157722323300025924Corn RhizosphereLVPLAIVAFVLFLLVLGTIGLAIAFAVIYVVGGAWRFVSGGRRRAG
Ga0207659_1000001893300025926Miscanthus RhizosphereLQDYAGVKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSRDPRRNR
Ga0207687_10000070383300025927Miscanthus RhizosphereLKLLFVPILVIAFVVFLLVLGAIGFAVSFAVLAVLGRAWRLLSGGRSRGA
Ga0207687_1008729923300025927Miscanthus RhizosphereVKLLLIPFAIVAFVLFLLLLGAIGFAVAFAVLAVVGRAWRLVFRRGTG
Ga0207700_100000032343300025928Corn, Switchgrass And Miscanthus RhizosphereVKLLLIPLAIVAFVIFLLILGAIGLAVAFAVLYVLGKFWRLISRAGRPRRRRASA
Ga0207704_10000079173300025938Miscanthus RhizosphereVKLLLIPFAILAFVIFLLVLGAIGFAVAFAVLAVLGRAWRLVSGGRPGRRRKAA
Ga0207704_1100069223300025938Miscanthus RhizosphereIVAFVLFLLLLGAIGLVVSMAVLAFFGKLWRLVMRR
Ga0207711_100000114323300025941Switchgrass RhizosphereVKILFVPIVIVAFVLFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGA
Ga0207661_1000023943300025944Corn RhizosphereVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYVCGAAWRLVAGGRRHNR
Ga0207658_1045379023300025986Switchgrass RhizosphereVVKVLLVPLAILAFVVFLLVLGAIGMAVSLAVLWVFGRIWRFVSRVDRRDRRRQQT
Ga0207678_1114922923300026067Corn RhizosphereLQDYAGVKLLLVPLAILAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVTGGRHRGR
Ga0207702_10000202473300026078Corn RhizosphereVKLLLIPFVVIAFVVFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGRARSGRSA
Ga0207674_1109992723300026116Corn RhizosphereLQDYAGVKLLLVPLAIVAFVLFLLLLGAIGLAISFAVLYAFGRAWRLVSRDPRPRR
Ga0207675_10007603133300026118Switchgrass RhizosphereVKVLFVPLAILAFVLFLLLLGAIGMAISMAVISAVGKLWRVASRADRRDRRRQQA
Ga0207698_1000267973300026142Corn RhizosphereLQDYAALKLLLVPVAIVAFVLFLLVLGAIGLAISFAVIYVVGGAWRLVSGGRRRR
Ga0209265_116768513300026308SoilDVKLLLIPFAVIAFVIFLLVLGAIGFAVAFAVLAVLGRGWRLVSGGHARTHGTR
Ga0209647_102597653300026319Grasslands SoilVKFLLIPLGILAFVLFLLLLGAIGLAAAMSVLWVVGRVWRFVTGVGRARSA
Ga0208994_104658823300027164Forest SoilVKFLLIPLGIIAFILFLLLLGAIGLAIAMGVLSALGRIWRLLSRRGYPQRS
Ga0209624_1000707283300027895Forest SoilVKLLLVPFAIVAFVLFLLMLGAIGLLIAMGVLAVCGRVWRLVMRR
Ga0268266_10001389113300028379Switchgrass RhizosphereLQDYAGVKLLLVPLAIVAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRAS
Ga0268266_1079539123300028379Switchgrass RhizosphereVKLLLVPLAVVAFVLFLLLLGAIGLAISFAVIYVVGGAWRLVTGGRRRNR
Ga0307285_10000004733300028712SoilLQDYAGVKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSGGPRRDR
Ga0307315_1014308923300028721SoilMEDYGGVKLLLVPFAVLAFVVFLLVLGAIGFAVAFAVLAVLGRAWRLVSGGRSRGA
Ga0307297_1004488413300028754SoilVKFLFVPIVVVAFLIFLLVLGAIGFAVSFAVLAVLGRAWRLISG
Ga0307280_10000021213300028768SoilLQDYAAVKLLLVPLAIIAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRNR
Ga0307288_100000042133300028778SoilLQDYAGVKLLLVPLAILAFVLFLLLLGSIGLAISFAVLYVFGWAWRLVSGGRRRGR
Ga0307283_1007988223300028790SoilAIIAFVLFLLVLGTIGLAISFAVIYVVGGAWRLVSGGRRRNR
Ga0307286_1026146023300028876SoilVKLLLVPLAILAFVLFLLLLGAIGLAISFAVLYVFGRAWRLVSGGPRRDR
Ga0268243_102669523300030510SoilVKLLFVPIVVAAFLVFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRGA
Ga0326721_10000051953300032080SoilVKFLLIPLAILAFVLFLLILGAIGLAIAFGVIYVVGGAWRLVSGGRPGRRKASG
Ga0307472_10001788653300032205Hardwood Forest SoilQVPPSLPSSLQDYAGVHILLVPFAVIAFVIFLLVLGAIGFAVSFAVLAVLGRAWRLVSGGRSRTP
Ga0334918_004875_1669_18063300034000Hypolithic BiocrustLIPLAILAFVCFLLLLGAIGLAISFAVIYLVVGAWRLVSGGHRRG
Ga0334913_060134_596_7633300034172Sub-Biocrust SoilLQDYAGVKLLLIPLAILAFVCFLLLLGAIGLAISFAVIYLVGGAWRLVSGGHRRG
Ga0334925_116913_352_5223300034173Hypolithic BiocrustLQDYGAVKLLLVPIAILAFAVFLLVLGAIGFAVSFAVLAVLGRAWRVVSAGRPRRR
Ga0334905_000676_1350_15023300034687SoilVKVLFVPIVAIAFVVFLLVLGAIGFAVSFAVLAALGRLWRLVSGGSSRSG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.