Basic Information | |
---|---|
Family ID | F064351 |
Family Type | Metagenome |
Number of Sequences | 128 |
Average Sequence Length | 43 residues |
Representative Sequence | MTTMPNQSAAANGLSAVRSSVAGVRERTVRSTAAAEAVAELGR |
Number of Associated Samples | 65 |
Number of Associated Scaffolds | 126 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 54.69 % |
% of genes near scaffold ends (potentially truncated) | 47.66 % |
% of genes from short scaffolds (< 2000 bps) | 78.91 % |
Associated GOLD sequencing projects | 62 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (64.062 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (53.125 % of family members) |
Environment Ontology (ENVO) | Unclassified (62.500 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.750 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 126 Family Scaffolds |
---|---|---|
PF08592 | Anthrone_oxy | 5.56 |
PF14237 | GYF_2 | 3.17 |
PF09406 | DUF2004 | 2.38 |
PF00730 | HhH-GPD | 1.59 |
PF00583 | Acetyltransf_1 | 1.59 |
PF01957 | NfeD | 1.59 |
PF14317 | YcxB | 1.59 |
PF08241 | Methyltransf_11 | 1.59 |
PF00782 | DSPc | 1.59 |
PF13365 | Trypsin_2 | 1.59 |
PF09851 | SHOCT | 0.79 |
PF04355 | SmpA_OmlA | 0.79 |
PF01906 | YbjQ_1 | 0.79 |
PF13495 | Phage_int_SAM_4 | 0.79 |
PF13088 | BNR_2 | 0.79 |
PF00497 | SBP_bac_3 | 0.79 |
PF07099 | DUF1361 | 0.79 |
PF13578 | Methyltransf_24 | 0.79 |
PF00903 | Glyoxalase | 0.79 |
PF00578 | AhpC-TSA | 0.79 |
PF04024 | PspC | 0.79 |
PF01223 | Endonuclease_NS | 0.79 |
PF10539 | Dev_Cell_Death | 0.79 |
PF07237 | DUF1428 | 0.79 |
PF11319 | VasI | 0.79 |
PF06445 | GyrI-like | 0.79 |
PF16347 | DUF4976 | 0.79 |
PF01909 | NTP_transf_2 | 0.79 |
PF13590 | DUF4136 | 0.79 |
PF04832 | SOUL | 0.79 |
PF11622 | DUF3251 | 0.79 |
PF13031 | DUF3892 | 0.79 |
PF08410 | DUF1737 | 0.79 |
PF13899 | Thioredoxin_7 | 0.79 |
PF15637 | Tox-HNH-HHH | 0.79 |
COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
---|---|---|---|
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.59 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.59 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.59 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.59 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.59 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.79 |
COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.79 |
COG2913 | Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG4330 | Uncharacterized membrane protein, DUF1361 domain | Function unknown [S] | 0.79 |
COG5507 | Uncharacterized conserved protein YbaA, DUF1428 family | Function unknown [S] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.84 % |
Unclassified | root | N/A | 35.16 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002523|JGI25326J35508_1056314 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300002531|JGI25327J35509_1008323 | All Organisms → cellular organisms → Bacteria | 4508 | Open in IMG/M |
3300003310|D1draft_1024909 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Prosthecobacter → Prosthecobacter vanneervenii | 1589 | Open in IMG/M |
3300003994|Ga0055435_10158827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp. | 633 | Open in IMG/M |
3300004000|Ga0055458_10064027 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
3300004027|Ga0055459_10122993 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300004070|Ga0055488_10037922 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300004779|Ga0062380_10553173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Anthocerotibacter → Anthocerotibacter panamensis | 515 | Open in IMG/M |
3300005294|Ga0065705_10848224 | Not Available | 574 | Open in IMG/M |
3300005518|Ga0070699_101684194 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera | 581 | Open in IMG/M |
3300005526|Ga0073909_10264179 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera | 769 | Open in IMG/M |
3300006046|Ga0066652_100143555 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1992 | Open in IMG/M |
3300009012|Ga0066710_102896269 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera | 673 | Open in IMG/M |
3300009100|Ga0075418_13023398 | Not Available | 513 | Open in IMG/M |
3300009506|Ga0118657_10015106 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 15394 | Open in IMG/M |
3300009506|Ga0118657_10149732 | All Organisms → cellular organisms → Bacteria | 3331 | Open in IMG/M |
3300009506|Ga0118657_11379970 | Not Available | 838 | Open in IMG/M |
3300009509|Ga0123573_11222049 | Not Available | 701 | Open in IMG/M |
3300009870|Ga0131092_10840292 | Not Available | 761 | Open in IMG/M |
3300009870|Ga0131092_11538948 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 502 | Open in IMG/M |
3300010293|Ga0116204_1267922 | Not Available | 537 | Open in IMG/M |
3300010313|Ga0116211_1201822 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300010335|Ga0134063_10332028 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera | 736 | Open in IMG/M |
3300010353|Ga0116236_11114950 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300010398|Ga0126383_10763800 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
3300012353|Ga0137367_11042760 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300012948|Ga0126375_11797105 | Not Available | 535 | Open in IMG/M |
3300012956|Ga0154020_10792512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
3300012956|Ga0154020_11257318 | Not Available | 557 | Open in IMG/M |
3300012956|Ga0154020_11257318 | Not Available | 557 | Open in IMG/M |
3300012985|Ga0164308_10967980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera | 754 | Open in IMG/M |
3300013087|Ga0163212_1049056 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1424 | Open in IMG/M |
(restricted) 3300013123|Ga0172368_10017313 | All Organisms → cellular organisms → Bacteria | 6253 | Open in IMG/M |
(restricted) 3300013123|Ga0172368_10017313 | All Organisms → cellular organisms → Bacteria | 6253 | Open in IMG/M |
(restricted) 3300013123|Ga0172368_10218728 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → Chlorobia → Chlorobiales → Chlorobiaceae → Chlorobium/Pelodictyon group → Chlorobium → unclassified Chlorobium → Chlorobium sp. KB01 | 959 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10168173 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10276826 | Not Available | 1004 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10159830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 1815 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10740827 | Not Available | 614 | Open in IMG/M |
(restricted) 3300013138|Ga0172371_10066631 | All Organisms → cellular organisms → Bacteria | 3597 | Open in IMG/M |
3300014298|Ga0075341_1017674 | Not Available | 974 | Open in IMG/M |
3300014306|Ga0075346_1050956 | Not Available | 819 | Open in IMG/M |
3300017788|Ga0169931_10165064 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1959 | Open in IMG/M |
3300017966|Ga0187776_10509013 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 825 | Open in IMG/M |
3300018064|Ga0187773_10749514 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300020074|Ga0194113_10180857 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300020074|Ga0194113_10346833 | Not Available | 1108 | Open in IMG/M |
3300020074|Ga0194113_10392361 | Not Available | 1022 | Open in IMG/M |
3300020074|Ga0194113_10421068 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300020074|Ga0194113_10606840 | Not Available | 771 | Open in IMG/M |
3300020074|Ga0194113_10896682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 599 | Open in IMG/M |
3300020074|Ga0194113_10910963 | Not Available | 593 | Open in IMG/M |
3300020083|Ga0194111_10265878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae | 1201 | Open in IMG/M |
3300020083|Ga0194111_10579518 | Not Available | 707 | Open in IMG/M |
3300020083|Ga0194111_10692576 | Not Available | 627 | Open in IMG/M |
3300020084|Ga0194110_10214945 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1436 | Open in IMG/M |
3300020084|Ga0194110_10610158 | Not Available | 690 | Open in IMG/M |
3300020109|Ga0194112_10141323 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
3300020109|Ga0194112_10357504 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 1076 | Open in IMG/M |
3300020109|Ga0194112_10378893 | Not Available | 1033 | Open in IMG/M |
3300020109|Ga0194112_10651602 | Not Available | 710 | Open in IMG/M |
3300020156|Ga0196970_1051135 | Not Available | 854 | Open in IMG/M |
3300020179|Ga0194134_10305018 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 626 | Open in IMG/M |
3300020193|Ga0194131_10028469 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 4744 | Open in IMG/M |
3300020193|Ga0194131_10042842 | Not Available | 3272 | Open in IMG/M |
3300020193|Ga0194131_10053812 | Not Available | 2663 | Open in IMG/M |
3300020193|Ga0194131_10061121 | Not Available | 2379 | Open in IMG/M |
3300020193|Ga0194131_10067683 | All Organisms → cellular organisms → Bacteria | 2183 | Open in IMG/M |
3300020193|Ga0194131_10079665 | Not Available | 1903 | Open in IMG/M |
3300020193|Ga0194131_10096899 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1621 | Open in IMG/M |
3300020193|Ga0194131_10098210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1603 | Open in IMG/M |
3300020193|Ga0194131_10144910 | Not Available | 1185 | Open in IMG/M |
3300020193|Ga0194131_10150223 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 1154 | Open in IMG/M |
3300020193|Ga0194131_10265138 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 786 | Open in IMG/M |
3300020193|Ga0194131_10291809 | Not Available | 741 | Open in IMG/M |
3300020193|Ga0194131_10347566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis elabens | 668 | Open in IMG/M |
3300020196|Ga0194124_10445543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300020197|Ga0194128_10017666 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 | 7233 | Open in IMG/M |
3300020197|Ga0194128_10024858 | All Organisms → cellular organisms → Bacteria | 5435 | Open in IMG/M |
3300020197|Ga0194128_10044442 | All Organisms → cellular organisms → Bacteria | 3372 | Open in IMG/M |
3300020197|Ga0194128_10066140 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia | 2469 | Open in IMG/M |
3300020197|Ga0194128_10070412 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
3300020197|Ga0194128_10076340 | Not Available | 2211 | Open in IMG/M |
3300020197|Ga0194128_10228478 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
3300020197|Ga0194128_10232813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Prochlorotrichaceae → Nodosilinea → Nodosilinea nodulosa | 962 | Open in IMG/M |
3300020197|Ga0194128_10463394 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia → Candidatus Brocadia caroliniensis | 589 | Open in IMG/M |
3300020197|Ga0194128_10464813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 588 | Open in IMG/M |
3300020198|Ga0194120_10277213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Brevifollis → Brevifollis gellanilyticus | 858 | Open in IMG/M |
3300020200|Ga0194121_10067492 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
3300020200|Ga0194121_10170087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1225 | Open in IMG/M |
3300020200|Ga0194121_10193961 | Not Available | 1110 | Open in IMG/M |
3300020200|Ga0194121_10222383 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300020200|Ga0194121_10259374 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 903 | Open in IMG/M |
3300020200|Ga0194121_10278843 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → unclassified Pedosphaera → Pedosphaera sp. Tous-C6FEB | 860 | Open in IMG/M |
3300020200|Ga0194121_10365488 | Not Available | 720 | Open in IMG/M |
3300020200|Ga0194121_10368827 | Not Available | 716 | Open in IMG/M |
3300020200|Ga0194121_10377685 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300020204|Ga0194116_10155936 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Gracilimonas → Gracilimonas amylolytica | 1362 | Open in IMG/M |
3300020214|Ga0194132_10080969 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
3300020214|Ga0194132_10321791 | Not Available | 814 | Open in IMG/M |
3300020214|Ga0194132_10322887 | Not Available | 812 | Open in IMG/M |
3300020214|Ga0194132_10324403 | Not Available | 809 | Open in IMG/M |
3300020214|Ga0194132_10595607 | Not Available | 531 | Open in IMG/M |
3300020220|Ga0194119_10369502 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 938 | Open in IMG/M |
3300020221|Ga0194127_10581263 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
3300020578|Ga0194129_10548198 | Not Available | 556 | Open in IMG/M |
3300020603|Ga0194126_10276384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 1138 | Open in IMG/M |
3300020603|Ga0194126_10387295 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300020603|Ga0194126_10539116 | Not Available | 710 | Open in IMG/M |
3300020603|Ga0194126_10633071 | Not Available | 634 | Open in IMG/M |
3300020603|Ga0194126_10698211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300021376|Ga0194130_10012503 | All Organisms → cellular organisms → Bacteria | 8129 | Open in IMG/M |
3300025283|Ga0208048_1009459 | All Organisms → cellular organisms → Bacteria | 3598 | Open in IMG/M |
3300025283|Ga0208048_1047543 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 1053 | Open in IMG/M |
3300025554|Ga0210060_1051860 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300025563|Ga0210112_1011745 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
3300025571|Ga0207874_1010399 | All Organisms → cellular organisms → Bacteria | 4506 | Open in IMG/M |
3300025924|Ga0207694_10042527 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera | 3505 | Open in IMG/M |
3300025924|Ga0207694_10056281 | All Organisms → cellular organisms → Bacteria | 3054 | Open in IMG/M |
3300026537|Ga0209157_1352694 | Not Available | 530 | Open in IMG/M |
3300028007|Ga0247718_1119432 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300031231|Ga0170824_103260403 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera | 674 | Open in IMG/M |
3300032829|Ga0335070_11608098 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300032897|Ga0335071_10315368 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300033004|Ga0335084_11740752 | Not Available | 612 | Open in IMG/M |
3300033004|Ga0335084_12056311 | Not Available | 556 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 53.12% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.38% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.69% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.12% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 2.34% |
Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 2.34% |
Ionic Liquid And High Solid Enriched | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched | 2.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.56% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.56% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.56% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 0.78% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.78% |
Hot Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring | 0.78% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.78% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.78% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.78% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.78% |
Down-Flow Hanging Sponge Reactor | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002523 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-D | Engineered | Open in IMG/M |
3300002531 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-2-D | Engineered | Open in IMG/M |
3300003310 | Down-flow hanging sponge reactor microbial communities from the University of Illinois at Urbana-Champaign, USA - L1-648F-DHS | Engineered | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004000 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004027 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D2 | Environmental | Open in IMG/M |
3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
3300010313 | Hot spring microbial communities from South Africa to study Microbial Dark Matter (Phase II) - Sagole hot spring metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010353 | AD_USCAca | Engineered | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014306 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D1 | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020156 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_5-13C | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
3300025554 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025563 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025571 | Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-1-D (SPAdes) | Engineered | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300028007 | Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_D | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25326J35508_10563142 | 3300002523 | Ionic Liquid And High Solid Enriched | MIQNQAMMPNQSAAANGLSAFRSSVAGIRERTVRSTAAAEAVAELDR |
JGI25327J35509_10083236 | 3300002531 | Ionic Liquid And High Solid Enriched | MMPNQSAAANGLSAFRSSVAGIRERTVRSTAAAEAVAELDR* |
D1draft_10249093 | 3300003310 | Down-Flow Hanging Sponge Reactor | MLMPNQRAAANGLPAVRSSIAGIRERTVRSTAAAEAVAELGR* |
Ga0055435_101588272 | 3300003994 | Natural And Restored Wetlands | NQSAAANGLSAVRSSVAGIRERTVRSAAAEAVAELGRPAS* |
Ga0055458_100640272 | 3300004000 | Natural And Restored Wetlands | MMMTLWPNQSAAANGLSAVRSSVAGIRERTVRSAAAEAVAELGRYAQNG* |
Ga0055459_101229932 | 3300004027 | Natural And Restored Wetlands | MMMTLRPNQSAAANGLSAVRSSVAGIRERTVRSAAAEAVAELGRYAQNG* |
Ga0055488_100379224 | 3300004070 | Natural And Restored Wetlands | MMMTLWPNQSAAANGLSAVRSSVASIRERTVRSAAAEAVAELGRPAS* |
Ga0062380_105531732 | 3300004779 | Wetland Sediment | MTTQRPNHALPNGLPAVRSSVAGVRERAVRSTRPAEAVAELGSLGV |
Ga0065705_108482241 | 3300005294 | Switchgrass Rhizosphere | MTTMPNQSAAANGLSAVRSSVAGVRERTVRSTAAAELGR* |
Ga0070699_1016841942 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSAAWTPNQCAAANGLCAVRSSVAGFRERAVRSTRTAEAAR |
Ga0073909_102641793 | 3300005526 | Surface Soil | MSIAAWTPNQCAAANGLCAVRSSVAGVRERTVRSTRAAEAVAEL |
Ga0066652_1001435551 | 3300006046 | Soil | VNLMSIAAWTPNQCAAANGLCAVRSSVAGVRERTVRS |
Ga0066710_1028962691 | 3300009012 | Grasslands Soil | MSIAAWTSNQCAAANGLCAVRSSVAGVRERTVRSTRAAEAIAELG |
Ga0075418_130233982 | 3300009100 | Populus Rhizosphere | MTTMPNQSAAANGLSAVRSSVAGVRERTVRSTAAAEAVAELGR* |
Ga0118657_1001510616 | 3300009506 | Mangrove Sediment | MTSEYCRDVASNKGAAANGLSAVRSGVAGVRERTVRSTAAAEAVAELGR* |
Ga0118657_101497323 | 3300009506 | Mangrove Sediment | MPNQGAAANGLSAVRSSVAGVGERTVRSTAAAEAVAELGRSLI* |
Ga0118657_113799702 | 3300009506 | Mangrove Sediment | MMPNQIAAANGLSAVRSSVAGVRERTVRSTAAAEAVAELGRSINEPVVV* |
Ga0123573_112220491 | 3300009509 | Mangrove Sediment | MDFEDSSLLTTMQPNQGAAANGLSGVRSRVAGIPERTLRSTAAEAVAGLDR* |
Ga0131092_108402921 | 3300009870 | Activated Sludge | MFAPNQSAAANGLSAVRSSVAGIRERTVRSTAAAEAVAE |
Ga0131092_115389481 | 3300009870 | Activated Sludge | MPNQSAAANGLSAVRSSVAGVRERTVRTTAAAEAVAELNR* |
Ga0116204_12679222 | 3300010293 | Anoxic Lake Water | MEIDSMWSNQSAAANGLSAVRSSIAGIRERTVRSTAAAEAVAELGR* |
Ga0116211_12018222 | 3300010313 | Hot Spring | AAANGLSAVRSSVAGIRERTVRSTAAAEAVAELGR* |
Ga0134063_103320281 | 3300010335 | Grasslands Soil | MSIAAWTPNQCAAANGLCAVRSSVAGVRERTVRSTRAAEAVA |
Ga0116236_111149502 | 3300010353 | Anaerobic Digestor Sludge | VTWLNQGAAANPDQIGTVRSSVAGVRERTVRSPAAGGAVGELGSLGV* |
Ga0126383_107638002 | 3300010398 | Tropical Forest Soil | MTATPKQGAAANGLSAVRSSVAGIRERTVRSTATPEAVAELSR* |
Ga0137367_110427602 | 3300012353 | Vadose Zone Soil | VLQQPNQGAAANGLSAVRSSVAGVRERAVRSTRAAEAVAELGSLGV |
Ga0126375_117971051 | 3300012948 | Tropical Forest Soil | GRAAANGLPVFRSSAAGVRERTVRSTRAAEAVAQLGR* |
Ga0154020_107925121 | 3300012956 | Active Sludge | MTTLWPNKGAAANGLSAVRSSIAGIRERTVRSTAAAEAVAELGR* |
Ga0154020_112573181 | 3300012956 | Active Sludge | MTKLWPNQGAAANGLSAVRSSVAGIRERTVRSTAAAEAVAELGR* |
Ga0154020_112573183 | 3300012956 | Active Sludge | CCCDSKDIAMMPNQSAAANGLSAVRSSVAGIRERTVRSTAAAEAVAELDR* |
Ga0164308_109679801 | 3300012985 | Soil | VNLMSIAAWTPNQSSAANGLCAVRSSVAGVRERTVRST |
Ga0163212_10490562 | 3300013087 | Freshwater | VRRAANKGAAANGLSAVRSRVAEIRERTVRSTAVAEAVAELGR* |
(restricted) Ga0172368_1001731311 | 3300013123 | Freshwater | MMTPNQGAAANGLSAVRSSVAGVRERAVRSTAAPEAVAELGR* |
(restricted) Ga0172368_100173137 | 3300013123 | Freshwater | MICDCKLQANQSAAANGLSAVRSSVAGVRERTVRSTAAAEAVAELDR* |
(restricted) Ga0172368_102187281 | 3300013123 | Freshwater | VTTRWPNKCAAANGLSAVRSSGAGVRERTVHSTAAPEAVAELG |
(restricted) Ga0172367_101681733 | 3300013126 | Freshwater | MTTLPPNQSAAANGLSAVRSRVAGNRERAVRSTAAAEAVAELGRSLSQA |
(restricted) Ga0172367_102768261 | 3300013126 | Freshwater | RWPNKCAAANGLSAVRSSGAGVRERTVHSTAAPEAVAELGR* |
(restricted) Ga0172375_101598301 | 3300013137 | Freshwater | MICDCKLQANQSAAANGLSAVRSSVAGVRERTVRSTAAAEAVAEL |
(restricted) Ga0172375_107408271 | 3300013137 | Freshwater | MSMTETPNQGAAANGLSAVRSSVAGIRERAVRSTAAAEAVAELGR* |
(restricted) Ga0172371_100666315 | 3300013138 | Freshwater | MPNQGAAANGLSAVRSSVAGIRERTVRSTAAAEAVAELDR* |
Ga0075341_10176741 | 3300014298 | Natural And Restored Wetlands | MEMMPNQGAAANGLSAVRSSVAGVRERTVRSTRAAEAVAEL |
Ga0075346_10509562 | 3300014306 | Natural And Restored Wetlands | MIQPNQGAAANGLSAVRSCVAGVRERTVRSTRAAEAVAELDR* |
Ga0169931_101650642 | 3300017788 | Freshwater | MTRWPNKGAAANGLSAVRSRVAGIRELTVRSTAAAEAVAELGR |
Ga0187776_105090133 | 3300017966 | Tropical Peatland | MKGTANKGAAANGLSAVRSSVAGIRERTVRSTATAEAVAELGR |
Ga0187773_107495142 | 3300018064 | Tropical Peatland | MTTLWPNQGAAANGLSAVRSSVAGIRERAVRSTAAAEAVAELDR |
Ga0194113_101808571 | 3300020074 | Freshwater Lake | GAAANGLSAVRSSIAGIRERTVRSTAAPEAVAELGSLAA |
Ga0194113_103468333 | 3300020074 | Freshwater Lake | MTTTANQSAAANGLSAVRSSVAGNRERAVRSTAAA |
Ga0194113_103923612 | 3300020074 | Freshwater Lake | MTPSPNQGAAANGLSAVRSRVAGVRERTVRSTAPAEAVAELGR |
Ga0194113_104210681 | 3300020074 | Freshwater Lake | LTPNKGAAANGLSAVRFCIAGVRERMVRSTAAPEAVAELGR |
Ga0194113_106068402 | 3300020074 | Freshwater Lake | MTMTWPNQGAAANGLSAVRSSIAGVCERTVRSTAAPEAVAELGR |
Ga0194113_108966821 | 3300020074 | Freshwater Lake | MTIYTPNQGAAANGLSAVRSSVAGVRERTVRSTAAAEAVAELGR |
Ga0194113_109109631 | 3300020074 | Freshwater Lake | MFREPNQSAAANGLSAVRSSVAGVRERTVRSTAAVEAVAELDR |
Ga0194111_102658782 | 3300020083 | Freshwater Lake | MPHNRRVAANGLYAVRSNGAEVRERTVRSTAAPEAVAELGR |
Ga0194111_105795183 | 3300020083 | Freshwater Lake | MPPNQGAAANDLSAVRSGVAGVRKRTVRSTAAAEAAAELGRPTAEV |
Ga0194111_106925762 | 3300020083 | Freshwater Lake | NQGAAANGLSAVRSSVAGVRERTVRSTAAAEAVAELGR |
Ga0194110_102149452 | 3300020084 | Freshwater Lake | MTTVWANQSAAANGLSAVRSSVAGNCERTVRSTAAPEAVAELDR |
Ga0194110_106101583 | 3300020084 | Freshwater Lake | MTMWPNQGAAANGLYAVRSNGAEVRERTVRSTAAPEAV |
Ga0194112_101413231 | 3300020109 | Freshwater Lake | HTQSLTPNKGAAANGLSAVRFCIAGVRERMVRSTAAPEAVAELGR |
Ga0194112_103575043 | 3300020109 | Freshwater Lake | MTTTPNQSAAANGLSAVRSCVAGVRERTVRSTAAPEAVAEL |
Ga0194112_103788931 | 3300020109 | Freshwater Lake | MTMTWPNQGAAANGLSAVRSSIAGIRERTVRSTAAPEAVAELGSLAA |
Ga0194112_106516024 | 3300020109 | Freshwater Lake | LKTNRKTQANQGAAANGLSAVRSSVAGIRERTVRSTAAAEAVAELGR |
Ga0196970_10511352 | 3300020156 | Soil | VMTMLSPNQGATANGLSAVCSSVAGVRERTVRSTAAAEAVAELGR |
Ga0194134_103050181 | 3300020179 | Freshwater Lake | MSFVYSKQQPNQSAAANGLSAVRSRGAGIRERTVRSTAAAEAVAELGR |
Ga0194131_100284692 | 3300020193 | Freshwater Lake | MTIYTPNQGAAANGLSAVRSRVAGVRERTVRSTAAAEAVAELGR |
Ga0194131_100428423 | 3300020193 | Freshwater Lake | MIVRSVTKSPNQGAAANGLSAVRSSVAGNRERTVRSTAAPEAVAELGR |
Ga0194131_100538124 | 3300020193 | Freshwater Lake | MTPSPNQGAAANGLSAVRSSVAGVRERDVRSTAAAEAVAELGRSAI |
Ga0194131_100611214 | 3300020193 | Freshwater Lake | MGRPNQGAAANGLSAVRSSVAGIRERTVRSTAAAEAVAELGR |
Ga0194131_100676834 | 3300020193 | Freshwater Lake | MPPNQGAAANGLSAVRSSVAGIRERAVRSTAAPEAVAELGR |
Ga0194131_100796653 | 3300020193 | Freshwater Lake | HGVAANGLSAVRSSVAGIRERTVRSTAAAEAVAELGRSA |
Ga0194131_100968992 | 3300020193 | Freshwater Lake | MIWPSNHGAAANGLSAVRSSVAGIRERTVRSTAAAEAVAELGR |
Ga0194131_100982102 | 3300020193 | Freshwater Lake | MTTWSNQSAAANCLSAVRSSVGGVRERIVRSTAAAEAVAELGR |
Ga0194131_101449101 | 3300020193 | Freshwater Lake | MTMTWPNQGAAANGLSAVRSSIAGIRERTVRSTAAPEAVAELGSL |
Ga0194131_101502233 | 3300020193 | Freshwater Lake | MKTLANKGAAANGLSAVRSSVAGVRERTVRSTAAPEAVAELGR |
Ga0194131_102651382 | 3300020193 | Freshwater Lake | MLTMPPNQGAAANDLSAVRSGVAGVRKRTVRSTAAAEAAAELGRPTAEV |
Ga0194131_102918091 | 3300020193 | Freshwater Lake | PCMASNGLSAVRSSVAGVRERTVRSTAAAEAVAELGRSALLAHLS |
Ga0194131_103475661 | 3300020193 | Freshwater Lake | MTWPNQGAAANGLAAVRSSDAGNRERTVRSTAAPEAVAEL |
Ga0194131_104817131 | 3300020193 | Freshwater Lake | FAGDDMSEILSMPPNQSAAANGLSAVRSSVAGIRERMVRSTAAAEAVAELGR |
Ga0194124_104455432 | 3300020196 | Freshwater Lake | MTPNQGAAANGLSAVRSGVAGVRERMVRSTAAPEAVAELDRWAASH |
Ga0194128_100176663 | 3300020197 | Freshwater Lake | MPNQGAAANGLSAVRSSVAGVRERTVRSTAAPEAVAELGR |
Ga0194128_100248582 | 3300020197 | Freshwater Lake | MTKLMPNQGAAANGLSAVRSSVAGVRERTVRSTAAPEPAAELGR |
Ga0194128_100444422 | 3300020197 | Freshwater Lake | MTWPNQGAAANGLSAVRSSVAEVRERTVRSTAAAEAVAELGR |
Ga0194128_100661404 | 3300020197 | Freshwater Lake | MTKMPSNQGAAANGLSAVRSRVAGVRERTVRSTAAPEAVAELGR |
Ga0194128_100704121 | 3300020197 | Freshwater Lake | MPHNRRVAANGLYAVRSNGAEVRERTVRSTAAPEAVAKLGR |
Ga0194128_100763402 | 3300020197 | Freshwater Lake | MTATPNHGAAANGLSAVRSSVAGIRERTVRSTAAAEAVAELGRSA |
Ga0194128_102284783 | 3300020197 | Freshwater Lake | MTTRANQSAAANGLSVVRSSVAGVRERTVRSTAAAEAVAELGR |
Ga0194128_102328131 | 3300020197 | Freshwater Lake | GAAANGLSAVRSSVAGVRERTVRSTADAEAVAELGR |
Ga0194128_104633943 | 3300020197 | Freshwater Lake | RANQSAAANGLSVVRSSVAGVRERTVRSTAAAEAVAELGR |
Ga0194128_104648131 | 3300020197 | Freshwater Lake | NKGAAANGLSAVRSSVAGNRERTVRSTAPAEAVAELGR |
Ga0194120_102772131 | 3300020198 | Freshwater Lake | MFRCLMRYVRWPNQGAAANGLSAVRSSVAGDRERTVRSTAAPEAVA |
Ga0194121_100674921 | 3300020200 | Freshwater Lake | MSEILSMPLKQGAATNGLSAVRSSVAANRARTVRCTAAPET |
Ga0194121_101700871 | 3300020200 | Freshwater Lake | MTKLMPNQGAAANGLSAVRSSVAGNRERTVRSTAAPEAAAELGRS |
Ga0194121_101939612 | 3300020200 | Freshwater Lake | MTKLMPNQGAAANGLSAVRSSVAGVRERTVRSTAAAEAVAELGR |
Ga0194121_102223831 | 3300020200 | Freshwater Lake | MFTERTANQGAAANGLSAVRSSVAGNRERTVRSTAAPEAVAELGR |
Ga0194121_102593741 | 3300020200 | Freshwater Lake | MIWPSNHGAAANGLSAVRSSVAGIRERTVRSTAAAEAVA |
Ga0194121_102665552 | 3300020200 | Freshwater Lake | MLPPNQGAAANGLSAVRSSVAGVRERTVRPTVAPEAVRDA |
Ga0194121_102788431 | 3300020200 | Freshwater Lake | MMTTPNQSAAANGLSAFRSSVAGVRERTVRSTAAAEAVAELGR |
Ga0194121_103654882 | 3300020200 | Freshwater Lake | GAAANGLSAVRSSIAGIRERTVRSTAAPEAVAELGSLANPN |
Ga0194121_103688271 | 3300020200 | Freshwater Lake | AAANGLSAVRSSVAGIRERTVRSTAAAEAVAELGR |
Ga0194121_103776851 | 3300020200 | Freshwater Lake | MFSTCLRTRRANQGAAANGLSAVRSSVAGVRKRTVRSTAAAEAVAE |
Ga0194116_101559363 | 3300020204 | Freshwater Lake | MTTWSNQSAAANGLSAVRSSVGGVRERIVRSTAAAEAVAELGR |
Ga0194132_100809695 | 3300020214 | Freshwater Lake | TWPNQGAAANGLSAVRSSIAGIRERTVRSTAAPEAVAELGSLAA |
Ga0194132_103217912 | 3300020214 | Freshwater Lake | MRTRPNQSAAANGLSAVRSIIAGVRERTVRSTATPEAVAELDRYLAGDCRAQ |
Ga0194132_103228872 | 3300020214 | Freshwater Lake | FISKPPNQGAPANGLSAVRSRVAGIRERTVRSTAAAEAVAELDRSAT |
Ga0194132_103244031 | 3300020214 | Freshwater Lake | WPNKCAAANGLSAVRSSVAGVRERTVRSTAAAEAVAELGR |
Ga0194132_105956072 | 3300020214 | Freshwater Lake | MILPPNKGAAANGLSAVRSSVAGNRERTVRSTAPAEAVAELGR |
Ga0194119_103695022 | 3300020220 | Freshwater Lake | MTTMWPNQGAAANGLSAVRSSVAGIRERTVRSTAAAEAVAELG |
Ga0194127_105812631 | 3300020221 | Freshwater Lake | MAQANQSAAANGLSAVRSSIAGARERAVRSTTAAEAV |
Ga0194129_105481981 | 3300020578 | Freshwater Lake | MTMTWPNQGAAANGLSAVRSSIAGIRERTVRSTAAPEAVAELGSLGVSA |
Ga0194126_102763842 | 3300020603 | Freshwater Lake | MTIYTPNQGAAANGLSAVRSSVAGVRERTVRSTAAVEAVAELDR |
Ga0194126_103872952 | 3300020603 | Freshwater Lake | NKGAAANGLSAVRFCIAGVRERTVRSTTAEAVAELGR |
Ga0194126_105391163 | 3300020603 | Freshwater Lake | MPPNQGAAANDLPAVRSRVTGVREHTARSTAAAEAAAE |
Ga0194126_106330712 | 3300020603 | Freshwater Lake | RQSLTQSAAANGLSAIRSSVAGVRERTVRSTAAPEAVAELGRSA |
Ga0194126_106982111 | 3300020603 | Freshwater Lake | MTPNQGAAANGLSAVRSGVAGVRERMVRSTAAPEAVAELDRWAASHTYAPNLRPFR |
Ga0194130_100125031 | 3300021376 | Freshwater Lake | TPNKGAAANGLSAVRFCIAGVRERTVRSTTAEAVAELGRYVVKRLYFH |
Ga0208048_10094594 | 3300025283 | Freshwater | MTRHMANQGAAANGLSAVRSSVAGVRERTVRSTAVAQAVAELGRWASTPVAWRD |
Ga0208048_10475431 | 3300025283 | Freshwater | VRRAANKGAAANGLSAVRSRVAEIRERTVRSTAVAEAVA |
Ga0210060_10518602 | 3300025554 | Natural And Restored Wetlands | WPNQSAAANGLSAVRSSVAGIRERTVRSAAAEAVAELGRYAQNG |
Ga0210112_10117452 | 3300025563 | Natural And Restored Wetlands | MMMTLWPNQSAAANGLSAVRSSVAGIRERTVRSAAAEAVAELGRYAQNG |
Ga0207874_10103995 | 3300025571 | Ionic Liquid And High Solid Enriched | MMPNQSAAANGLSAFRSSVAGIRERTVRSTAAAEAVAELDR |
Ga0207694_100425276 | 3300025924 | Corn Rhizosphere | VNLMTITAWTPDQCAAANGLCAVRSSVAGVWERMVRSTRAAEVAAELGSLGL |
Ga0207694_100562811 | 3300025924 | Corn Rhizosphere | LLTITAWTPDQCAAANGLCAGRSSVAGVHERTVRSTRAAGAVAELGR |
Ga0209157_13526942 | 3300026537 | Soil | MTTMPNQSAAANGLSAVRSSVAGVRERTVRSTAAA |
Ga0247718_11194321 | 3300028007 | Soil | VAVGVFSMTTWPNKGAAANGLSAVCSSVAGVRERTVRSTAAAEAVAELERSP |
Ga0170824_1032604031 | 3300031231 | Forest Soil | MSIAAWTPNQSAAANGLCAVRSSVAGVRERTVRSTRAAEAVAELGHSAPLT |
Ga0335070_116080982 | 3300032829 | Soil | PIAETMTTWPNPGAAANALSTVRSSVAGIRERAVRSTAAAEAIAELGR |
Ga0335071_103153682 | 3300032897 | Soil | MRDFTDTPNQGAAANGLSAVRSSVAGIRERTVRSTVAAEAVAELDRSAT |
Ga0335084_117407521 | 3300033004 | Soil | MAQPRPNQSAAANGLVAVRSGVAGIRERTVRSTAAAEAVAELGR |
Ga0335084_120563112 | 3300033004 | Soil | MRTMPNQGAAANGLSAVRSSVAGNRERTVRSTRAAEAVAELLSLDHYA |
⦗Top⦘ |