Basic Information | |
---|---|
Family ID | F064705 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 46 residues |
Representative Sequence | MSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY |
Number of Associated Samples | 121 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 81.25 % |
% of genes near scaffold ends (potentially truncated) | 41.41 % |
% of genes from short scaffolds (< 2000 bps) | 92.97 % |
Associated GOLD sequencing projects | 117 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.656 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.062 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.844 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.781 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.17% β-sheet: 0.00% Coil/Unstructured: 63.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF00440 | TetR_N | 59.38 |
PF04055 | Radical_SAM | 20.31 |
PF00106 | adh_short | 1.56 |
PF07336 | ABATE | 1.56 |
PF13561 | adh_short_C2 | 0.78 |
PF01694 | Rhomboid | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG5516 | Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding | General function prediction only [R] | 1.56 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.66 % |
Unclassified | root | N/A | 2.34 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig1213254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 603 | Open in IMG/M |
2166559006|FI_contig04002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EAN1pec | 1630 | Open in IMG/M |
2170459016|G1P06HT01DFAZB | Not Available | 607 | Open in IMG/M |
2170459017|G14TP7Y01BEO4K | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 583 | Open in IMG/M |
2189573002|GZIGXIF02I6SA9 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
2189573002|GZIGXIF02JZFP5 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
2199352025|deepsgr__Contig_162845 | Not Available | 681 | Open in IMG/M |
3300003659|JGI25404J52841_10014789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EAN1pec | 1694 | Open in IMG/M |
3300004114|Ga0062593_101755863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
3300004803|Ga0058862_12677421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 538 | Open in IMG/M |
3300005103|Ga0066813_1016934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
3300005158|Ga0066816_1027701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 507 | Open in IMG/M |
3300005162|Ga0066814_10022952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
3300005169|Ga0066810_10017405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1155 | Open in IMG/M |
3300005175|Ga0066673_10282321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
3300005175|Ga0066673_10586178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
3300005177|Ga0066690_10335836 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300005186|Ga0066676_10357778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
3300005327|Ga0070658_10174744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1806 | Open in IMG/M |
3300005330|Ga0070690_101669233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300005332|Ga0066388_100574852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1753 | Open in IMG/M |
3300005336|Ga0070680_100834345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 794 | Open in IMG/M |
3300005337|Ga0070682_100192007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1434 | Open in IMG/M |
3300005344|Ga0070661_100081282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2392 | Open in IMG/M |
3300005356|Ga0070674_101443585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 617 | Open in IMG/M |
3300005367|Ga0070667_100714319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
3300005434|Ga0070709_10626736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 830 | Open in IMG/M |
3300005445|Ga0070708_100227357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1750 | Open in IMG/M |
3300005451|Ga0066681_10923626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300005558|Ga0066698_10878685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300005566|Ga0066693_10055235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1338 | Open in IMG/M |
3300005577|Ga0068857_100676221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 979 | Open in IMG/M |
3300005578|Ga0068854_102224159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300005617|Ga0068859_100270217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1792 | Open in IMG/M |
3300006572|Ga0074051_11597219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
3300006573|Ga0074055_11228481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 817 | Open in IMG/M |
3300006575|Ga0074053_10012967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 798 | Open in IMG/M |
3300006579|Ga0074054_12025044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
3300006581|Ga0074048_13170598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
3300006755|Ga0079222_12396796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300006791|Ga0066653_10265138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 874 | Open in IMG/M |
3300006804|Ga0079221_11002005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
3300006871|Ga0075434_100538559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1187 | Open in IMG/M |
3300006881|Ga0068865_100468468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
3300009162|Ga0075423_10770565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
3300010046|Ga0126384_10276949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1369 | Open in IMG/M |
3300010152|Ga0126318_10560713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
3300010152|Ga0126318_10949918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1327 | Open in IMG/M |
3300010323|Ga0134086_10502271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
3300010326|Ga0134065_10075369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
3300010335|Ga0134063_10744691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
3300010375|Ga0105239_10922177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1003 | Open in IMG/M |
3300010376|Ga0126381_104931711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300010396|Ga0134126_11238346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
3300010396|Ga0134126_11391754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
3300010397|Ga0134124_11945012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
3300010401|Ga0134121_12609858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
3300010403|Ga0134123_10245530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1554 | Open in IMG/M |
3300012200|Ga0137382_10286841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1146 | Open in IMG/M |
3300012201|Ga0137365_10027065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 4421 | Open in IMG/M |
3300012206|Ga0137380_10316868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1395 | Open in IMG/M |
3300012285|Ga0137370_10698591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
3300012353|Ga0137367_10049682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3161 | Open in IMG/M |
3300012355|Ga0137369_10940192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300012358|Ga0137368_10390250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
3300012360|Ga0137375_10314858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1408 | Open in IMG/M |
3300012380|Ga0134047_1145024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 522 | Open in IMG/M |
3300012488|Ga0157343_1002143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1051 | Open in IMG/M |
3300012507|Ga0157342_1002403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1517 | Open in IMG/M |
3300012532|Ga0137373_10043630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 4228 | Open in IMG/M |
3300012915|Ga0157302_10328248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
3300012976|Ga0134076_10538636 | Not Available | 538 | Open in IMG/M |
3300012977|Ga0134087_10182706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis saalfeldensis | 930 | Open in IMG/M |
3300012986|Ga0164304_10701738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 769 | Open in IMG/M |
3300012987|Ga0164307_10574540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
3300014326|Ga0157380_10039931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3652 | Open in IMG/M |
3300015200|Ga0173480_11104754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 529 | Open in IMG/M |
3300015264|Ga0137403_10098601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2931 | Open in IMG/M |
3300015371|Ga0132258_11318614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1824 | Open in IMG/M |
3300015371|Ga0132258_11319642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1823 | Open in IMG/M |
3300015373|Ga0132257_101089907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1008 | Open in IMG/M |
3300018431|Ga0066655_10147042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1394 | Open in IMG/M |
3300019361|Ga0173482_10129300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300019883|Ga0193725_1131978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
3300019885|Ga0193747_1024287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1499 | Open in IMG/M |
3300020001|Ga0193731_1168307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 527 | Open in IMG/M |
3300020062|Ga0193724_1069230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 738 | Open in IMG/M |
3300020070|Ga0206356_10416711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1287 | Open in IMG/M |
3300020080|Ga0206350_11551260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 620 | Open in IMG/M |
3300020082|Ga0206353_11468737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
3300020140|Ga0179590_1165821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 605 | Open in IMG/M |
3300020583|Ga0210401_10446119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1157 | Open in IMG/M |
3300021403|Ga0210397_10312649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1156 | Open in IMG/M |
3300021445|Ga0182009_10299124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
3300021475|Ga0210392_10541461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EAN1pec | 860 | Open in IMG/M |
3300022504|Ga0242642_1039797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 706 | Open in IMG/M |
3300024178|Ga0247694_1009472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1185 | Open in IMG/M |
3300024232|Ga0247664_1114973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300024249|Ga0247676_1012403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1313 | Open in IMG/M |
3300025885|Ga0207653_10140853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 882 | Open in IMG/M |
3300025904|Ga0207647_10130556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1477 | Open in IMG/M |
3300025906|Ga0207699_10098851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1847 | Open in IMG/M |
3300025907|Ga0207645_10150690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1518 | Open in IMG/M |
3300025908|Ga0207643_10124577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1529 | Open in IMG/M |
3300025916|Ga0207663_11143392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 626 | Open in IMG/M |
3300025920|Ga0207649_10293272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1187 | Open in IMG/M |
3300025932|Ga0207690_10299291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1258 | Open in IMG/M |
3300025935|Ga0207709_10701733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 810 | Open in IMG/M |
3300026088|Ga0207641_10330945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1447 | Open in IMG/M |
3300027058|Ga0209111_1010741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
3300027725|Ga0209178_1079280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1078 | Open in IMG/M |
3300027725|Ga0209178_1119933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
3300027787|Ga0209074_10057865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1206 | Open in IMG/M |
3300027787|Ga0209074_10319993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 627 | Open in IMG/M |
3300028711|Ga0307293_10168279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
3300028715|Ga0307313_10064392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1089 | Open in IMG/M |
3300028768|Ga0307280_10011819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2388 | Open in IMG/M |
3300028872|Ga0307314_10209300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
3300031170|Ga0307498_10059100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1066 | Open in IMG/M |
3300031184|Ga0307499_10176709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300031198|Ga0307500_10109792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
3300031226|Ga0307497_10092349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 1163 | Open in IMG/M |
3300031716|Ga0310813_10681828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 916 | Open in IMG/M |
3300031996|Ga0308176_10107542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2465 | Open in IMG/M |
3300032074|Ga0308173_10850499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 842 | Open in IMG/M |
3300032205|Ga0307472_101114516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 748 | Open in IMG/M |
3300032770|Ga0335085_10088250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4047 | Open in IMG/M |
3300032898|Ga0335072_11212761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.59% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.47% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.69% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.91% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.91% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.12% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.34% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.34% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.34% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.56% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.56% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.56% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.56% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.78% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.78% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.78% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010152 | Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012380 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Host-Associated | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027058 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_02532430 | 2124908045 | Soil | MSERVAIADVIEVPAAEPGLAQGELTELAEAELLVEEVSIDGMCG |
FI_00073200 | 2166559006 | Grass Soil | MSERVATADVIEVPAAEPELAQSELNELAEAELLVEEVSIDGMCGVY |
2ZMR_02214230 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | VHERTRRDRDVIEAPVEEPELAEAELLVEEVSIDGMCGVY |
4ZMR_05039830 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MSERAATVDVIEVPVEEPELAEAELLVEEVSIDGMCGVY |
FE1_00294720 | 2189573002 | Grass Soil | TADVIEVPAAEPELAQSELNELAQAELLVEEVSIDGMCGVY |
FE1_07192580 | 2189573002 | Grass Soil | MSERVAIADVIEVPAAEPGLAQSELTETGLAEAELLVEEVSIDGMCGVY |
deepsgr_02713750 | 2199352025 | Soil | MSERVAIADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGMCGVY |
JGI25404J52841_100147893 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MSERVATADVIEVPAAEPGLAQSELTGLTELTEAELLVEEVSIDGMCGVY* |
Ga0062593_1017558632 | 3300004114 | Soil | MSERVATADVIEVPAAEPGLAQGELSELAEAELLVEEVSIDGMCG |
Ga0058862_126774212 | 3300004803 | Host-Associated | MSERVATADVIEVPAAQPGLAQSELTDLAEAELLVEEVSIDGMCGVY* |
Ga0066813_10169341 | 3300005103 | Soil | MSERVATADVIEVPAAEPGLAQSELAETELAEAELAEAELLVEEVSIDG |
Ga0066816_10277011 | 3300005158 | Soil | MSERVATADVIEVPAAEPGLAQSDPTDLAEAELLVEEVSIDGMCGVY* |
Ga0066814_100229522 | 3300005162 | Soil | MSERVATADVIEVPAAEPGLAQSELAETELAETELAEAELAEAELLVEEVSIDGMCGVY* |
Ga0066810_100174052 | 3300005169 | Soil | MSERVATADVIEVPAAEPGLAQSEATETELAGTELAEAELLVEEVSIDGMCGVY* |
Ga0066673_102823214 | 3300005175 | Soil | ADVIEVPAAEPELAQSELTELAEAELLVEEVSIDGMCGVY* |
Ga0066673_105861782 | 3300005175 | Soil | MSERVATADVIEVPAAEPELVQGELTELAEAELLVEEVSIDG |
Ga0066690_103358362 | 3300005177 | Soil | MSERVATADVIEVPAAEPGLAQSELTETELTETELTETELTETELTEAELLVEEVSIDG |
Ga0066676_103577781 | 3300005186 | Soil | MSERVATADVIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMC |
Ga0070658_101747443 | 3300005327 | Corn Rhizosphere | MSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY* |
Ga0070690_1016692332 | 3300005330 | Switchgrass Rhizosphere | MSERVATADVIEVPGAEPGMTQGELTDLAEAELLVEEVSIDGMCGVY* |
Ga0066388_1005748522 | 3300005332 | Tropical Forest Soil | MSERVATADVIEVPAAEPELAQGELTELAEAELLVEEVSIDGMCGVY* |
Ga0070680_1008343452 | 3300005336 | Corn Rhizosphere | MSERVAIADVIEVPAPEPGPAQSKLTETELAEAELLVEEV |
Ga0070682_1001920073 | 3300005337 | Corn Rhizosphere | MSERVATADVIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY* |
Ga0070661_1000812822 | 3300005344 | Corn Rhizosphere | MSERVAIADVIEVPAAEPGPAQSDPTDLAEAELLVEEVSIDGMCGVY* |
Ga0070674_1014435852 | 3300005356 | Miscanthus Rhizosphere | MSERVATADVIEVPAAEPGLAQSDLTDLAEAELLVEEVSIDGMCGVY* |
Ga0070667_1007143191 | 3300005367 | Switchgrass Rhizosphere | MSERVAIADVIEVPAPEPGPAQSELTETELAEAELLVEEVSI |
Ga0070709_106267362 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERAATVDVIEVPVEEPELAEAELLVEEVSIDGMCGVY* |
Ga0070708_1002273572 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERVATADVIEVPAAEPGLARSELTETELAEAELLVEEVSIDGMCGVY* |
Ga0066681_109236262 | 3300005451 | Soil | MSERVATADVIEVPAAEPELTRSELTQTELAEAELLVEEVSIDGMCGVY* |
Ga0066698_108786852 | 3300005558 | Soil | MSERVATADVIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMCGVY* |
Ga0066693_100552352 | 3300005566 | Soil | MSERVAIADVIEVPPAEPELTQGEPAELAEAELLVEEVSIDGMCGVY* |
Ga0068857_1006762213 | 3300005577 | Corn Rhizosphere | MSERAATVDVIEAPEEEPELAEAELLVEEVSIDGMCGVY* |
Ga0068854_1022241592 | 3300005578 | Corn Rhizosphere | MSERVATADVIEVPAAEPGLAQSELTDLAEAELLVEE |
Ga0068859_1002702173 | 3300005617 | Switchgrass Rhizosphere | MSERVATADVIEVPAAEPGLTQGELTELAEAELLVEEVSIDGMCGVY* |
Ga0074051_115972191 | 3300006572 | Soil | MSERVATADVIEVPAAEPGLAQSELTETELAEAELLVEE |
Ga0074055_112284812 | 3300006573 | Soil | MSERVATADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGMCGVY* |
Ga0074053_100129672 | 3300006575 | Soil | MSERVATADVIEVPAAEPGLAQSELPGTELAEAELLVEEVSIDGMCGVY* |
Ga0074054_120250442 | 3300006579 | Soil | MSERVATADVIEVPAAEPGLAQSELTETELAEAELAEAELLVEEVSIDGMCGVY* |
Ga0074048_131705981 | 3300006581 | Soil | MSERVATADVIEVPAAEPGLAQSELTETELAEAELL |
Ga0079222_123967961 | 3300006755 | Agricultural Soil | EESVMSERAATVDVIEVPVEEPELAEAELLVEEVSIDGMCGVY* |
Ga0066653_102651382 | 3300006791 | Soil | MSERVAIADVIEVPAAEPELAQSELTELAEAELLVEEVSIDGMCGVY* |
Ga0079221_110020052 | 3300006804 | Agricultural Soil | MSERVATADVIEVPAAEPGLAQGELTELAEAELLVEEVSIDGMCGVY* |
Ga0075434_1005385592 | 3300006871 | Populus Rhizosphere | MSERVATADVIEVPAAEPGLTQGELAELAEAELLVEEVSIDGMCGVY* |
Ga0068865_1004684681 | 3300006881 | Miscanthus Rhizosphere | MSERVATADVIEVPAAEPGLAQSELTDLAEAELLVEEVSI |
Ga0075423_107705652 | 3300009162 | Populus Rhizosphere | MSERVATADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGM |
Ga0126384_102769493 | 3300010046 | Tropical Forest Soil | MSERVATADVIEVPAAEPELAQSELTELAEAELLVEEVSIDGMCGVY* |
Ga0126318_105607133 | 3300010152 | Soil | EPGLAQGELAGTELAGTELAEAELLVEEVSIDGMCGVY* |
Ga0126318_109499181 | 3300010152 | Soil | IEVPAAGPELTQGELAELAEAELLVEEVSIDGMCGVY* |
Ga0134086_105022713 | 3300010323 | Grasslands Soil | VIEVPAAEPELAQSELTDSELAEAELLVEEVSIDGMCGVY* |
Ga0134065_100753692 | 3300010326 | Grasslands Soil | MSERVAIADVIEVPAAEPELAQSELTELAEAELLVE |
Ga0134063_107446911 | 3300010335 | Grasslands Soil | VIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMCGVY* |
Ga0105239_109221773 | 3300010375 | Corn Rhizosphere | DVIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY* |
Ga0126381_1049317113 | 3300010376 | Tropical Forest Soil | TVDVIEAPALEGAVEEPELAEAELLVEEVSIDGMCGVY* |
Ga0134126_112383462 | 3300010396 | Terrestrial Soil | MSERAATVDVIEAPAEEPELAEAELLVEEVSIDGMCGVY* |
Ga0134126_113917543 | 3300010396 | Terrestrial Soil | MSERVATADVIEVPAAEPELAQGELAELAEAELLVEEVSIDGMCGVY* |
Ga0134124_119450122 | 3300010397 | Terrestrial Soil | MSERVATADVIEVPGAEPGLAQGELTDLAEAELLVEEVSIDGMCGVY* |
Ga0134121_126098583 | 3300010401 | Terrestrial Soil | CAARESAMSERVATADIIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY* |
Ga0134123_102455302 | 3300010403 | Terrestrial Soil | MSERVATADVIEVPTAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY* |
Ga0137382_102868413 | 3300012200 | Vadose Zone Soil | MSERVATADVIEVPAADPELARSELTQTELAEAGLLVEEVSIDGMCGVY* |
Ga0137365_100270656 | 3300012201 | Vadose Zone Soil | MSERVAIADVIEVPAAEPGLAQSELTETELAETELAEAELLVEEVSIDGMCGVY* |
Ga0137380_103168683 | 3300012206 | Vadose Zone Soil | MSERVAIADVIEVPVAEPGLAQSELTETELAETELAEAELLVEEVSIDGMCGVY* |
Ga0137370_106985912 | 3300012285 | Vadose Zone Soil | MSERVAIAEVIEVPAAEPELTQGEPAELAEAELLVEEVSIDGMCGVY* |
Ga0137367_100496823 | 3300012353 | Vadose Zone Soil | MSERVAIADVIEVPAAEPGLAQSKLTETELAETELAETELAEAELLVEEVSIDGMCGVY* |
Ga0137369_109401921 | 3300012355 | Vadose Zone Soil | MSERVATADVIEVPAAEPGLAQSKLTETELAETELAETELAEAELLVEEVSIDGMCG |
Ga0137368_103902501 | 3300012358 | Vadose Zone Soil | MSERVAIADVIEVPAAEPELAQSGLTDSELAEAELLVEEVSIDGMCGVY* |
Ga0137375_103148582 | 3300012360 | Vadose Zone Soil | MSERVAIADVIEVPAAEPGLAQSELTETELAETELAETELAEAELLVEEVSIDGMCGVY* |
Ga0134047_11450241 | 3300012380 | Grasslands Soil | ATADVIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMCGVY* |
Ga0157343_10021433 | 3300012488 | Arabidopsis Rhizosphere | MSERVATADVIEVPAAEPEMTQGELTDLAEAELLVEEVSIDGMCGVY* |
Ga0157342_10024033 | 3300012507 | Arabidopsis Rhizosphere | MSERVATADVIEVPAAEPGLAQSELSELAEAELLVEEVSIDGMCGVY* |
Ga0137373_100436306 | 3300012532 | Vadose Zone Soil | MSERVAIADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGMCGVY* |
Ga0157302_103282482 | 3300012915 | Soil | MSERVATADVIEVPAAEPGVAQGELTELAEAELLVEEVSIDGMCGVY* |
Ga0134076_105386361 | 3300012976 | Grasslands Soil | MSERVAIADVIEVPAAEPELAQSELTDSELAEAELLVEEVSIDGMC |
Ga0134087_101827063 | 3300012977 | Grasslands Soil | ESVMSERVATADVIEVPAAEPGLAQSELTETELTEAELLVEEVSIDGMCGVY* |
Ga0164304_107017382 | 3300012986 | Soil | MSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSIDG |
Ga0164307_105745402 | 3300012987 | Soil | MSARAATVDVIEAPVEEPELAEAELLVEEVSIDGMCGVY* |
Ga0157380_100399315 | 3300014326 | Switchgrass Rhizosphere | MSERVATADVIEVPASEPGLAQSDPTDLAEAELLVEEVSIDGMCGVY* |
Ga0173480_111047541 | 3300015200 | Soil | MSERVATADVIEVPGAEPGMTQGELTDLAEAEVLVEEVSIDGMCGVY* |
Ga0137403_100986011 | 3300015264 | Vadose Zone Soil | RVATADVIEVPAAEPELTRSELTQTELAEAELLVEEVSIDGMCGVY* |
Ga0132258_113186142 | 3300015371 | Arabidopsis Rhizosphere | MSERVAIADVIEVPAAEPELAPGELDELAEAELLVEEVSIDGMCGVY* |
Ga0132258_113196421 | 3300015371 | Arabidopsis Rhizosphere | MSERAATVDVIEIPAEEPELADAELLVEEVSIDGMCGVY* |
Ga0132257_1010899073 | 3300015373 | Arabidopsis Rhizosphere | VHVCAARESAMSERVAIADVIEVPAAEPELAPGELDELAEAELLVEEVSIDGMCGVY* |
Ga0066655_101470422 | 3300018431 | Grasslands Soil | MSERVATADVIEVPAAEPGLAQSELNELAEAELLVEEVSIDGMCGVY |
Ga0173482_101293002 | 3300019361 | Soil | MSERVATADVIEVPAAEPGLAQGELSELAEAELLVEEVSIDGMCGVY |
Ga0193725_11319782 | 3300019883 | Soil | MSERVAIADVIEVPAPEPGLAQSELAETELAEAELLVEEVSIDGMCGVY |
Ga0193747_10242872 | 3300019885 | Soil | MSERVATAVITEVPAAEPELAQGRLGENELAEAELLVEEV |
Ga0193731_11683071 | 3300020001 | Soil | MSERVAIADVIEVPAPEPGLAQSELTETELAEAELLVEEVSIDGMCGVY |
Ga0193724_10692302 | 3300020062 | Soil | MSERVATADVIEVPAAEPELAQSGLNELAEAELLVEEVSIDGMCGVY |
Ga0206356_104167113 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERVATADVIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY |
Ga0206350_115512601 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | VTKSYRRWARVGSEESVMSERAAIVDVIEAPVEEPELAEAELLVEEVSIDGMCGVY |
Ga0206353_114687372 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERVATADVIEVPAAEPGLAQSDPTDLAEAELLVEEVSI |
Ga0179590_11658211 | 3300020140 | Vadose Zone Soil | MSERVATADVIEVPVAEPELTRSELTETGLAEAELLVEEVSIDGMCGVY |
Ga0210401_104461192 | 3300020583 | Soil | MSERVAIAEITENQAPAVEPELAQDELAQDELAEAELLVEEVSIDGMCGVY |
Ga0210397_103126492 | 3300021403 | Soil | MSERVATADVIEVPAAEPGLAPSDLTELAEAELLVEEVSIDGMCGVY |
Ga0182009_102991241 | 3300021445 | Soil | MSERVATADVIEVPAAEPGLAQGELTELAEAELLVEEVSIDGMCGVY |
Ga0210392_105414613 | 3300021475 | Soil | MSERVATADVIEVPAAEPGLAQSDLTELAEAELLVEEVSIDGMCGVY |
Ga0242642_10397973 | 3300022504 | Soil | MSERVAIAEITENQAPAVEPELAQDELAQDELAEAELLVEEVSIDGMCGLY |
Ga0247694_10094722 | 3300024178 | Soil | MSERVATADVIEVPAAEPGMTQGELTDLAEAELLVEEVSIDGMCGVY |
Ga0247664_11149731 | 3300024232 | Soil | MSERVATADVIEVPAAEPELTQGELTELAEAELLV |
Ga0247676_10124031 | 3300024249 | Soil | MSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSI |
Ga0207653_101408533 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | RESAMSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY |
Ga0207647_101305563 | 3300025904 | Corn Rhizosphere | MSERVATADVIEVPAAEPGLAQSDPTDLAEAELLVEEVSIDGMCGVY |
Ga0207699_100988513 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERVATADIIEVPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY |
Ga0207645_101506901 | 3300025907 | Miscanthus Rhizosphere | MSERVATADVIEVPAAEPGLAQSDPTDLAEAELLVEEVSIDGMCG |
Ga0207643_101245771 | 3300025908 | Miscanthus Rhizosphere | IIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY |
Ga0207663_111433922 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSERVATADVIEVPAAEPELAQGELAELAEAELLVEEVS |
Ga0207649_102932723 | 3300025920 | Corn Rhizosphere | MSERVATADVIEVPAAEPGPAQSDPTDLAEAELLVEEVSIDGMCGVY |
Ga0207690_102992913 | 3300025932 | Corn Rhizosphere | AMSERVATADIIEVPAAEPGLAQSELTDLAEAELLVEEVSIDGMCGVY |
Ga0207709_107017333 | 3300025935 | Miscanthus Rhizosphere | VPAAEPGLAQSELTELAEAELLVEEVSIDGMCGVY |
Ga0207641_103309453 | 3300026088 | Switchgrass Rhizosphere | MSERAATVDVIEVPVEEPELAEAELLVEEVSIEAMCGVYGGTDAGHAGRVRTLRP |
Ga0209111_10107412 | 3300027058 | Forest Soil | MSERVAIAEITENQAPAVEPELAQDELAEAELLVEEVSIDGMCGVY |
Ga0209178_10792803 | 3300027725 | Agricultural Soil | SEESVMSERAATVDVIEVPVEEPELAEAELLVEEVSIDGMCGVY |
Ga0209178_11199331 | 3300027725 | Agricultural Soil | MSERVATADVIEVPAAEPGLAQSELTELAEAELLVEEVSID |
Ga0209074_100578651 | 3300027787 | Agricultural Soil | MSERVATADVIEVPAAEPGLAQSELTETELAEAELLVEEVSIDGMCGVY |
Ga0209074_103199931 | 3300027787 | Agricultural Soil | CAARESAMSERVATADVIEVPAAEPGLAQGELTELAEAELLVEEVSIDGMCGVY |
Ga0307293_101682792 | 3300028711 | Soil | MSERVAIADVIEVPAPEPGLAQSELAETELAEAELLV |
Ga0307313_100643923 | 3300028715 | Soil | VPAAEPELAQSELNELAEAELLVEEVSIDGMCGVY |
Ga0307280_100118194 | 3300028768 | Soil | APEPGLAQSELAETELAEAELLVEEVSIDGMCGVY |
Ga0307314_102093001 | 3300028872 | Soil | MSERVATADVIEVPAAEPELAQSELNELAEAELLVEE |
Ga0307498_100591002 | 3300031170 | Soil | MSERVATADVIEVPAAEPELAQSELNELAQAELLVEEVSIDGMCGVY |
Ga0307499_101767092 | 3300031184 | Soil | MSERVATADVIEVPAAEPGLAQSELTEPELTEAELLVEEVSIDGMCGVY |
Ga0307500_101097921 | 3300031198 | Soil | EVPAAEPGLAQCELTELAEAELLVEEVSIDGMCGVY |
Ga0307497_100923492 | 3300031226 | Soil | MSERVAIADVIEVPAAEPELAQSELNELAQAELLVEEVSIDGMCGVY |
Ga0310813_106818282 | 3300031716 | Soil | MSERVATADVIEVPATEPGVAQGELTELAEAELLVEEVSIDGMCGVY |
Ga0308176_101075421 | 3300031996 | Soil | MSERVAIADVIEVPAAEPELAQSELTELAEAELLVEEVSIDGMCGVY |
Ga0308173_108504992 | 3300032074 | Soil | MSERVAIADVIEVPAAEPELAQGELTELAEAELLVEEVSIDGMCGVY |
Ga0307472_1011145161 | 3300032205 | Hardwood Forest Soil | MSERVATLDITEATGAEAAEAELAETELAEAELAEAELLVEEVSID |
Ga0335085_100882501 | 3300032770 | Soil | MSERVAIADVIEVPAAEPELAQSEPDELAEAELLVEEVSIDGMCGVY |
Ga0335072_112127612 | 3300032898 | Soil | MSERVATADVIEVPAAEPELAETELLVEEVSIDGMCGVY |
⦗Top⦘ |