NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F064239

Metagenome / Metatranscriptome Family F064239

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064239
Family Type Metagenome / Metatranscriptome
Number of Sequences 129
Average Sequence Length 136 residues
Representative Sequence YETIKETVADYFDISHAVDPDLAEYRRDLLEIFPRRSERARSSQNALSAARFIQQHQRMLVDKMGGWIGKSDRRVIGRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Number of Associated Samples 101
Number of Associated Scaffolds 129

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.33 %
% of genes near scaffold ends (potentially truncated) 95.35 %
% of genes from short scaffolds (< 2000 bps) 93.80 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.70

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen
(17.829 % of family members)
Environment Ontology (ENVO) Unclassified
(27.907 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.760 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.55%    β-sheet: 5.26%    Coil/Unstructured: 36.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.70
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.130.1.0: automated matchesd5ts9a_5ts90.63991
a.130.1.4: Secreted chorismate mutase-liked2fp1a_2fp10.62122
a.130.1.0: automated matchesd6cnza_6cnz0.61926
a.127.1.1: L-aspartase/fumarased7miwa17miw0.57615
f.38.1.0: automated matchesd6gs4a_6gs40.54915


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 129 Family Scaffolds
PF07879PHB_acc_N 53.49
PF00942CBM_3 3.10
PF00005ABC_tran 1.55
PF01458SUFBD 1.55
PF00266Aminotran_5 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 129 Family Scaffolds
COG5394Polyhydroxyalkanoate (PHA) synthesis regulator protein, binds DNA and PHASignal transduction mechanisms [T] 53.49
COG0719Fe-S cluster assembly scaffold protein SufBPosttranslational modification, protein turnover, chaperones [O] 1.55


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000318|WSSedL1CaDRAFT_10034079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales1091Open in IMG/M
3300000956|JGI10216J12902_110504707All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300001213|JGIcombinedJ13530_100859316All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium806Open in IMG/M
3300001213|JGIcombinedJ13530_101598834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300001213|JGIcombinedJ13530_104254952All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium708Open in IMG/M
3300001213|JGIcombinedJ13530_109585989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium796Open in IMG/M
3300001373|YBMDRAFT_10296644All Organisms → cellular organisms → Bacteria → Proteobacteria1243Open in IMG/M
3300003432|JGI20214J51088_10880295All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300003889|Ga0062441_1038137All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1161Open in IMG/M
3300004780|Ga0062378_10238115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Enterococcaceae → Enterococcus → Enterococcus gilvus520Open in IMG/M
3300005340|Ga0070689_101035232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium731Open in IMG/M
3300005356|Ga0070674_101395964All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300005719|Ga0068861_100571897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1033Open in IMG/M
3300005829|Ga0074479_10069766All Organisms → cellular organisms → Bacteria → Proteobacteria1117Open in IMG/M
3300005841|Ga0068863_102519237All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300005995|Ga0066790_10530137All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300006642|Ga0075521_10261473All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium829Open in IMG/M
3300007004|Ga0079218_11075585All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium817Open in IMG/M
3300009082|Ga0105099_10798663All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300009503|Ga0123519_10588248All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300009629|Ga0116119_1144465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300009630|Ga0116114_1016190All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2300Open in IMG/M
3300010166|Ga0126306_10837117All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium744Open in IMG/M
3300010403|Ga0134123_10320244All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1385Open in IMG/M
3300010403|Ga0134123_13634141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300011445|Ga0137427_10441703All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300012212|Ga0150985_106335390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300012469|Ga0150984_122562252All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1364Open in IMG/M
3300012469|Ga0150984_123217404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium589Open in IMG/M
3300012532|Ga0137373_11186215All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300014153|Ga0181527_1301055All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300014309|Ga0075317_1076804All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium703Open in IMG/M
3300014490|Ga0182010_10080399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1605Open in IMG/M
3300014490|Ga0182010_10159694All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300014490|Ga0182010_10323306All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium831Open in IMG/M
3300014491|Ga0182014_10471819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium617Open in IMG/M
3300014498|Ga0182019_10099223All Organisms → cellular organisms → Bacteria → Proteobacteria1780Open in IMG/M
3300014498|Ga0182019_11038572All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300014498|Ga0182019_11128591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300014498|Ga0182019_11384268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300014502|Ga0182021_10070624All Organisms → cellular organisms → Bacteria4055Open in IMG/M
3300014502|Ga0182021_10156250All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2656Open in IMG/M
3300014502|Ga0182021_10537842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1395Open in IMG/M
3300014502|Ga0182021_10578413All Organisms → cellular organisms → Bacteria → Proteobacteria1343Open in IMG/M
3300014638|Ga0181536_10346447All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium677Open in IMG/M
3300014839|Ga0182027_10715339All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1059Open in IMG/M
3300014839|Ga0182027_10965755All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium875Open in IMG/M
3300014839|Ga0182027_11782060All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300014839|Ga0182027_12349959All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300016700|Ga0181513_1274835All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium735Open in IMG/M
3300019788|Ga0182028_1130657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2414Open in IMG/M
3300019788|Ga0182028_1176878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium814Open in IMG/M
3300019788|Ga0182028_1335454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1948Open in IMG/M
3300022520|Ga0224538_1010880All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium923Open in IMG/M
3300023075|Ga0224520_1057948All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium884Open in IMG/M
3300024238|Ga0224523_1047646All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1065Open in IMG/M
3300025419|Ga0208036_1064771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300025878|Ga0209584_10182520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium797Open in IMG/M
3300025906|Ga0207699_11348230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300025918|Ga0207662_10984860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300026373|Ga0256817_1019921All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300026451|Ga0247845_1063040All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300026476|Ga0256808_1002623All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300027863|Ga0207433_10108902All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2502Open in IMG/M
3300027886|Ga0209486_10906510All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300028069|Ga0255358_1031192All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium750Open in IMG/M
3300028558|Ga0265326_10079184All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium929Open in IMG/M
3300028649|Ga0302162_10068724All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium807Open in IMG/M
3300028665|Ga0302160_10127141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300028679|Ga0302169_10053339All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium941Open in IMG/M
3300028774|Ga0302208_10123031All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium634Open in IMG/M
3300028800|Ga0265338_10522686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium833Open in IMG/M
3300028868|Ga0302163_10072799All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium843Open in IMG/M
3300029923|Ga0311347_10771873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium584Open in IMG/M
3300029980|Ga0302298_10164789All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium717Open in IMG/M
3300029984|Ga0311332_11296147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300029987|Ga0311334_10397138All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300029987|Ga0311334_10868030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium745Open in IMG/M
3300029990|Ga0311336_11689834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300030000|Ga0311337_11376004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300030019|Ga0311348_10643133All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium791Open in IMG/M
3300030019|Ga0311348_11044449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300030047|Ga0302286_10382707All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium709Open in IMG/M
3300030294|Ga0311349_10525762All Organisms → cellular organisms → Bacteria → Proteobacteria1119Open in IMG/M
3300030294|Ga0311349_10891993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium836Open in IMG/M
3300030339|Ga0311360_11329119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300030339|Ga0311360_11493344All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300031235|Ga0265330_10239819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium764Open in IMG/M
3300031235|Ga0265330_10391825All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium587Open in IMG/M
3300031238|Ga0265332_10222672All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium782Open in IMG/M
3300031240|Ga0265320_10062031All Organisms → cellular organisms → Bacteria → Proteobacteria1781Open in IMG/M
3300031242|Ga0265329_10217632All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300031249|Ga0265339_10013068All Organisms → cellular organisms → Bacteria → Proteobacteria5043Open in IMG/M
3300031521|Ga0311364_11332209All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium711Open in IMG/M
3300031712|Ga0265342_10438374All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300031722|Ga0311351_10855557All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium694Open in IMG/M
3300031726|Ga0302321_101001037All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium951Open in IMG/M
3300031727|Ga0316576_10319091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1159Open in IMG/M
3300031740|Ga0307468_102014581All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300031902|Ga0302322_100909354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1056Open in IMG/M
3300031902|Ga0302322_102064226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium700Open in IMG/M
3300031918|Ga0311367_12009162All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300032180|Ga0307471_104068147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300032770|Ga0335085_10595343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1246Open in IMG/M
3300032770|Ga0335085_12593771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300032829|Ga0335070_10371539All Organisms → cellular organisms → Bacteria → Proteobacteria1373Open in IMG/M
3300032893|Ga0335069_11760206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300032897|Ga0335071_10066381All Organisms → cellular organisms → Bacteria3546Open in IMG/M
3300032897|Ga0335071_10521721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1140Open in IMG/M
3300033414|Ga0316619_10258095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1301Open in IMG/M
3300033433|Ga0326726_11905947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300033480|Ga0316620_11451292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium677Open in IMG/M
3300033482|Ga0316627_100903208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium847Open in IMG/M
3300033483|Ga0316629_10836577All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium710Open in IMG/M
3300033483|Ga0316629_11472445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300033528|Ga0316588_1157937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300033797|Ga0334815_000456All Organisms → cellular organisms → Bacteria → Proteobacteria4853Open in IMG/M
3300033798|Ga0334821_052935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium807Open in IMG/M
3300033820|Ga0334817_110986All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300033820|Ga0334817_117975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300033825|Ga0334843_069772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300033827|Ga0334848_055413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium719Open in IMG/M
3300033890|Ga0334810_103413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium686Open in IMG/M
3300034070|Ga0334822_030307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1211Open in IMG/M
3300034129|Ga0370493_0345937All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300034170|Ga0370487_0307283All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300034195|Ga0370501_0118258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium902Open in IMG/M
3300034358|Ga0370485_0045331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1130Open in IMG/M
3300034652|Ga0316598_131172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium702Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen17.83%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen13.95%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil10.08%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil8.53%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere6.98%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland4.65%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil3.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.33%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.55%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment1.55%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring1.55%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.55%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.55%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.55%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.55%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.55%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.55%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.55%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.78%
Anaerobic Enrichment CultureEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture0.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.78%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.78%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.78%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.78%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.78%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.78%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.78%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.78%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.78%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.78%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000318Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 CattailEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001373YB-Mouth-sedEnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003889Freshwater pond sediment microbial communities from Middleton WI, enriched with Humin and Glucose under anaerobic conditions - HM Sample 1EnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009503Hot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014309Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1EnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016700Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300022520Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 20-24EnvironmentalOpen in IMG/M
3300023075Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25EnvironmentalOpen in IMG/M
3300024238Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T50EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026373Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F6EnvironmentalOpen in IMG/M
3300026451Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T-25EnvironmentalOpen in IMG/M
3300026476Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PR6EnvironmentalOpen in IMG/M
3300027863Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028649Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2EnvironmentalOpen in IMG/M
3300028665Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3EnvironmentalOpen in IMG/M
3300028679Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3EnvironmentalOpen in IMG/M
3300028774Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029980Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031727Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5Host-AssociatedOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033528Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033797Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-SEnvironmentalOpen in IMG/M
3300033798Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-SEnvironmentalOpen in IMG/M
3300033820Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-DEnvironmentalOpen in IMG/M
3300033825Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 1-5EnvironmentalOpen in IMG/M
3300033827Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9EnvironmentalOpen in IMG/M
3300033890Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-MEnvironmentalOpen in IMG/M
3300034070Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-MEnvironmentalOpen in IMG/M
3300034129Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16EnvironmentalOpen in IMG/M
3300034170Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M
3300034358Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16EnvironmentalOpen in IMG/M
3300034652Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
WSSedL1CaDRAFT_1003407933300000318WetlandRRRYKDWQVALVKLEYIDRIVEVEGVCKGTPPNERLGLRVPYETIKETVADYFDIAHAVDPDLAEYRNDLLEIFPRRSERSRPRGALSAARFIQQHQRMLMDKISAWIGKSDRRVVGRFLRQLQALCTYEHLLVPEAQRNEKLVDLTIVATWHVLDGIHRLSERQPGRK*
JGI10216J12902_11050470713300000956SoilYRDWQVALAKLEFVDRIIDVERACKGAAPNLRTGQRVPHTDIKETVAEYFDIDHAVDPDLTEYRRDLLEIFPRKAPRARTRSARALGQTQNAQSAARFIQQHQRLLVTKLSAWIGNSDRRVIGKFLRQLQAVCTYEHLVVPDNRRNEKLVDLTIVATWHVVDGIHRLSG*
JGIcombinedJ13530_10085931623300001213WetlandVWLDPSSRWRRRYKNWQVAFVKLEYIDRIVEVEGLCRGTPQNQRLGSRIGYETIKETVADYFDIAHAVDPDLAEYRNDLLEIFPRRPDGSRRTQGAVSAARFIQQHQRMLIDKMSLWIGRSDRRVVGRFLRQLQALCTYEHLVVPEAQRNDKLVDLTIVATWHVIDGIHRLSGG*
JGIcombinedJ13530_10159883423300001213WetlandGACKGTPPNQRPGKRVGYETIKETVAEYLDIAHAVDPDLVEYRRDLLEIFPRRSERARSRQSGLSAARFIQQHQRVLIDKIGAWIGDSDRRVITRFLRQLQALCTYEHLVVPESQRSEKLVDLTIVATWHVLDGIHRLSGR*
JGIcombinedJ13530_10425495213300001213WetlandRRYKDWQVALVKLEYIDRIVDVEGVCKGAPPNQRPGQRVAYESIKETVADYFDLDHAVDPDLAEYRSDLLEIFPRRSDRVRNPQGAQSAARFIQQHQRMLLDKMRLWIGKSDRRVIGRFLRQLQALCTYEHLVVPEAQRNEKLVDLTIVATWHVLDGIHRLSDRQPKRK*
JGIcombinedJ13530_10958598913300001213WetlandLEYVDRIVDVEGACRGAPNNQRPGLQVPYQDIKETVAEYFDIIHALDPDLAEYRRDVLEIFARRSSRSQNSQSALSAARFIQLHQRLLVSKLAGWIGNSDRRVITRFLRQLQALCTYEHLVVPENRRNEILVDLTIVATWHVVDGIHRLSG*
YBMDRAFT_1029664413300001373Marine EstuarineEGTGYLRPYLPHRLGQRVSYEGIKETVADYFDIAHAVDPDLAEYRRDLLGIFPRRPESARRTQSGLSAARFIQQNQRMLVDKMAGWIGNSDRRVIGRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE*
JGI20214J51088_1088029523300003432WetlandRRDLLDIFPRRSQRARSRQSALSAARFIQQHQRVLIDKIGSWIGKSDRRVIGRFLRQLQALCTYEHLVVPESERSEKLVDLTIVATWHVLDGIHRLSGE*
Ga0062441_103813723300003889Anaerobic Enrichment CultureVCKGTPPNERLGLRVPYETIKETVADYFDIAHAVDPDLAEYRNDLLEIFPRRSERSRPRGALSAARFIQQHQRMLMDKVSAWIGKSDRRVVGRFLRQLQALCTYEHLMVPEAQRNEKLVDLTIVATWHVLDGIHRLSDRHPSRR*
Ga0062378_1023811513300004780Wetland SedimentWQVALAKLEYVERIVDVEGVCRGTPPNQRVGQRITHESIKETVADYLDIAHAVDPDIAEYRRDLLEIFPRRSERSRGRPSAQSAARFIQQHQQVLVDKIGGWIGRSDRRVIARFMRQLQALCTYEHLVVPESQRNEKLVDLTIVATWHVLDGIHRLSGG*
Ga0070689_10103523213300005340Switchgrass RhizosphereSRWRRRYRDWQVAFAKLEYVDRIVEVEGACKGTPSNSRLGLRLPYTEIKETVAEYFDIDHAVDPDLAEYRRDLLEIFPRRGPRARGRAATMGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEQFLRQMQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSG*
Ga0070674_10139596413300005356Miscanthus RhizosphereAKLEYVDRIVEVEGACKGTPDNTRLGLRLPYTEIKETVAEYFDIDHAVDPDLAEYRRDLLEIFPRRGARGRTGATGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEKFLRQLQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSE*
Ga0068861_10057189733300005719Switchgrass RhizospherePYTEIKETVAEYFDIDHAVDPDLAEYRRDLLEIFPRRDPRTRGRSATMGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEQFLRQMQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSG*
Ga0074479_1006976633300005829Sediment (Intertidal)LEYIDRIVDVEGVCRGTAPNQRAGARVGFETFKETVAEYLEMGHAVDPDLVEYRRDLLEIFPRRSGRASSRQSAISAARFIQQHQRVLIEKIGGWIGQSNRRVISRFLRQLQAICAYEHLVVPEPQRNEKLVDLTIVATWHVLDGIHRLSGE*
Ga0068863_10251923713300005841Switchgrass RhizosphereEYVDRIVDVEGACKGTPSNARLGLRLPYTEIKETVAEYFDIDHAVDPDLAEYRRDLLEIFPRRGPRARGRAATMGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEKFLRQMQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSG*
Ga0066790_1053013713300005995SoilRIVDVEGVCRGTPPNERLGQRIGYESIKETVAGYFDIAHAVDPDLAEYRRDLLEIFPRRSERTQGGQNALSAARFIQQQQHMLVDKMGGWIGKSDRRVIGRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGK*
Ga0075521_1026147313300006642Arctic Peat SoilDVEGVCRGTPPNERLGQRIGYESIKETVADYFDIAHAVDPDLAEYRRDLLEIFPRRSERTQGVQNALSAARFIQQQQHMLVDKMGGWIGKSDRRVIGRFMRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGK*
Ga0079218_1107558513300007004Agricultural SoilLPYTEIKETVAEYFDINHAVDPDLAEYRRDLLEIFPRRGPRARGRSPSMGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEQFLRQMQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSG*
Ga0105099_1079866313300009082Freshwater SedimentNQRAGKRVGYETLKETVADYLDIAHAVDPDLVEYRRDLLEIFPRRPEHARSRQNAFSAARFIQQHQRMLIDKIGGWIGNSDRRVIGKFLRQLQALCTYEHLVVPEAQRNEKLVDLTIVATWHVLDGIHRLSGK*
Ga0123519_1058824813300009503Hot SpringNRRIGLQIPYQGIKETVAEYFDIIHALDPDLAEYRKDVLEIFVQRPNRTHGKQGAISAARFVQMHQELLLSKLSKWIGNSDRRVITRFLRQLQALCTYEHLVVPENRRHETLVDLSIVATWHVVDGIHRLSG*
Ga0116119_114446523300009629PeatlandCRGTPANQRTGTQIPYGDLKETVAEYFDINHALDPDLAEYRRDLLDIFPRRSPHARGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE*
Ga0116114_101619043300009630PeatlandRYRDWQVAVTKLEYVDRIIDLEGACRGTPANQRTGTQIPYGDLKETVAEYFDINHALDPDLAEYRRDLLDIFPRRSPHARGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE*
Ga0126306_1083711713300010166Serpentine SoilTVAEYFNINDAVDPDLAEYRRDLLEIFPRRAPRTRASSSTSQSAARFIQQHQRLLVDRLGGWIHASDRRVIKRFLRQLEAVCTSEHLVIPDNRRSEKLVDLTIVATWHVLDGIHRLSE*
Ga0134123_1032024423300010403Terrestrial SoilDIDHAVDPDLAEYRRDLLEIFPRRGPRARGRAPAMAKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEKFLRQLQALCTYEHLVVPDNRRNEKLVDLTIVATWHVVDGIHRLSG*
Ga0134123_1363414113300010403Terrestrial SoilGLRLPYTEIKETVAEYFDIDHAVDPDLAEYRRDLLEIFPRRDPRSRGRAPAMGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEKFLRQLQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSG*
Ga0137427_1044170313300011445SoilRYASWQVALAKLEYLDRIIDVDGACRGTPSNTRRGVRVPYGDMRETVAEYLKIPDAVDRDLAEYRKDLLEIFPRRARVGAPAGDAQSAARFIQQHQRLLVDRLGGWIGRSDRRVIKKFLRQLEAVCTSERLVVPDKRRSEKLVDLTIVATWHVVDGIHRLSE*
Ga0150985_10633539023300012212Avena Fatua RhizosphereRLPYTEIKETVAEYFDIDHAVDPDLAEYRRDLLEICPRRDPRSRRTATTGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEKFLRQLQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSG*
Ga0150984_12256225223300012469Avena Fatua RhizosphereMEIFPRRTPRAGSKNGRGATLGSTQNAQSAARFIQQHQRLLVSKLSAWIGNSDRRVIERFLRQLQALCTYEHLVVNQNRRAEKLVDLTIVATWHVLDGIHRLSG*
Ga0150984_12321740413300012469Avena Fatua RhizosphereLDPSTRWRRRYKDWQVAFAKLEYVDRLIDVEGACKGAPPNTRRGIRLPYTDIKETVAEYFKIADVVDTELVEYRRDLLEIFPRRIGAKRSRSSTGETARGDAQSAARFIQQNQRLLIDRLGGWIENSDRRVIKRFLRRLEAVCTMEGLVVPDNRRAEKLVDLTIVATWHVLDGIHRLSG*
Ga0137373_1118621513300012532Vadose Zone SoilQVAFVKLEYVDRIVDVEGVCRGAPPNQRLGQRIGYESIKETVADYFDIAHAVDPDLAEYRRDLLEIFPRRSERTQAGQNALSAARFIQQQQHMLVDKMGGWIGKSDRRVIGRFLRQLQALCTYEHLVVPETQRNDKLVDLTIVATWHVLDGIHRLSDK*
Ga0181527_130105523300014153BogEYIDRIIDVEGICKGPPKNQRLGTRIGYETIKETVADYFDLAHAVDPDLAEYRDDLLEIFPRRPPRARHSQSSVSAARFIQLHQRMLVDKISLWIGRSDRRIVGRFLRQLQALCTYEHLVVPEAQRNEKLVDLTIVATWHVLDGIHRLSEK*
Ga0075317_107680423300014309Natural And Restored WetlandsALDPDLAEYRRDVLEVFARRPNRVRGRQGAISAARFIQLHQRLLVSKLAGWIGNSDRRVITRFLRQLQALCTYEHLVVPENRRNEILVDLTIVATWHVVDGIHRLSG*
Ga0182010_1008039933300014490FenSSRWRRRYKDWQVALVKLEYLDRVIDVEGTCRGAPPNQRLGQRVGYELIKETVADYFDIAHAVDPDLAEYRRDLLEIFPRRPESARSGQNALSAARFIQQHQNVLIDKMGGWIGRSDRRVISRFLRQLQALCTYEHLVVPENQRSDKLIDLTIVATWHVLDGIHRLSGE*
Ga0182010_1015969413300014490FenLDPDLAEYRKDLLDIFPRRSPHARGAQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE*
Ga0182010_1032330623300014490FenDYLGIAHTVDPDLVEYRRDLLEIFPRRPEGARSRQSALSAARFIQQHQRVLIDKIGGWIGDSDRRVISKFLRQLQALCTYEHLVVPESQRNDKLVDLTIVATWHVLDGIHRLSGE*
Ga0182014_1047181913300014491BogPNQRLGQRVSYESIKETVADYFDITHAVDPDLTEYRRDLLEIFPRRSVASRGSALSAARFIQLNQRMLADKIGGWIGKSDRRVIGRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSET*
Ga0182019_1009922333300014498FenYETIKETVADYFDIAHAVDPDLAEYRNDLLEIFPRRLDLARRPQGALSAARFIQQHQRMLMDKMSLWIGKSDRRVIGRFLRQLQALSTYERLVVPEAQRNEKLVDLTIVATWHVLDGIHRLSDKQPGRK*
Ga0182019_1103857213300014498FenGQRIGYGTIKETVADYFDIEHAVDPDLAEYRRDLLEIFPRRSDRARGSQGALSAARFIQQHQHMLVDKMGGWIGKSDRRVISRFLRQLQALCTYEHLVVPENQRSDKLVDLTIVATWHVLDGIHRLSGK*
Ga0182019_1112859113300014498FenRTGSQAPYSEIKETVAEYFDINHALDPDLAEYRKDLLDIFPRRSVRARGSQGALSAARFIQQHQRLMINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE*
Ga0182019_1138426813300014498FenLDRIVDVEGACRGTPPNQRLGQRESYEIIKETVADYFDIAHAVEPDLAEYRRDLLEIFPRRPERARSSQSALSAARFIQQHQRMLVDKMGGWIGKSDRRIISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGK*
Ga0182021_1007062463300014502FenWRRRYRDWQVALTKLEYIDRIIDLEGACRGAPRNQRLGSQLTYLEIKETVAEYFDINHALDPDLAEYRRDLLDIFPRRSLSARGTQGALSAARFIQQHQRLLINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLLVPENRRNEKLVDLTIVATWHVVDGIHRLSG*
Ga0182021_1015625013300014502FenQVALTKLEYIDRIIDLEGACRGAPRNQRLGSQVTYLEIRETVAEYFDINHALDPDLAEYRRDLLDIFPRRSLSARGTQGALSAARFIQQHQRLLINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLLVPENRRNEKLVDLTIVATWHVVDGIHRLSE*
Ga0182021_1053784233300014502FenQVALTKLEYIDRIIDLEGACRGAPRNQRLGSQVTYLEIRETVAEYFDINHALDPDLAEYRRDLLDIFPRRSLSARGTQGALSAARFIQQHQRLLINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLLVPENRRNEKLVDLTIVATWHVVDGIHRLSG*
Ga0182021_1057841313300014502FenSRWRRRYKDWQVALVKLEYLDRVIDVEGTCRGAPPNQRLGQRVGYELIKETVADYFDIAHAVDPDLAEYRRDLLEIFPRRSERARSNQSAFSAARFIQQHQRMLVDKMGGWIGKSDRRVITRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE*
Ga0181536_1034644723300014638BogYVDRIIDLEGACRGTPANQRTGTQIPYGDLKETVAEYFDINHALDPDLAEYRRDLLDIFPRRSPHARGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE*
Ga0182027_1071533933300014839FenSSRWRRRYRDWQVALTKLEYIDRIIDLEGACRGAPRNQRLGSQETYLEIRETVAEYFDINHALDPDLAEYRMDLLDIFPRRSLSARGTQGALSAARFIQQHQRLLINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLLVPENRRNEKLVDLTIVATWHVVDGIHRLSG*
Ga0182027_1096575513300014839FenLEYVDRIIDLEGACRGTPDNQRSGSQATYLELRETVAEYFDINHALDPDLAEYRRDLLDIFPRRSARARGSQGALSAARFIQQHQRLLITKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE*
Ga0182027_1178206013300014839FenRRYRDWQVALTKLEYIDRIIDLEGACRGAPRNQRLGSQVTYLEIRETVAEYFDINHALDPDLAEYRRDLLDIFPRRSLSARGTQGALSAARFIQQHQRLLINKLCGWIGDSDRRVIGKFLRQLQALCTYEHLLVPENRRNEKLVDLTIVATWHVVDGIHRLSE*
Ga0182027_1234995913300014839FenKLEYVDRIIDLEGACRGTPSNQRTGSQAPYSDIRETVAEYFDINHALDPDLAEYRKDLLDIFPRRSPSARGSQGALSAARFIQQHQRLLISKLGGWIGNSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE*
Ga0181513_127483523300016700PeatlandIKETVADYFDLAHAVDPDLAEYRDDLLEIFPRRPPRARHSQSSVSAARFIQLHQRMLVDKISLWIGRSDRRIVGRFLRQLQALCTYEHLVVPEAQRNEKLVDLTIVATWHVLDGIHRLSE
Ga0182028_113065743300019788FenFDINHALDPDLAEYRKDLLDIFPRRSARASGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIAKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0182028_117687823300019788FenDINHALDPDLAEYRKDLLDIFPRRSARASGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIAKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0182028_133545413300019788FenMHWTRIWPSTARIARYLPRRSVRARGSQGALSAARFIQQHQRLMINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLVCRKPAQRETGRPDLVATWHVVDGIHRLSE
Ga0224538_101088013300022520SoilLDPDLAEYRRDLLDIFPRRSLSARGTQGALSAARFIQQHQRLLINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLLVPENRRNEKLVDLTIVATWHVVDGIHRLSG
Ga0224520_105794813300023075SoilEGACRGTPDNQRSGSQATYLELRETVAEYFDINHALDPDLAEYRRDLLDIFPRRSARARGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0224523_104764633300024238SoilPTNQRTGSQAPYSEIRETVAEYFDINHALDPDLAEYRKDLLDIFPRRSPRARGSQGALSAARFIQQHQRLLVSKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSG
Ga0208036_106477113300025419PeatlandCRGTPANQRTGTQIPYGDLKETVAEYFDINHALDPDLAEYRRDLLDIFPRRSPHARGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0209584_1018252033300025878Arctic Peat SoilPDLAEYRRDLLEIFPRRSERTQGVQNALSAARFIQQQQHMLVDKMGGWIGKSDRRVIGRFMRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGK
Ga0207699_1134823013300025906Corn, Switchgrass And Miscanthus RhizosphereWLDPASRWRRRYRDWQVAHAKLEYVDRIVEVEGACKGTPPNARLGLRLPYTEIKETVAEYFDINHAVDPDLAEYRHDLLEIFPKRGVRARGGKAGAMGKTQNAQSAARFIQQHQRLLVSKLTGWIGNSDRRVIINFLRQLQALCTYEHLVVPDNRRNEKLVDLTIVATWHVVDGI
Ga0207662_1098486013300025918Switchgrass RhizosphereDVEGACKGQPDNSRLGLRLPYTEIKETVAEYFDIDHAVDPDLVEYRRDLMEIFPRRPPRTRGRVGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEKFLRQLQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSG
Ga0256817_101992123300026373SedimentGYETLKETVADYLNIADAVDPDLAEYRRDLLEIFPRRSERARSRQNAFSAARFIQQHQRMLVDKIGAWIGKSDRRVIGRFLRQLQALCTYEHLVVPESQRNEKLVDLTIVATWHVLDGIHRLSGE
Ga0247845_106304013300026451SoilDWQVAVTKLEYVDRIIDLEGACRGTPTNQRTGSQAPYSEIKETVAEYFDINHALDPDLAEYRKDLLDIFPRRSVRARGSQGALSAARFIQQHQRLMINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0256808_100262313300026476SedimentDVEGTCRGTPPNERLGKRVPYETLKETVADYLDIAHAVDPDLVEYRRDLLEIFPRRSARARGRQSAVSAARFIQQHQRMLIDKIGGWIGNSDRRVIGRFLRQLQALCTYEHLVVPEAQRNDKLVDLTIVATWHVLDGIHRLSGQ
Ga0207433_1010890253300027863Hot SpringTVAEYFDIIHALDPDLAEYRKDVLEIFVQRPNRTHGKQGAISAARFVQMHQELLLSKLSKWIGNSDRRVITRFLRQLQALCTYEHLVVPENRRHETLVDLSIVATWHVVDGIHRLSG
Ga0209486_1090651023300027886Agricultural SoilEIKETVAEYFDINHAVDPDLAEYRRDLLEIFPRRGPRARGRSPSMGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEQFLRQMQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSG
Ga0255358_103119223300028069SoilRETVAEYFDINHALDPDLAEYRKDLLDIFPRRSPRARGSQGALSAARFIQQHQRLLVSKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSG
Ga0265326_1007918423300028558RhizosphereDVEGVCKGTPPNHRLGTRVGYETIKETVADYFDIAHAVDPDLAEYRSDLLEIFPRRPERSGQSQNAVSAARFIQQHQRMLMDKLGLWIAKSDRRVVGQFLRQLQALCTYEHLVVPESQRSEKLVDLTIMATWHVLDGIHRLSGD
Ga0302162_1006872423300028649FenSHAVDPDLAEYRRDLLEIFPKRREGARNSQSALSAARFIQQNQRMLVDKMAGWIGKSDRRVISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0302160_1012714113300028665FenSRWRRRYKDWQVALAKLEYVDRVVDLEGVCRVVPPNQRSGKRVGFETIKESVADYLGIAHTVDPDLVEYRRDLLEIFPRRPEGARSRQSALSAARFIQQHQRVLIDKIGGWIGDSDRRVISKFLRQLQALCTYEHLVVPESQRNDKVVDLTIVATWHVLDGIHRLSGE
Ga0302169_1005333913300028679FenLDPSSRWRRRYRNWQVALTKLEYVDRIIDLEGACRGTPTNQRIGSQAPYRELKETVAEYFDINHALDPDLAEYRKDLLDIFPRRSPHARGAQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0302208_1012303123300028774FenGYESIKETVADYLDIAHVVDPDLLEYRRDLLEIFPRRSERARSQQSALSAARFIQQHQRVLIDKIGAWIGKSDRRVISRFLRQLQALCTYEHLVVPESQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0265338_1052268613300028800RhizosphereLDPDLAEYRRDLLEIFPRRSERTQAGQNALSAARFIQQQQHMLVDKMGGWIGKSDRRVIGRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSDK
Ga0302163_1007279923300028868FenWQVALAKLEYLDRIVDVEGACRGTPPNQRLGQRVGYEAIKETVADYFDIAHVVDPDLAEYRRDLLEIFPRRPESARSARSGLSAARFIQQNQRMLVDKMVGWIGKSDRRVIERFLRQLQALCTYEHLVVPENQRHDKLVDLTIVATWHVLDGIHRLSGE
Ga0311347_1077187313300029923FenDLEGACRGTPTNQRTGSQAPYSEIRETVAEYFDINHALDPDLAEYRKDLLDIFPRRSPRARGSQGALSAARFIQQHQRLLVSKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSG
Ga0302298_1016478913300029980FenEYVDRIIDLEGACRGTPTNQRTGSQAPYSEIRETVAEYFDINHALDPDLAEYRKDLLDIFPRRSPRARGSQGALSAARFIQQHQRLLVSKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSG
Ga0311332_1129614713300029984FenLDRIVDVEGACRGTPPNQRLGQRVGYEIIKETVADYFDIAHVVDPDLAEYRRDLLEIFPRRPERARSTQSGLSAARFIQQHQRMLVDKMGGWIGKSDRRIISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0311334_1039713813300029987FenTVAEYFDINHALDPDLAEYRKDLLDIFPRRSPHARGAQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSG
Ga0311334_1086803013300029987FenACKGAPPNQREGQRLEYQSIKETVADYFDISHAVDPDLAEYRRDLLEIFPKRREGARNSQSALSAARFIQQNQRMLVDKMAGWIGKSDRRVISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0311336_1168983413300029990FenTVADYFDISHAVDPDLAEYRRDLLEIFPKRPVGARRNQSALSAARFIQQNQRMLVDKVAGWIGKSDRQVISRFLRQLQALCTYEQLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0311337_1137600423300030000FenQSIKETVADYFDISHAVDPDLAEYRRDLLEIFPKRREGARNSQSALSAARFIQQNQRMLVDKMAGWIGKSDRRVISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0311348_1064313323300030019FenLGYESIKETVADYLDIAHVVDPDLLEYRRDLLEIFPRRSERARSQQSALSAARFIQQHQRVLIDKIGAWIGKSDRRVISRFLRQLQALCTYEHLVVPESQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0311348_1104444923300030019FenYRRDLLEIFPRRSERARSQQSALSAARFIQQHQHVLIDKIGGWIGNSDRRIISHFLRQLQALCTYEHLVVPESQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0302286_1038270723300030047FenNQRLGQRLVYGDIKETVADYFDIEHTVDPDLAEYRHDLLDIFAKRSEKARGTQGAISAARFIQQYQGMLIEKLGGWIEKSDRRVISRFLRQLQALCTYEHLVVPENQRNEKLVDLTIVATWHVLDGIHRLSGK
Ga0311349_1052576233300030294FenGVPPNQRSGKRVGFETIKESVADYLGIAHTVDPDLVEYRRDLLEIFPRRPEGARSRQSALSAARFIQQHQRVLIDKIGGWIGDSDRRVISKFLRQLQALCTYEHLVVPESQRNDKVVDLTIVATWHVLDGIHRLSGE
Ga0311349_1089199323300030294FenVADYFDISHAVDPDLAEYRRDLLEIFPKRREGARNSQSALSAARFIQQNQRMLVDKMAGWIGKSDRRVISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0311360_1132911913300030339BogEGACKGAPPNQRMGQRVGYESIKETVADYFDIAHVVDPDLAEYRRDLLEIFPKRPERARSTQSGLSAARFIQQHQRMLVDKMGAWIGKSDRRVIGRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0311360_1149334413300030339BogPTSRWRRRYGGWQVALAKLEYVDRIIDVEGACRGIPPNQRLGQRLVYGDIKETVADYFDIEHTVDPDLAEYRHDLLDIFAKRSEKARGTQGAISAARFIQQYQGMLIEKLGGWIEKSDRRVISRFLRQLQALCTYEHLVVPENQRNEKLVDLTIVATWHVLDGIHRLSGK
Ga0265330_1023981923300031235RhizosphereHAVDPDLAEYRRDLLEIFPRRSERARSSQNALSAARFIQQHQRMLVDKMGGWIGKSDRRVIGRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0265330_1039182513300031235RhizosphereDRIIDLEGACRGTPDNQRTGSQATYLELRETVAEYFDINHALDPDLAEYRRDLLDIFPRRSARARGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIAKFLRELQALCTYEHLVVPENRRHEKLVDLTIVATWHVVDGIHRLSE
Ga0265332_1022267223300031238RhizosphereYETIKETVADYFDISHAVDPDLAEYRRDLLEIFPRRSERARSSQNALSAARFIQQHQRMLVDKMGGWIGKSDRRVIGRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0265320_1006203113300031240RhizosphereVKHEDLDRIVDVEGVCKGTPPNHRLGTRVGYETIKETVADYFDIAHAVDPDLAEYRSDLLEIFPRRPERSGQSQNAVSAARFIQQHQRMLMDKLGLWIAKSDRRVVGQFLRQLQALCTYEHLVVPESQRSEKLVDLTIMATWHVLDGIHRLSGD
Ga0265329_1021763213300031242RhizosphereIIDLEGACRGTPSNQRTGSQAPYGEIRETVAEYFEIDHALDPDLAEYRKDLLDIFPRRAASARGSQAALSAARFIQQHQRLLVSKLGGWIGDSDRRVIGKFLRQLQALCTYEHLVVPENRRNETLVDLTIVATWHVVDGIHRLSE
Ga0265339_1001306813300031249RhizosphereCRGTPPNQRPGKRVGYETIRETVADYLDIAHAVDPDLAEYRRDLLEIFPRRPERARSSQSALSAARFIQQNQRMLVDKMGGWIGRSDRRVISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0311364_1133220913300031521FenVDRIIDLEGACRGTPTNQRIGSQAPYRELKETVAEYFDINHALDPDLAEYRKDLLDIFPRRSPHARGAQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSG
Ga0265342_1043837413300031712RhizosphereRKDLLEIFPRRSQRVRGAQGALSAARFIQQHQQLLVDKLRGWIGDSDRRVINTFLRQLQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSG
Ga0311351_1085555713300031722FenGQRLVYGDIKETVADYFDIEHTVDPDLAEYRHDLLDIFAKRSEKARGTQGAISAARFIQQYQGMLIEKLGGWIEKSDRRVISRFLRQLQALCTYEHLVVPENQRNEKLVDLTIVATWHVLDGIHRLSGK
Ga0302321_10100103713300031726FenDPDLAEYRKDLLDIFPRRSQRARGSQAALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRQLQALCTYEHLLVPENRRNEKLVDLTIVATWHVVDGIHRLSD
Ga0316576_1031909113300031727RhizosphereRVPYTEIRETVAECFDIGHVLDPDLEEYRRDLLDIFPRRPAPKAPKRALSAARFIQQNQLLLVEKLSGWIGRSDRRVITRFLRQLQALCAYEQLVVPEDLRSEALMDITIMATWHVVDGIHKLSED
Ga0307468_10201458123300031740Hardwood Forest SoilEYRKDLLDIFPRRPASSRAGQRGDAQSAARFIQQHQRLLVDRLGGWIHSSDRRVIKRFLRQLEALCTSENLVVTETRRAEKLVDLTVIATWHVLDGIHRLSE
Ga0302322_10090935423300031902FenDINHALDPDLAEYRKDLLDIFPRRSPSARGSQGALSAARFIQQHQRLLISKLGGWIGNSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0302322_10206422623300031902FenAEYRHDLLDIFAKRSEKARGTQGAISAARFIQQYQGMLIEKLGGWIEKSDRRVISRFLRQLQALCTYEHLVVPENQRNEKLVDLTIVATWHVLDGIHRLSGK
Ga0311367_1200916223300031918FenVADYFDIANAVDPDLAEYRNDLLEIFPRRSDRSRSPQGALSAARFIQQHQRMLIDKIRLWIGKSDRRVVGRFLRQLQALCTYEHLVAPEAQRNEKLVDLTIVATWHVLDGIHRLSDKQSRRK
Ga0307471_10406814713300032180Hardwood Forest SoilPNTRPGLRLPYTEIKETVAEYFDIDHALDPDLAEYRRDLMEIFPRRPPRARGRAQMGKTQNAQSAARFIQQHQRLLVNKLSGWIGNSDRRVIEQFLRQMQALCTYEHLVVPDNRRNEKIVDLTIVATWHVVDGIHRLSG
Ga0335085_1059534333300032770SoilVALAKLEYVDRIVDIEGTCRGEPPNLRAGKRVGYESLKETVADYLDIAHAVDPDLVEYRRDLLEIFPRRSGRARSRQSASSAARFIQQHQRVLIDKIGGWIGDSDRRVIGKFLRQLQALCTYEHLVVPEAQRSEKLVDLTIVATWHVLDGIHRLSGE
Ga0335085_1259377113300032770SoilHDLAEYRRDLLEIFPRRSERARSSQSALSAARFIQQNQRMLVDKVGGWIGRSDRRVISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0335070_1037153933300032829SoilEGTCRGEPPNLRAGKRVGYESLKETVADYLDIAHAVDPDLVEYRRDLLEIFPRRSGRARSRQSASSAARFIQQHQRVLIDKIGGWIGDSDRRVIGKFLRQLQALCTYEHLVVPEAQRSEKLVDLTIVATWHVLDGIHRLSGE
Ga0335069_1176020613300032893SoilAVDPDLAEYRNDLMEIFPRRSDRTRRPQGALSAARFIQQHQRMLMDKMSLWIGKSDRRVIGRFLRQLQALCTYEHLVVPEAQRNEKLVDLTIVATWHVLDGIHRLSDRQPGRK
Ga0335071_1006638113300032897SoilEGLCKGTPQNQRLGARVGYETIKETVADYFEIAHAVDPDLAEYRNDLLEIFPRRSERSGKPQSAVSAARFIQQHQRMLVDKMSLWIGKSDRRVVGQFLRQLQALCTYEHLVVPEAQRNDKLVDLTIVATWHVIDGIHRLSGG
Ga0335071_1052172123300032897SoilMGSRAGQARIRRPHRRHRRYLPGRAAQPPGKRVGYESLKETVADYLDIAHAVDPDLVEYRRDLLEIFPRRSGRARSRQSASSAARFIQQHQRVLIDKIGGWIGDSDRRVIGKFLRQLQALCTYEHLVVPEAQRSEKLVDLTIVATWHVLDGIHRLSGE
Ga0316619_1025809533300033414SoilETLKETVADYLDIAHAVDPDLVEYRRDLLEIFPRRSEPARRRPSAFSAARFIQQHQRMLIDKIGGWIGNSDRRVIGKFLRQLQALCTYEHLVVPEVQRNDKLVDLTIVATWHVLDGIHRLSGK
Ga0326726_1190594713300033433Peat SoilEYIDRIIDVEGVCRGTPHNQRMGKRVGFETIKETVADYLDIAHAVDPDLAEYRRDLLEIFSRRSERARSRQSALSAARFIQQHQRVLVDKIGGWIGKSDRRIINRFLRQLQALCTYEHLVVPESQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0316620_1145129223300033480SoilYLDIAHAVDPDLVEYRRDLLEIFPRRSEPARRRPSAFSAARFIQQHQRMLIDKIGGWIGNSDRRVIGKFLRQLQALCTYEHLVVPEAQRNDKLVDLTIVATWHVLDGIHRLSSK
Ga0316627_10090320823300033482SoilQRLGSRIGYETIKETVADYFDITHAVDPDLAEYRSDLLEIFPRRPERSRRSHGAVPAARFIQQHQEMLIEKMSLWIGKSDRRVIGRFLRQLQALCTYEHLVVPEAQRNEKLVDLTIVATWHVLDGIHRLSGK
Ga0316629_1083657723300033483SoilEYRRDLLEIFPRRSDRSRGRGSAQSAARFLQQHQNVLVDKIGGWIGKSDRRVIGRFLRQLQALCTYEHLVVPESQRNEKLVDLTIVATWHVVDGIHRLSGE
Ga0316629_1147244513300033483SoilDVEGLCKGTAPNQRLGTRIGYETIKETVADYFDITHAVDPDLAEYRNDLLEIFPRRPERSRGSQGAVPAARFIQQHQEMLIDKMSLWIGKSDRRVIGRFLRQLQALCTYEHLVVPEAQRHEKLVDLTIVATWHVLDGIHRLSGE
Ga0316588_115793713300033528RhizosphereAVDPDLAEYRRDLLEIFPRRSERARSRQSAQSAARFIQQNQKVLVDKIGVWIGRSNRRDIGRFLRQLQALCTYEHLVVPESQRSEKLVDLTIISTWHVLDGIHRLSGE
Ga0334815_000456_4405_48513300033797SoilVDRIIDLEGACRGTPTNQRIGSQAPYRELKETVAEYFDINHALDPDLAEYRKDLLDIFPRRSPHARGAQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0334821_052935_2_4783300033798SoilWQVALTKLEYIDRIIDLEGACRGAPRNQRLGSQVTYLEIRETVAEYFDINHALDPDLAEYRRDLLDIFPRRSLSARGTQGALSAARFIQQHQRLLINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLLVPENRRNEKLVDLTIVATWHVVDGIHRLSG
Ga0334817_110986_16_5283300033820SoilDPSSRWRRRYRDWQVALTKLEYVDRIIDLEGACRGTPDNQRSGSQATYLELRETVAEYFDINHALDPDLAEYRRDLLDIFPRRSARARGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0334817_117975_218_5113300033820SoilKDLLDIFPRRSPHARGAQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0334843_069772_112_5103300033825SoilNQRSGSQALYSEIKETVAEYFDINHALDPDLAEYRKDLLDIFPRRSVRARGSQGALSAARFIQQHQRLMINKLGGWIGDSDRRVIGKFLRQLQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0334848_055413_380_7183300033827SoilFDINHALDPDLAEYRRDLLDIFPRRSTRARGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0334810_103413_37_4173300033890SoilVGYETIKETVADYFDINHAVDRDLAEYRRDLLEIFPRRSERARSSQSALSAARFIQQNQRMLVDKIGAWIGKSDRRVISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHRLSGE
Ga0334822_030307_790_12093300034070SoilACRGTPDNQRSGSQATYLELRETVAEYFDINHALDPDLAEYRRDLLDIFPRRSTRARGSQGALSAARFIQQHQRLLISKLGGWIGDSDRRVIGKFLRELQALCTYEHLVVPENRRNEKLVDLTIVATWHVVDGIHRLSE
Ga0370493_0345937_34_5163300034129Untreated Peat SoilDWQVALAKLEYLDRIVDVEGACRGTAPNHRLGQRIGYETIKETVADYFDIEHAVDPDLAEYRRDLLEIFPRRSDRARSSQGALSAARFIQQHQRMLVDKMGGWIGKSDRRVISRFLRQLQALCTYEHLVVPENQRNDKLVDLTIVATWHVLDGIHTLSEK
Ga0370487_0307283_192_5363300034170Untreated Peat SoilHAVDPDLAEYRSDLFEIFPRRSQRSRRPQAALSAARFIQQHQRMLMDKIGLWIGKSDRRVIGRFLRQLQALCTYEHLVVPEAQRNEKLVDLTIVATWHVLDGIHRLSDKQPGRK
Ga0370501_0118258_537_9023300034195Untreated Peat SoilEIRETVAEYFEINHALDPDLAEYRKDLLDIFPRRAASARGSQSALSAARFIQQHQRLLVSKLGGWIGDSDRRVIGKFLRQLQALCTYEHLVVPENRRNETLVDLTIVATWHVVDGIHRLS
Ga0370485_0045331_646_11283300034358Untreated Peat SoilRNWQVALTKLEYVDRIIDLEGACRGIPENQRLGLQVPYQDIKETVAEYFDIIHALDPDLAEYRKDVLDVFARRSNRSRGSQSALSAARFIQLHQRLLVSKLAGWIGNSDRRVITRFLRQLQALCTYEHLVVPENRRNEILVDLTIVATWHVVDGIHRLSG
Ga0316598_131172_311_7003300034652Untreated Peat SoilPGLQVPYQDIKETVAGYFDIIHALDPDLAEYRRDVLEVFARRSTRVRGSQSALSAARFIQLHQRLLVSKLAGWIGNSDRRVITRFLRQLQALCTYEHLVVPENRRNEILVDLTIVATWHVVDGIHRISG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.