NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F064467

Metagenome Family F064467

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F064467
Family Type Metagenome
Number of Sequences 128
Average Sequence Length 54 residues
Representative Sequence MRQWACVFALLLGLAGNGYTASARVRLPIPIERRLESWGREGRLVQTLDWWRA
Number of Associated Samples 98
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.34 %
% of genes near scaffold ends (potentially truncated) 17.19 %
% of genes from short scaffolds (< 2000 bps) 80.47 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.062 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(19.531 % of family members)
Environment Ontology (ENVO) Unclassified
(40.625 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(51.562 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 28.40%    β-sheet: 0.00%    Coil/Unstructured: 71.60%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00496SBP_bac_5 36.72
PF01406tRNA-synt_1e 17.97
PF00535Glycos_transf_2 8.59
PF12867DinB_2 2.34
PF13485Peptidase_MA_2 2.34
PF10092DUF2330 1.56
PF08818DUF1801 0.78
PF01047MarR 0.78
PF00069Pkinase 0.78
PF00528BPD_transp_1 0.78
PF07969Amidohydro_3 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 17.97
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 17.97
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 17.97
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.12
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.78
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.78
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.78

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.06 %
UnclassifiedrootN/A10.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_101576835Not Available621Open in IMG/M
3300004114|Ga0062593_100322812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1331Open in IMG/M
3300004114|Ga0062593_100429074All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300004114|Ga0062593_102290983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi607Open in IMG/M
3300004156|Ga0062589_100011980All Organisms → cellular organisms → Bacteria3674Open in IMG/M
3300004156|Ga0062589_101854343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium607Open in IMG/M
3300004157|Ga0062590_102132056Not Available585Open in IMG/M
3300004479|Ga0062595_100148702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1358Open in IMG/M
3300004480|Ga0062592_100102885All Organisms → cellular organisms → Bacteria1776Open in IMG/M
3300004643|Ga0062591_100451145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1085Open in IMG/M
3300005093|Ga0062594_100058782All Organisms → cellular organisms → Bacteria2029Open in IMG/M
3300005172|Ga0066683_10094155All Organisms → cellular organisms → Bacteria1813Open in IMG/M
3300005332|Ga0066388_104677138Not Available696Open in IMG/M
3300005334|Ga0068869_100265374All Organisms → cellular organisms → Bacteria1376Open in IMG/M
3300005336|Ga0070680_100000054All Organisms → cellular organisms → Bacteria58906Open in IMG/M
3300005336|Ga0070680_101800340Not Available531Open in IMG/M
3300005338|Ga0068868_100604524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium972Open in IMG/M
3300005406|Ga0070703_10156727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi860Open in IMG/M
3300005440|Ga0070705_100035269All Organisms → cellular organisms → Bacteria2803Open in IMG/M
3300005440|Ga0070705_100183002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1421Open in IMG/M
3300005441|Ga0070700_101675405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium545Open in IMG/M
3300005444|Ga0070694_100601248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium886Open in IMG/M
3300005444|Ga0070694_100664339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium845Open in IMG/M
3300005445|Ga0070708_100000462All Organisms → cellular organisms → Bacteria30606Open in IMG/M
3300005457|Ga0070662_100729208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi840Open in IMG/M
3300005467|Ga0070706_100087792All Organisms → cellular organisms → Bacteria2883Open in IMG/M
3300005467|Ga0070706_100763717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium895Open in IMG/M
3300005467|Ga0070706_101458138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium626Open in IMG/M
3300005468|Ga0070707_100193583All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300005468|Ga0070707_100292134All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1584Open in IMG/M
3300005471|Ga0070698_100422938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1267Open in IMG/M
3300005471|Ga0070698_101085961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium748Open in IMG/M
3300005471|Ga0070698_101618804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium600Open in IMG/M
3300005540|Ga0066697_10237716All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300005545|Ga0070695_100377655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1069Open in IMG/M
3300005844|Ga0068862_101289716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium731Open in IMG/M
3300006852|Ga0075433_10009126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7919Open in IMG/M
3300006854|Ga0075425_100249385All Organisms → cellular organisms → Bacteria2043Open in IMG/M
3300006871|Ga0075434_100373616All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300006894|Ga0079215_10193926All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300006903|Ga0075426_10174506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1555Open in IMG/M
3300006904|Ga0075424_100494616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1306Open in IMG/M
3300006904|Ga0075424_102548936Not Available535Open in IMG/M
3300009012|Ga0066710_101031832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1270Open in IMG/M
3300009147|Ga0114129_10337817All Organisms → cellular organisms → Bacteria1999Open in IMG/M
3300009147|Ga0114129_13027912Not Available552Open in IMG/M
3300009148|Ga0105243_11113219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi799Open in IMG/M
3300009176|Ga0105242_12437532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium571Open in IMG/M
3300009789|Ga0126307_10253194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1415Open in IMG/M
3300009840|Ga0126313_10293632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1270Open in IMG/M
3300010304|Ga0134088_10436992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium641Open in IMG/M
3300010362|Ga0126377_12544317Not Available587Open in IMG/M
3300010375|Ga0105239_10056848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium4291Open in IMG/M
3300010396|Ga0134126_12719402Not Available537Open in IMG/M
3300010399|Ga0134127_10015870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5727Open in IMG/M
3300010399|Ga0134127_11113857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium854Open in IMG/M
3300010399|Ga0134127_13298240Not Available528Open in IMG/M
3300010399|Ga0134127_13504150All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300010400|Ga0134122_10788480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi905Open in IMG/M
3300010400|Ga0134122_10949832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi837Open in IMG/M
3300010401|Ga0134121_12312264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium576Open in IMG/M
3300010403|Ga0134123_10676854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1005Open in IMG/M
3300010403|Ga0134123_11043389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium837Open in IMG/M
3300012045|Ga0136623_10318895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium659Open in IMG/M
3300012046|Ga0136634_10451410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium542Open in IMG/M
3300012198|Ga0137364_11264707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium551Open in IMG/M
3300012208|Ga0137376_10303154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1387Open in IMG/M
3300012361|Ga0137360_11747634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium528Open in IMG/M
3300012529|Ga0136630_1157212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300012668|Ga0157216_10198562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium951Open in IMG/M
3300012668|Ga0157216_10268894All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300012685|Ga0137397_10701466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium752Open in IMG/M
3300012922|Ga0137394_10951281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi715Open in IMG/M
3300012989|Ga0164305_10383016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1071Open in IMG/M
3300013102|Ga0157371_11170592Not Available592Open in IMG/M
3300013297|Ga0157378_10086154All Organisms → cellular organisms → Bacteria2847Open in IMG/M
3300014497|Ga0182008_10867158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium529Open in IMG/M
3300015084|Ga0167654_1005174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2416Open in IMG/M
3300015190|Ga0167651_1058742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium795Open in IMG/M
3300015371|Ga0132258_10232646All Organisms → cellular organisms → Bacteria4491Open in IMG/M
3300015371|Ga0132258_10450652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3207Open in IMG/M
3300015371|Ga0132258_10950230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2171Open in IMG/M
3300015371|Ga0132258_12156421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1400Open in IMG/M
3300015372|Ga0132256_102031972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium681Open in IMG/M
3300017787|Ga0183260_10017163All Organisms → cellular organisms → Bacteria5544Open in IMG/M
3300018071|Ga0184618_10284002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium703Open in IMG/M
3300018076|Ga0184609_10518979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium541Open in IMG/M
3300018422|Ga0190265_10154339All Organisms → cellular organisms → Bacteria2251Open in IMG/M
3300018432|Ga0190275_10046334All Organisms → cellular organisms → Bacteria3604Open in IMG/M
3300018433|Ga0066667_10279944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1284Open in IMG/M
3300018466|Ga0190268_10320005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi945Open in IMG/M
3300018466|Ga0190268_10561405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium796Open in IMG/M
3300018476|Ga0190274_10415178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1311Open in IMG/M
3300019377|Ga0190264_10597427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium786Open in IMG/M
3300019377|Ga0190264_10761324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium729Open in IMG/M
3300021080|Ga0210382_10426414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium587Open in IMG/M
3300021344|Ga0193719_10177937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium913Open in IMG/M
3300025885|Ga0207653_10177867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi795Open in IMG/M
3300025910|Ga0207684_10042693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3845Open in IMG/M
3300025910|Ga0207684_10247486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1538Open in IMG/M
3300025910|Ga0207684_11271360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia607Open in IMG/M
3300025917|Ga0207660_10000001All Organisms → cellular organisms → Bacteria1034169Open in IMG/M
3300025922|Ga0207646_10164128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2005Open in IMG/M
3300025922|Ga0207646_10565718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium1021Open in IMG/M
3300025922|Ga0207646_10686719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi916Open in IMG/M
3300025922|Ga0207646_10798730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium840Open in IMG/M
3300025923|Ga0207681_10707609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi838Open in IMG/M
3300025925|Ga0207650_11054365Not Available692Open in IMG/M
3300025960|Ga0207651_10608580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium956Open in IMG/M
3300026075|Ga0207708_10517703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1002Open in IMG/M
3300026536|Ga0209058_1026173All Organisms → cellular organisms → Bacteria3700Open in IMG/M
3300027639|Ga0209387_1118300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium666Open in IMG/M
3300027650|Ga0256866_1177793Not Available575Open in IMG/M
3300028715|Ga0307313_10272111Not Available527Open in IMG/M
3300028791|Ga0307290_10035327All Organisms → cellular organisms → Bacteria1783Open in IMG/M
3300028799|Ga0307284_10431897Not Available538Open in IMG/M
3300028814|Ga0307302_10215490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium938Open in IMG/M
3300028824|Ga0307310_10418557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium667Open in IMG/M
3300028828|Ga0307312_10036602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2884Open in IMG/M
3300028828|Ga0307312_10108410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1728Open in IMG/M
3300028884|Ga0307308_10272765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium811Open in IMG/M
3300030006|Ga0299907_10581788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium874Open in IMG/M
3300030336|Ga0247826_10613703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium836Open in IMG/M
3300031548|Ga0307408_102073616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium548Open in IMG/M
3300031716|Ga0310813_10111822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2142Open in IMG/M
3300031965|Ga0326597_10173752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2551Open in IMG/M
3300032180|Ga0307471_100962644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1021Open in IMG/M
3300033475|Ga0310811_10312525All Organisms → cellular organisms → Bacteria → Terrabacteria group1798Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere19.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil17.19%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil7.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil7.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.25%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.91%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.12%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.12%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.12%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.34%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.34%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.56%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.56%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.56%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.78%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.78%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015084Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine)EnvironmentalOpen in IMG/M
3300015190Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10157683513300000956SoilMRQWACVVALLLGLAGNGYVASVRIRLPVAIERRLEPRVAEGRTLRTLDWWRA*
Ga0062593_10032281223300004114SoilMRQWACVFALLLGLAGSGYVSAARLRMPIPIERRLDSWGRAGRLTQTLDWWRA*
Ga0062593_10042907423300004114SoilMRQWARVVALLLGLAGNGYVATVRPRIPVAIERRLEPRSLEGRTLRTLDWWRA*
Ga0062593_10229098323300004114SoilAMRQWACVFALLLGLAGSGYTASARIRVPIPIERRLDSWKRDGGVVQTLDWWRA*
Ga0062589_10001198033300004156SoilVRQWACVFALLLGLVGSGYVAAARTRIPIPIERRLDSWAREGRLTQTLDWWRA*
Ga0062589_10185434323300004156SoilRVSPHTPAMRQWACVFALLLGLAGSGYTASARIRVPIPIERRLDSWKRDGGVVQTLDWWRA*
Ga0062590_10213205623300004157SoilMRQWACVFALLLGLAGSGYTASARIRVPIPIERRLDSWKRDGGVVQTLDWWRA*
Ga0062595_10014870223300004479SoilMRQWACVFALLLGLAGSGYAASARIRTPIPIERGLDSWARDGRLVRMLDWWRV*
Ga0062592_10010288523300004480SoilVRQWACVFALLLGLVGSGYVAAARIRIPIPIERRLDSWAREGRLTQTLDWWRA*
Ga0062591_10045114523300004643SoilVRQWACVFALLIGLVGSGYVAAARIRIPIPIERRLDSWAREGRLTQTLDWWRA*
Ga0062594_10005878223300005093SoilMRRGAFPHTPGMRQWAAVVALLLGLAGNGYVAAARLRLPIAIERPLETSTTDGRTKRTLDWWRA*
Ga0066683_1009415523300005172SoilMRQWACVFALLLGLAGNGYTASARVRLPIPIERRLESWGRDERLIQTLDWWRA*
Ga0066388_10467713823300005332Tropical Forest SoilMRQWALVFALLLGLAGSGYVAAARLRMPIPIERRLDSWPRDGRLRQTLDWWRA*
Ga0068869_10026537423300005334Miscanthus RhizosphereMRQWACVFALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRVTQTLDWWRA*
Ga0070680_100000054433300005336Corn RhizosphereVACVFALLLGLAGNGYVSAARIRVPIPIERRLDSWGRDRRLVQTVDWWRA*
Ga0070680_10180034023300005336Corn RhizosphereMRQWACVFALLLGLAGSGYAASARIRTPIPIERRLDSWAREGRLVRTLDWWRA*
Ga0068868_10060452423300005338Miscanthus RhizosphereMRQWACVFALLFGLVGSGYVAAARVRIPIPIERRLDSWAREGRVTQTLDWWRA*
Ga0070703_1015672713300005406Corn, Switchgrass And Miscanthus RhizosphereMRQWACVIALLLGLAGSGYTASARIRIPIPIERRLDSWARDGGLVQTLDWWRA*
Ga0070705_10003526923300005440Corn, Switchgrass And Miscanthus RhizosphereMRQWACVFALLLGLAGNGYTDSARIRLPIPIERRLESWGGEGRLNQTLDWWRA*
Ga0070705_10018300223300005440Corn, Switchgrass And Miscanthus RhizosphereMGHTRRMRQWACVFALLLGLAGSGYAASARIRTPIPIERRLDSWAREGRLVRTLDWWRA*
Ga0070700_10167540523300005441Corn, Switchgrass And Miscanthus RhizosphereALLLGLAGSGYTASARIRIPIPIERRLDSWAHDGGLVQTLDWWRA*
Ga0070694_10060124823300005444Corn, Switchgrass And Miscanthus RhizosphereMRQWACVFALLLGLAGSGYAASARIRIPIPIERRLDSWARDGRLTRTLDWWRA*
Ga0070694_10066433923300005444Corn, Switchgrass And Miscanthus RhizosphereMRQWACVVALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRLTQTLDWWRA*
Ga0070708_10000046233300005445Corn, Switchgrass And Miscanthus RhizosphereMRQWACVFALLLGLAGNGYTDSARIRLPIPIERRLESWAGEGRLIQTLDWWRA*
Ga0070662_10072920813300005457Corn RhizosphereMRQWACVFALLLGLVGSGYAAAARVRIPIPIERRLDSWAREGRVTQTLDWWRA*
Ga0070706_10008779213300005467Corn, Switchgrass And Miscanthus RhizosphereMRQWACVFALLLGLAGNGYTASARIRLPIPIERRLESWAGEGRLIQTLDWWRA*
Ga0070706_10076371713300005467Corn, Switchgrass And Miscanthus RhizosphereMRQWALVFALLLGLAGSGYVAAARLRMPIPIERRLDSWSRDGRLIQTLDWWRA*
Ga0070706_10145813823300005467Corn, Switchgrass And Miscanthus RhizosphereGLVGSGYVAAARVRIPIPIERRLDSWAREGRVTQTLDWWRA*
Ga0070707_10019358333300005468Corn, Switchgrass And Miscanthus RhizosphereMRQWACVFALLLGLAGNGYTASARLRLPIPIERRLESWGGEGRLNQTLDWWRA*
Ga0070707_10029213413300005468Corn, Switchgrass And Miscanthus RhizosphereHTRPMRQWACVVALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRLTQTLDWWRA*
Ga0070698_10042293823300005471Corn, Switchgrass And Miscanthus RhizosphereVRHLACVFALLLGLAGNGYVGAARVRIPIPIERRLDSWARDGRLVQTLDWWRA*
Ga0070698_10108596123300005471Corn, Switchgrass And Miscanthus RhizosphereMRQWACVVALLLGLVSSGYVAAARVRIPIPIERRLDSWAREGRLTQTLDWWRA*
Ga0070698_10161880423300005471Corn, Switchgrass And Miscanthus RhizosphereMRQWACVFALLLGLAGNGYTASARIRLPIPIERRLESWGGEGRLNQTLDWWRA*
Ga0066697_1023771623300005540SoilMRREAFPLARPEPKGDCWHTRGMRQWACVFALLLGLAGNGYTASARVRLPIPIERRLESWGRDERLIQTLDWWRA*
Ga0070695_10037765523300005545Corn, Switchgrass And Miscanthus RhizosphereMRQWACVIALLLGLAGSGYTASARIRIPIPIERRLDSWAHDGGLVQTLDWWRA*
Ga0068862_10128971623300005844Switchgrass RhizosphereMRRGAFPHTPGMRQWAAVVALLLGLAGNGYVAAARLRLPIAIERHLETSTTDGRTKRTLDWWRA*
Ga0075433_1000912673300006852Populus RhizosphereMRQWACVFALLLGLAGSGYTASTRIRIPIPIERRLDSWTRDGRLNRTLGWWRA*
Ga0075425_10024938523300006854Populus RhizosphereMRQWACVFALLLGLAGSGYAASARIRIPIPIERRLDSWTRDGRLNRTLDWWRA*
Ga0075434_10037361623300006871Populus RhizosphereMRQWARVFALLLGLAGSGYAASARIRIPIPIERRLDSWTRDGRLNRTLDWWRA*
Ga0079215_1019392623300006894Agricultural SoilMRQWACVVALLLGLAGNGYATTARTRLPIAIERRLGPLTREAGTLRTLDWWRA*
Ga0075426_1017450633300006903Populus RhizosphereMRQWALVFALLLGLAGSGYVAAARLRMPIPIERRLDSWSRDGRLIQTVDWWRA*
Ga0075424_10049461623300006904Populus RhizosphereMRQWALVFALLLGLAGSGYVAAARLRMPVPIERRLDSWPRDRRLVQTLDWWRA*
Ga0075424_10254893623300006904Populus RhizosphereMRQWACVFALLLGLAGNGYTASARIRLPIPIERRLESWRGEGRLIQTLDWWRA*
Ga0066710_10103183213300009012Grasslands SoilMRQWACVFALLLGLAGNGYAAAARVRLPIPIERRLESWSRDERLVQTLDWWRA
Ga0114129_1033781723300009147Populus RhizosphereMRQWARVVALLLGLAGNGYVATVRPRIPVAIERRLEPRVLEGRTRRTLDWWRA*
Ga0114129_1302791213300009147Populus RhizosphereMRQWACVFALLVGLAGNGYAVSARIRLPIPIERRLESWAGDGRLRQTLDWWRA*
Ga0105243_1111321923300009148Miscanthus RhizosphereMRQWACVFALLLGLAGSGYTASARIRIPIPIERRLDSWARDGGLVQTLDWWRA*
Ga0105242_1243753223300009176Miscanthus RhizosphereMRQWACVFALLLGLVGSGYVAGARVRIPIPIERRLDSWAREGRVTQTLDWWRA*
Ga0126307_1025319423300009789Serpentine SoilMRQWALVFALLLGLAGNGYQSTFRPRLPIPIERRLETFPNDGPTRRTLDWWRA*
Ga0126313_1029363223300009840Serpentine SoilMRQWACVAALLLGLAGNGYVATARLRFPIPIERRLDSFADTGRTRRTRDWWRA*
Ga0134088_1043699223300010304Grasslands SoilMRQWAVVFALLLGLAGNGYAASARIRLPIPIERRLESWAGDGRLNQTLDWWRA*
Ga0126377_1254431713300010362Tropical Forest SoilMRRVACVFALLLGLAGNGYVAAARVRIPIPIERRLDSWAREGRLVQTLDWWRA*
Ga0105239_1005684823300010375Corn RhizosphereMRQWACVIALLLGLAGSGYTASARIRIPIPIERRLDSWAREGGLVQTLDWWRA*
Ga0134126_1271940223300010396Terrestrial SoilMRQWACVFALLLGLTGSGYAAAARIRIPIPIERRIESWARDGRLVRTLDWWRA*
Ga0134127_1001587023300010399Terrestrial SoilMRQWACVFALLLGLAGSGYAAAARIRIPIPIERRIESWARDGRLVRTLDWWRA*
Ga0134127_1111385723300010399Terrestrial SoilMRQWACVVALLLGLAGNGYVASVRVRLPVAIERRLGPRTLEGSTLRTLDWWRA*
Ga0134127_1329824023300010399Terrestrial SoilMRQWACIVALLLGLAGNGYVATYRSRMPVAIERRIEPYLVHGRSGRTLDWWRA*
Ga0134127_1350415023300010399Terrestrial SoilPAMRQWACVFALLLGLAGSGYTASARIRVPIPIERRLDSWKRDGGVVQTLDWWRA*
Ga0134122_1078848013300010400Terrestrial SoilMRQWACVFALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRLTQTLDWWRA*
Ga0134122_1094983223300010400Terrestrial SoilVACVFALLLGLAGNGYVSAARIRVPIPIERRLDSWGRDRGLVQTVDWWRA*
Ga0134121_1231226423300010401Terrestrial SoilMRQWACVLALLLGLAGSGYTASARIRIPIPIERRLDSWSRDGRLVQTLDWWRA*
Ga0134123_1067685413300010403Terrestrial SoilAMRQWACVIALLLGLAGSGYTASARIRIPIPIERRLDSWARDGGLVQTLDWWRA*
Ga0134123_1104338923300010403Terrestrial SoilMRQLACVFALLLGLAGSGYTASARIRVPIPIERRLDSWKRDGGVVQTLDWWRA*
Ga0136623_1031889513300012045Polar Desert SandQWACVFALLLGLAGNGYATTTRIRLPIAIERRLAPRTLEGGTLRTLDWWRA*
Ga0136634_1045141023300012046Polar Desert SandMRQWACVVALLLGLAGNGYATTTRTRLPIAIERRLAPRTLEGGTLRTLDWWRA*
Ga0137364_1126470713300012198Vadose Zone SoilMRREAFPHTRAMRQWACVFALLLGLAGNGYTASARVRLPIPIERRLESFGREGRLVQTLDWWRA*
Ga0137376_1030315423300012208Vadose Zone SoilMRQWACVFALLLGLAGNGYTASARVRLPIPIERRVESFGREGRLVQTLDWWRA*
Ga0137360_1174763413300012361Vadose Zone SoilGRVCSHTRGMRQWACVLALLLGLAGSGYVASARIRIPIPIERRLDSWARDGRLIQTLDWWRA*
Ga0136630_115721223300012529Polar Desert SandMRQWACVFALLLGLAGNGYATTTRIRLPIAIERRLAPRTLEGGTLRTLDWWRA*
Ga0157216_1019856223300012668Glacier Forefield SoilMRQWAAVVALLLGLAGNGYVAAARLRLPIAIERLLEPTTTDGRTKRTLDWWRA*
Ga0157216_1026889423300012668Glacier Forefield SoilMRQWACVIALMLGLLGNGYVAAARPRLPIAIEQPLEPAMRGTRTRRTLDWWRA*
Ga0137397_1070146613300012685Vadose Zone SoilVRQWACVIALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRLTQTLDWWRA*
Ga0137394_1095128123300012922Vadose Zone SoilMRQWACVFALLLGLAGNGYTASARIRLPIPIERRFESWGHDERLVRTPDWWRA*
Ga0164305_1038301613300012989SoilMRQWACVFALLLGLAGSGYVSAARLRMPIPIERRLDSWERAGRLTQTLDWWRA*
Ga0157371_1117059213300013102Corn RhizosphereMRQWACVIALLLGLAGSGYTASARIRVPIPIERRLDSWAREGRVTQTLDWWRA*
Ga0157378_1008615443300013297Miscanthus RhizosphereMRQWACVIALLLGLAGSGYTASARIRIPIPIERRLDSWSRDRRLVQTLDWWRA*
Ga0182008_1086715813300014497RhizosphereMRQWACVFALLLGLVGSGYTASARVRIPIPIERRLDSWRRDGGLVQTVDWWRA*
Ga0167654_100517423300015084Glacier Forefield SoilMRQWACVVALLLGLAGNGYVATMLTRLPIAIERRFEPTTTGRRTSRTLDWWRA*
Ga0167651_105874223300015190Glacier Forefield SoilWACVVALLLGFAGDGYVWSARARLPIAIVRQIDIPRGRRTGQTPDWWRR*
Ga0132258_1023264633300015371Arabidopsis RhizosphereMRQWACVLALLLGLAGSGYTASARIRIPIPIERRLDSWSRGGGLVQTLDWWRA*
Ga0132258_1045065223300015371Arabidopsis RhizosphereMRQWACVLALLLGLAGSGYTASARIRIPIPIERRLDSWARDGGLVQTLDWWRA*
Ga0132258_1095023013300015371Arabidopsis RhizosphereMRQWACVVALLLGLAGNGYVATSRVRLPIAIERRLDPRPTGRRTVQTLDWWRA*
Ga0132258_1215642123300015371Arabidopsis RhizosphereMRQWACVFALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRMTQTLDWWRA*
Ga0132256_10203197223300015372Arabidopsis RhizosphereMRQWACVLALLLGLAGSRYTASARIRIPIPIERRLDSWARDGGLVQTLDWWRA*
Ga0183260_1001716323300017787Polar Desert SandMRQWACVFALLLGLAGNGYATATRTRLPIAIERRLVPRTLERGTLRTLDWWRA
Ga0184618_1028400213300018071Groundwater SedimentMRQWACVFALLLGLAGNGYAASARIRLPIPIERRLESWGRDERLVRTLDWWRA
Ga0184609_1051897923300018076Groundwater SedimentMRQWACVFALLLGLAGNGYAASARIRMPIPIERRLESWADEERHGHGRQRRLVQTLDWWR
Ga0190265_1015433923300018422SoilMRQWACVVALLFGLAGNGYVASVRIRLPVAIERRLEPRMYEGGTLRTLDWWRA
Ga0190275_1004633423300018432SoilMRQWACGVALLLGLAGNGYVASVRIRLPVAIERRLEPRMFEGGTLRTLDWWRA
Ga0066667_1027994423300018433Grasslands SoilMRQWACVFALLLGLAGNGYTASARVRLPIPIERRLESWGRDERLIQTLDWWRA
Ga0190268_1032000523300018466SoilMRQWACVVALLLGLAGNGYVASVRIRLPVAIERRLDPRLIEGRTLRTLDWWRA
Ga0190268_1056140513300018466SoilMRQWACVVALLLGLAGNGYVFSVRSRLPIAIERPIEPAMSGARTRRTLDWWRA
Ga0190274_1041517823300018476SoilMRQWARVVALLLGLAGNGYVASVRIRLPVAIERRLEPRVAEGRTLRTLDWWRA
Ga0190264_1059742723300019377SoilMRQWACVVALLLGLVGNGYVFSARSRLPIAIERPIEPAMGGVRTRRTLDWWRA
Ga0190264_1076132413300019377SoilMRQWACVVALLLGLAGNGYVASVRIRLPVAIERRLEPRLLEGGTLRTLDWWRA
Ga0210382_1042641413300021080Groundwater SedimentMRQWACVFALLLGLAGNGYAASARIRLPIPIERRLESWGREERLVRTLDWWRA
Ga0193719_1017793713300021344SoilMRQWACVFALLLGLAGNGYTASARVRLPIPIERRLESWGREGRLVQTLDWWRA
Ga0207653_1017786713300025885Corn, Switchgrass And Miscanthus RhizosphereMRQWACVIALLLGLAGSGYTASARIRIPIPIERRLDSWARDGGLVQTLDWWRA
Ga0207684_1004269323300025910Corn, Switchgrass And Miscanthus RhizosphereMRQWACVFALLLGLAGNGYTASARIRLPIPIERRLESWAGEGRLIQTLDWWRA
Ga0207684_1024748623300025910Corn, Switchgrass And Miscanthus RhizosphereMRQWALVFALLLGLAGSGYVAAARLRMPIPIERRLDSWSRDGRLIQTLDWWRA
Ga0207684_1127136013300025910Corn, Switchgrass And Miscanthus RhizosphereGLVGSGYVAAARVRIPIPIERRLDSWAREGRVTQTLDWWRA
Ga0207660_100000012763300025917Corn RhizosphereVACVFALLLGLAGNGYVSAARIRVPIPIERRLDSWGRDRRLVQTVDWWRA
Ga0207646_1016412823300025922Corn, Switchgrass And Miscanthus RhizosphereMRQWACVFALLLGLAGNGYTASARLRLPIPIERRLESWGGEGRLNQTLDWWRA
Ga0207646_1056571823300025922Corn, Switchgrass And Miscanthus RhizosphereMRQWALVFALLLGLAGSGYVAAARLRMPIPIERRLDPWSRDGRLIQTLDWWRA
Ga0207646_1068671923300025922Corn, Switchgrass And Miscanthus RhizosphereMRQWACVFALLLGLAGNGYTASARIRLPIPIERRLESWGGEGRLNQTLDWWRA
Ga0207646_1079873013300025922Corn, Switchgrass And Miscanthus RhizosphereVVALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRLTQTLDWWRA
Ga0207681_1070760923300025923Switchgrass RhizosphereVRQWACVFALLIGLVGSGYVAAARIRIPIPIERRLDSWAREGRLTQTLDWWRA
Ga0207650_1105436523300025925Switchgrass RhizosphereMRQWACVFALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRVTQTLDWWRR
Ga0207651_1060858023300025960Switchgrass RhizospherePMRQWACVFALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRVTQTLDWWRA
Ga0207708_1051770313300026075Corn, Switchgrass And Miscanthus RhizosphereMRQWACVIALLLGLAGSGYTASARIRIPIPIERRLDSWAHDGGLVQTLD
Ga0209058_102617333300026536SoilMRREAFPLARPEPKGDCWHTRGMRQWACVFALLLGLAGNGYTASARVRLPIPIERRLESWGRDERLIQTLDWWRA
Ga0209387_111830023300027639Agricultural SoilQWACVVALLLGLAGNGYATTARTRLPIAIERRLGPLTREAGTLRTLDWWRA
Ga0256866_117779313300027650SoilMRQWACVVALLLGLAGNGYVASVRIRLPVAIERRLEPRMFEGGTLRTLDWWRA
Ga0307313_1027211123300028715SoilMRQWACVFALLLGLAGNGYTASARVRVPIPIERRLESWGREGRLVQTLDWWRA
Ga0307290_1003532723300028791SoilMRQWACVFALLLGLAGNGYAASARVRLPIPIERRLESWGRDERLFRTLDWWRA
Ga0307284_1043189723300028799SoilALGPSAGLAHTRDMRQWACVFALLLGLAGSGYVSAARVRTPIPIERRLDSWGREGRLTQTLDWWRA
Ga0307302_1021549023300028814SoilMRQWACVVALLLGLAGNGYAATVRIRLPIAIERRLVADRDADDDDRDVLTEPGGLRRTLDWWRA
Ga0307310_1041855713300028824SoilPSAGLAHTRDMRQWACVFALLLGLVGSGYVSAARLRTPIPIERRLDSWGREGRLTQTLDWWRA
Ga0307312_1003660213300028828SoilMRQWACVFALLLGLAGNGYAAAARVRIPIPIERRLESWSRDERLVQTLDWWRA
Ga0307312_1010841013300028828SoilLPHTRGMRQWACVFALLLGLAGNGYTASARVRVPIPIERRLESWGREGRLVQTLDWWRA
Ga0307308_1027276513300028884SoilGFLSYLPHTRGMRQWACVFALLLGLAGNGYTASARVRVPIPIERRLESWGREGRLVQTLDWWRA
Ga0299907_1058178823300030006SoilMRQWACVVALLLGLAGNGYVASVRIRLPVAIERRLEPRMFDGGTLRTLDWWRA
Ga0247826_1061370323300030336SoilHTRPMRQWARVVALLLGLAGNGYVATVRPRIPVAIERRLEPRTLEGRTLRTLDWWRA
Ga0307408_10207361623300031548RhizosphereMRQWACVVALLLGLAGNGYVATARTRLPIAIERRLDSWTERGRTTRTLDWWRA
Ga0310813_1011182223300031716SoilMRQWACVFALLLGLAGSGYVSAARLRMPIPIERRLDSWGRAGRLTQTLDWWRA
Ga0326597_1017375223300031965SoilMRQWACVVALLLGLAGNGYAATVRIRLPIAIERRLDLIVERERLVRTLDWWRA
Ga0307471_10096264423300032180Hardwood Forest SoilMRQWACVFALLLGLVGSGYVAAARVRIPIPIERRLDSWAREGRLTQTLDWWRA
Ga0310811_1031252513300033475SoilGPSAGLAHTRDMRQWACVFALLLGLAGSGYVSAARLRMPIPIERRLDSWGRAGRLTQTLDWWRA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.