Basic Information | |
---|---|
Family ID | F064898 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 42 residues |
Representative Sequence | ADCERRVNAEPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN |
Number of Associated Samples | 109 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.78 % |
% of genes near scaffold ends (potentially truncated) | 97.66 % |
% of genes from short scaffolds (< 2000 bps) | 89.06 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.438 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.250 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.812 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.594 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF13349 | DUF4097 | 27.34 |
PF01202 | SKI | 10.16 |
PF13345 | Obsolete Pfam Family | 10.16 |
PF01381 | HTH_3 | 1.56 |
PF12802 | MarR_2 | 0.78 |
PF08281 | Sigma70_r4_2 | 0.78 |
PF04551 | GcpE | 0.78 |
PF14534 | DUF4440 | 0.78 |
PF04542 | Sigma70_r2 | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.78 |
COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.78 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.78 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.78 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.44 % |
Unclassified | root | N/A | 1.56 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001867|JGI12627J18819_10302305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100324195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
3300004091|Ga0062387_100751441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300004091|Ga0062387_100882537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
3300004102|Ga0058888_1378545 | Not Available | 517 | Open in IMG/M |
3300005166|Ga0066674_10309749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300005174|Ga0066680_10033880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2907 | Open in IMG/M |
3300005180|Ga0066685_10348746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
3300005181|Ga0066678_10892588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300005447|Ga0066689_10111618 | All Organisms → cellular organisms → Bacteria | 1583 | Open in IMG/M |
3300005454|Ga0066687_10059444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1813 | Open in IMG/M |
3300005541|Ga0070733_11214668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300005542|Ga0070732_10035287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2859 | Open in IMG/M |
3300005552|Ga0066701_10258471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
3300005554|Ga0066661_10006017 | All Organisms → cellular organisms → Bacteria | 5715 | Open in IMG/M |
3300005558|Ga0066698_11034710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300005560|Ga0066670_10257090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
3300005576|Ga0066708_10157295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1401 | Open in IMG/M |
3300006086|Ga0075019_10119675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1525 | Open in IMG/M |
3300006176|Ga0070765_101746753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300006797|Ga0066659_10030955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3199 | Open in IMG/M |
3300007255|Ga0099791_10130930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1165 | Open in IMG/M |
3300009012|Ga0066710_101179848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
3300009038|Ga0099829_10385814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
3300009038|Ga0099829_10472922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
3300009088|Ga0099830_11419735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300009137|Ga0066709_101682616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
3300010142|Ga0127483_1169071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300010366|Ga0126379_13324093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300010379|Ga0136449_102029415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300010396|Ga0134126_10819507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
3300010860|Ga0126351_1147302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
3300011082|Ga0138526_1196144 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 670 | Open in IMG/M |
3300011120|Ga0150983_10004364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1234 | Open in IMG/M |
3300011120|Ga0150983_10892573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
3300011270|Ga0137391_10577405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
3300011270|Ga0137391_11018288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300011271|Ga0137393_11322953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
3300012189|Ga0137388_11504807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
3300012189|Ga0137388_11766883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300012202|Ga0137363_10002180 | All Organisms → cellular organisms → Bacteria | 11587 | Open in IMG/M |
3300012203|Ga0137399_11803205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300012205|Ga0137362_10932581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
3300012205|Ga0137362_11058553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300012209|Ga0137379_10748897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300012350|Ga0137372_10016824 | All Organisms → cellular organisms → Bacteria | 6915 | Open in IMG/M |
3300012361|Ga0137360_10882965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300012392|Ga0134043_1127134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
3300012582|Ga0137358_11040947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300012918|Ga0137396_10156494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1662 | Open in IMG/M |
3300012922|Ga0137394_11271326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300012929|Ga0137404_12006601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
3300012930|Ga0137407_10647725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
3300015053|Ga0137405_1324633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
3300015053|Ga0137405_1340750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2520 | Open in IMG/M |
3300015054|Ga0137420_1031422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300015054|Ga0137420_1250234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300015054|Ga0137420_1377373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
3300015264|Ga0137403_11491876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300017972|Ga0187781_11033939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300018059|Ga0184615_10361944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300020021|Ga0193726_1125969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
3300020140|Ga0179590_1044378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300020170|Ga0179594_10131701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
3300020170|Ga0179594_10189620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300020581|Ga0210399_10636770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300020581|Ga0210399_10646397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
3300020581|Ga0210399_10808839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
3300021046|Ga0215015_10508785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
3300021086|Ga0179596_10009119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3170 | Open in IMG/M |
3300021088|Ga0210404_10085461 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
3300021151|Ga0179584_1085138 | Not Available | 541 | Open in IMG/M |
3300021170|Ga0210400_10647166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
3300021171|Ga0210405_10042476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3611 | Open in IMG/M |
3300021178|Ga0210408_10194069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1614 | Open in IMG/M |
3300021315|Ga0179958_1009295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300021403|Ga0210397_10594743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
3300021406|Ga0210386_11197230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
3300021433|Ga0210391_10235106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1439 | Open in IMG/M |
3300021559|Ga0210409_10929662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
3300022504|Ga0242642_1010573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300022504|Ga0242642_1011825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
3300022508|Ga0222728_1059945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
3300022531|Ga0242660_1034120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
3300022531|Ga0242660_1211749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300022533|Ga0242662_10050749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
3300022724|Ga0242665_10279830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300022726|Ga0242654_10278499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300024330|Ga0137417_1254797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300025922|Ga0207646_11026709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300025939|Ga0207665_11005857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300026285|Ga0209438_1049782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
3300026325|Ga0209152_10159142 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
3300026328|Ga0209802_1048149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2125 | Open in IMG/M |
3300026328|Ga0209802_1324925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300026499|Ga0257181_1018928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
3300026523|Ga0209808_1228475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300026523|Ga0209808_1235999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300026530|Ga0209807_1340743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
3300026536|Ga0209058_1097934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1492 | Open in IMG/M |
3300026555|Ga0179593_1081698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3077 | Open in IMG/M |
3300027307|Ga0209327_1020223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300027562|Ga0209735_1084238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300027583|Ga0209527_1036850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
3300027587|Ga0209220_1005445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3410 | Open in IMG/M |
3300027629|Ga0209422_1062412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
3300027633|Ga0208988_1138448 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300027773|Ga0209810_1052432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2124 | Open in IMG/M |
3300027842|Ga0209580_10257332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
3300027846|Ga0209180_10235602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
3300027857|Ga0209166_10189575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
3300027862|Ga0209701_10502856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300027867|Ga0209167_10378506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300027867|Ga0209167_10738304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300027903|Ga0209488_10487877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300027903|Ga0209488_11153557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300027986|Ga0209168_10081556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1686 | Open in IMG/M |
3300028536|Ga0137415_10515320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300028884|Ga0307308_10629741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300029636|Ga0222749_10296050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300030991|Ga0073994_12271441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
3300031823|Ga0307478_10693921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
3300031962|Ga0307479_10322516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1527 | Open in IMG/M |
3300031962|Ga0307479_11099307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
3300032180|Ga0307471_100016030 | All Organisms → cellular organisms → Bacteria | 5286 | Open in IMG/M |
3300032205|Ga0307472_101053796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
3300032756|Ga0315742_11674476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
3300032770|Ga0335085_10537514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1327 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.19% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.84% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.59% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.25% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.34% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.34% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.56% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.78% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.78% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF212 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010860 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011082 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021315 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12627J18819_103023051 | 3300001867 | Forest Soil | FIADCEQRIKDEPGDDLTREYLTGAYEQKAELISAMMERRGSVN* |
JGIcombinedJ26739_1003241954 | 3300002245 | Forest Soil | KEQPGDELARDYLSGAYQQKAELLSAMMEREGGVY* |
Ga0062387_1007514411 | 3300004091 | Bog Forest Soil | LHTVDDFIAECEHHLKEEPQDDLAREYLSRAYEQKAELLSAMMDRGRSVN* |
Ga0062387_1008825371 | 3300004091 | Bog Forest Soil | ADCEQRVKEEPRDDLAREYLTGAYQQKAELLSAMMERGGSIN* |
Ga0058888_13785452 | 3300004102 | Forest Soil | VDCEERVKENPQDDLAREYLTGAYQQKAELISVMMDRGESGH* |
Ga0066674_103097492 | 3300005166 | Soil | RQNLKQVDDFIADCERRVSAEPRDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0066680_100338805 | 3300005174 | Soil | FIADCERHLKAEPQDELAREYLSNAYQQKAELLSAMMDREGSLH* |
Ga0066685_103487461 | 3300005180 | Soil | FIADCKQRIQEDPQDDLAREYLNSAYQQKAELLAAMMDRGGSVN* |
Ga0066678_108925881 | 3300005181 | Soil | DCERRLNDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0066689_101116183 | 3300005447 | Soil | QNLKQVDDFIADCERRVSAEPRDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0066687_100594444 | 3300005454 | Soil | IADCEHRVSAEPRDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0070733_112146681 | 3300005541 | Surface Soil | EQRVKEQPEDELARDYLSGAYQQKAQLLSVMMEREGGVY* |
Ga0070732_100352875 | 3300005542 | Surface Soil | QRVKEQPGDDVARDYLTGAYQQKAQLLSVMMERQGGEY* |
Ga0066701_102584711 | 3300005552 | Soil | LKQVDDFIADCERRVSAEPRDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0066661_100060171 | 3300005554 | Soil | DDFIADCERRVHAAPQDDLAREYLSNAYQQKAELLSAMMDRGGSVQ* |
Ga0066698_110347102 | 3300005558 | Soil | QTVDDFIADCERRLNDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0066670_102570902 | 3300005560 | Soil | IADCERRVSAEPRDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0066708_101572951 | 3300005576 | Soil | FIADCERRVNAEPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0075019_101196753 | 3300006086 | Watersheds | QQVDDFIADCEHRVSVAPQDELAREYLSNAYQQKAELLSAMMDREGSLH* |
Ga0070765_1017467532 | 3300006176 | Soil | EEPQDDLAREYLSGAYQQKAELLSAMMDRGGSIH* |
Ga0066659_100309555 | 3300006797 | Soil | DCKQRIQEDPQDDLAREYLNSAYQQKAELLAAMMDRGGSVN* |
Ga0099791_101309302 | 3300007255 | Vadose Zone Soil | AAPQDELAREYLSNAYQQKAELLSAMMDREGSMH* |
Ga0066710_1011798481 | 3300009012 | Grasslands Soil | DDFIADCERRLNDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN |
Ga0099829_103858142 | 3300009038 | Vadose Zone Soil | SAVDEFIADCERRVQTEPQDELTREYLTGAYRQKAELLSAMMDRGGSGN* |
Ga0099829_104729221 | 3300009038 | Vadose Zone Soil | QAAPEDDLAREYLSNAYQQKAELLSAMMDREGSIH* |
Ga0099830_114197351 | 3300009088 | Vadose Zone Soil | RVHAAPQDELAREYLYNAYQQKAELLSAMMDRGGSVH* |
Ga0066709_1016826161 | 3300009137 | Grasslands Soil | DDFIADCERRVNEAPQDDLAREYLTNAYQQKAELLSAMMDRGGSVN* |
Ga0127483_11690711 | 3300010142 | Grasslands Soil | DCERRVNAEPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0126379_133240931 | 3300010366 | Tropical Forest Soil | IVDCEQRVKQEPDDQLARDYLTGAYQQKAELISVMMERGETEY* |
Ga0136449_1020294151 | 3300010379 | Peatlands Soil | PVDDSYRQSLQQVDEFIADCEHRVSVAPEDELAREYLSNAYQQKAELLSAMMDREGSVH* |
Ga0134126_108195072 | 3300010396 | Terrestrial Soil | ADCEQRMKDDPRDDLTREYLSGAYQQKAQLLSAMMERGGSVN* |
Ga0126351_11473021 | 3300010860 | Boreal Forest Soil | RRVREEPSDELAREYLTNAYQQKAQLLSAMMDRGGSLN* |
Ga0138526_11961441 | 3300011082 | Peatlands Soil | EFIADCERRVNAAPQDDLAREYLSNAYQQKAELLSAMMDREGSLH* |
Ga0150983_100043641 | 3300011120 | Forest Soil | RVSATPEDDVAREYLSNAYQQKAELLSAMMDREGSLH* |
Ga0150983_108925733 | 3300011120 | Forest Soil | APVDDSYRQSLQQVDEFIADCERRVSATPEDDVAREYLSNAYQQKAELLSAMMDREGSLH |
Ga0137391_105774052 | 3300011270 | Vadose Zone Soil | ADCERRVNAAPQDELAREYLSNAYQQKAELLSAMMDRGGSVH* |
Ga0137391_110182882 | 3300011270 | Vadose Zone Soil | IVDCEQRVKEQPEDEIARDYLAGAYQQKAELLSVMMEREGGGY* |
Ga0137393_113229531 | 3300011271 | Vadose Zone Soil | YDFIADCEHRLNDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSLN* |
Ga0137388_115048072 | 3300012189 | Vadose Zone Soil | ADCERHLKAEPQDDLAREYLSNAYQQKAELLSAMMDREGSLH* |
Ga0137388_117668831 | 3300012189 | Vadose Zone Soil | NDFIADCERRVNAAPQDELAREYLSSAYQQKAELLSAMMDREGSIH* |
Ga0137363_100021801 | 3300012202 | Vadose Zone Soil | VNVFIADCERHLKAEPQDELAREYLSIAYQQKAELLSAMMDREGSLH* |
Ga0137399_118032052 | 3300012203 | Vadose Zone Soil | RENLQKVDDFIADCERRLNDVPQDDLAREYLSNAYQQKAELLSAMMDRRGSVN* |
Ga0137362_109325812 | 3300012205 | Vadose Zone Soil | QVDDFIAECERRVNDAPQDELAREYLSNAYQQNAELLSAMMDREGSVH* |
Ga0137362_110585531 | 3300012205 | Vadose Zone Soil | ERHLKAEPQDELAREYLSNAYQQKAELLSAMMDREGSLH* |
Ga0137379_107488972 | 3300012209 | Vadose Zone Soil | NEAPQDDLARDYLTNAYQQKAELLSAMMDRGGSVQ* |
Ga0137372_1001682410 | 3300012350 | Vadose Zone Soil | QEVDDFIADCARRANEAPQDDPARDYLTNAYQHKAELPSAMMDRGGSVN* |
Ga0137360_108829652 | 3300012361 | Vadose Zone Soil | DNFIADYERHLKTEPQDELAREYLSNAYQQKAELLSAMMDREGSIH* |
Ga0134043_11271342 | 3300012392 | Grasslands Soil | AEPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN* |
Ga0137358_110409472 | 3300012582 | Vadose Zone Soil | LNDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSLN* |
Ga0137396_101564941 | 3300012918 | Vadose Zone Soil | DFIADCEHRVSVAPQDELAREYLSNAYQQKAELLSAMMDREGSIH* |
Ga0137394_112713261 | 3300012922 | Vadose Zone Soil | HLVSVAPQDELAREYLSNAYEQKAGLLSAMMDREGRLH* |
Ga0137404_120066012 | 3300012929 | Vadose Zone Soil | ERRLNDAPQDDLAREYLSNAYQQKAALLSAMMDRGGSLN* |
Ga0137407_106477252 | 3300012930 | Vadose Zone Soil | DFIADCERRVNDAPQDELAREYLSNAYQQKAELLSAMMDRGGSVQ* |
Ga0137405_13246332 | 3300015053 | Vadose Zone Soil | LQTVDDFIADCERRLNDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSLH* |
Ga0137405_13407502 | 3300015053 | Vadose Zone Soil | LKTEPQDELAREYLSNAYQQKAELLSAMMDREGSIH* |
Ga0137420_10314222 | 3300015054 | Vadose Zone Soil | ADCERRVNAAPQDELAREYLSDAYQQKAELLSAMMDREGSIH* |
Ga0137420_12502342 | 3300015054 | Vadose Zone Soil | RHLKAEPQDELAREYLSNAYQQKAELLSAMMDREGSLH* |
Ga0137420_13773731 | 3300015054 | Vadose Zone Soil | CERHLKFIADCERHLKAEPQDELAREYLSNAYQQKAELLSAMMDREGSLH* |
Ga0137403_114918762 | 3300015264 | Vadose Zone Soil | SDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSLN* |
Ga0187781_110339392 | 3300017972 | Tropical Peatland | FIADCERHLKAEPQDVLAREYLSDAYQQKAELLSAMMDRGRSVN |
Ga0184615_103619441 | 3300018059 | Groundwater Sediment | RTDPQNELAREYLYGAYQQKADLLSAMVERGAYGE |
Ga0193726_11259692 | 3300020021 | Soil | FIADCEQRLREVPSDDLAREYLTNAYQQKAQLLSAMMDRGGSLN |
Ga0179590_10443781 | 3300020140 | Vadose Zone Soil | VKEQPQDELTREYLSGAYQQKAELISVMMERGGSEN |
Ga0179594_101317012 | 3300020170 | Vadose Zone Soil | RLNDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSLH |
Ga0179594_101896201 | 3300020170 | Vadose Zone Soil | ADCERRLNDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN |
Ga0210399_106367702 | 3300020581 | Soil | VDCEQRVKEQPQDDLAREYLTGAYQQKAELISVIMERGGSGY |
Ga0210399_106463972 | 3300020581 | Soil | IADCERRVKEEPQDDLAREYLSGAYQQKAELLSAMMDRGGSIH |
Ga0210399_108088391 | 3300020581 | Soil | VDDFIADCERRVQAEPQDELTREYLTGAYRQKAVLLSAMMERGGSGN |
Ga0215015_105087852 | 3300021046 | Soil | MILSQNCERRVQAEPQDELAREYLSSAYRQKAQLLSAMMERQGSGN |
Ga0179596_100091195 | 3300021086 | Vadose Zone Soil | DDFIAVCERRMQAAPEDDLAREYLSNAYQQKAELLSAMMDREGSVH |
Ga0210404_100854611 | 3300021088 | Soil | IKEEPRDDLAREYLTGAYQQKAELLSAMMERGGSVN |
Ga0179584_10851382 | 3300021151 | Vadose Zone Soil | IDCEQRVKEQPQDELTRDYLSGAYQQKAELISVMMERGGSEN |
Ga0210400_106471662 | 3300021170 | Soil | CIADCEQRVKEEPRDDLAREYLNGAYQQKAELLSAMMERGGSVN |
Ga0210405_100424761 | 3300021171 | Soil | ERRVREEPSDELAREYLTNAYQQKAQLLSAMMDRGGSLN |
Ga0210408_101940691 | 3300021178 | Soil | RLRAAPQDELAREYLSNAYQQKAELLSAMMDREGSIH |
Ga0179958_10092951 | 3300021315 | Vadose Zone Soil | KFIIDCEQRVKEQPQDELTRDYLSGAYQQKAELISVMMERGGSEN |
Ga0210397_105947431 | 3300021403 | Soil | KFIADCEQRVKEEPRDDLAREYLTGAYQQKAELLSAMMERGGSVN |
Ga0210386_111972302 | 3300021406 | Soil | KEEPRDDLAREYLTGAYQQKAELLSAMMERGGSVN |
Ga0210391_102351061 | 3300021433 | Soil | RVKEEPRDDLAREYLNGAYQQKAELLSAMMERGGSVN |
Ga0210409_109296621 | 3300021559 | Soil | EFIAECEHHLREDPQDDLAREYLSRAYQQKAELLSAMMDRGRSVN |
Ga0242642_10105731 | 3300022504 | Soil | VDCEQRIKEQPQDALTREYLSGAYQQKAELISVMMERGGSGY |
Ga0242642_10118252 | 3300022504 | Soil | ISECERHLKEDPQDDLAREYLSRAYQQKAELLSAMMDRGGSVN |
Ga0222728_10599452 | 3300022508 | Soil | VKEEPQDDLAREYLANAYQQKAELLSTMMDRGGSVN |
Ga0242660_10341202 | 3300022531 | Soil | ERHLKEQPQDELTREYLSAAYQQKAELLSAMMDRGGSVH |
Ga0242660_12117492 | 3300022531 | Soil | VDDFIADCEHRVSVAPQDELAREYLSNAYQQKAELLSAMMDREGSLH |
Ga0242662_100507492 | 3300022533 | Soil | VIEAPQDELAREYLSNAYQQKAELLSAMMDREGSLH |
Ga0242665_102798301 | 3300022724 | Soil | RRVKEEPQDDLAREYLSGAYQQKAELLSAMMDRGGSIH |
Ga0242654_102784992 | 3300022726 | Soil | DDFIADCERRVQAEPQDELTREYLTGAYRQKAVLLSAMMERGGSGN |
Ga0137417_12547972 | 3300024330 | Vadose Zone Soil | QRVKEEPQDDLAREYLTGAYQQKAELISVMMERGESGY |
Ga0207646_110267092 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IIDCEQRVKEQPQDELTREYLSGAYQQKAELISVMMERGGSGN |
Ga0207665_110058571 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | KFIADCEQRMKEEPRDDLAREYLTGAYQQKAELLSAMMERGGSVN |
Ga0209438_10497823 | 3300026285 | Grasslands Soil | SVAPQDELAREYLSNAYQQKAELLSAMMDREGSLH |
Ga0209152_101591422 | 3300026325 | Soil | DCERRVNAAPQDDLAREYLSNAYQQKAELLSAMMDRGGSVH |
Ga0209802_10481491 | 3300026328 | Soil | REEPQNEIAREYLYGAYQQKAELLASMTERGEIGD |
Ga0209802_13249252 | 3300026328 | Soil | NLKQVDDFIADCERRVSAEPRDDLAREYLSNAYQQKAELLSAMMDRGGSVN |
Ga0257181_10189282 | 3300026499 | Soil | CERRVQAEPQDELAREYLSGAYRQKAQLLSAMMERGGSGN |
Ga0209808_12284751 | 3300026523 | Soil | ADCERRVNAEPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN |
Ga0209808_12359992 | 3300026523 | Soil | FRQNLKQVDDFIADCERRVSAEPRDDLAREYLSNAYQQKAELLSAMMDRGGSVN |
Ga0209807_13407432 | 3300026530 | Soil | CEQRMKDDPRDDLTREYLSGAYQQKAQLLSAMMERGGSVN |
Ga0209058_10979343 | 3300026536 | Soil | IADCERRVNEAPQDDLAREYLTNAYQQKAELLSAMMDRGGSVN |
Ga0179593_10816984 | 3300026555 | Vadose Zone Soil | VKEQPQDDLTREYLSGAYQQKAELISVMMERGGSEN |
Ga0209327_10202231 | 3300027307 | Forest Soil | FIADCEQRIKDEPGDDLTREYLTGAYEQKAELISAMMERRGSVN |
Ga0209735_10842381 | 3300027562 | Forest Soil | FIADCERRVNATPQDELAREYLSNAYQQKAELLSAMMDREGSVH |
Ga0209527_10368502 | 3300027583 | Forest Soil | ADCERRVREEPSDELAREYLTNAYQQKAQLLSAMMDRGGSLN |
Ga0209220_10054455 | 3300027587 | Forest Soil | VNAAPQDELAREYLSNAYQQKAELLSAMMDREGSIH |
Ga0209422_10624122 | 3300027629 | Forest Soil | EFIADCERRVREVPSDELAREYLTNAYQQKAQLLSAMMDRGGSLN |
Ga0208988_11384481 | 3300027633 | Forest Soil | LQQVDDFIADCERRVNAAPQDELAREYLSNAYQQKAELLSAMMDRGGSVY |
Ga0209810_10524321 | 3300027773 | Surface Soil | RDCRQRLEQDPQDPLAREYLSGAYQQKAELLSTMMDRGGSLN |
Ga0209580_102573322 | 3300027842 | Surface Soil | KEQPGDDVARDYLTGAYQQKAQLLSVMMERQGGEY |
Ga0209180_102356021 | 3300027846 | Vadose Zone Soil | EFIADCERRVQTEPQDELTREYLTGAYRQKAELLSAMMDRGGSGN |
Ga0209166_101895753 | 3300027857 | Surface Soil | RVKEQPEDEVARDYLTGAYQQKAELLSVMMDREGERVLR |
Ga0209701_105028562 | 3300027862 | Vadose Zone Soil | QNLSAVDDFIADCERRVQAEPQDELAREYLSGAYRQKAQLLSAMMERQGSGN |
Ga0209167_103785062 | 3300027867 | Surface Soil | KDEPDDDLTREYLTGAYEQKAELISAMMERRGSVN |
Ga0209167_107383041 | 3300027867 | Surface Soil | KFIVDCEQRVKEQPEDELARDYLSGAYQQKAQLLSVMMEREGGVY |
Ga0209488_104878771 | 3300027903 | Vadose Zone Soil | NFIVDCEQRVKDQPQDELTREYLSGAYQQKAELISVMMERGGSGN |
Ga0209488_111535571 | 3300027903 | Vadose Zone Soil | RVKATPEDDLAREYLSNAYQQKAELLSAMMDREGSVH |
Ga0209168_100815563 | 3300027986 | Surface Soil | RIKDEPDDDLTREYLSGAYEQKAELISAMMERRGSVN |
Ga0137415_105153202 | 3300028536 | Vadose Zone Soil | DCERRLNDVPQDDLAREYLSNAYQQKAELLSAMMDRGGSVN |
Ga0307308_106297411 | 3300028884 | Soil | RRVRSAPQDDLAREYLSNAYQQKAELLSAMMDRGGSVH |
Ga0222749_102960501 | 3300029636 | Soil | QNLTTVNDFIADCERRVQAEPQDELTREYLTGAYRQKAVLLSAMMERGGSGN |
Ga0073994_122714411 | 3300030991 | Soil | FIADCERRVKEEPKDELAREYLTNAYQQKAQLLSAMMDRGGSLN |
Ga0307478_106939211 | 3300031823 | Hardwood Forest Soil | RLKDQPGDDFSREYLNGAYQQKAELLSVMMEREGGR |
Ga0307479_103225163 | 3300031962 | Hardwood Forest Soil | IADCEQRVKEQPGDDLAREYLSGAYQQKAELLSALMEPGGGGN |
Ga0307479_110993072 | 3300031962 | Hardwood Forest Soil | QVDEFIADCERRVSATPEDDVAREYLSNAYQQKAELLSAMMDREGSLH |
Ga0307471_1000160301 | 3300032180 | Hardwood Forest Soil | QAEPQDELTREYLTGAYRQKAELLSAMMERGGSGN |
Ga0307472_1010537961 | 3300032205 | Hardwood Forest Soil | ERRLNDAPQDDLAREYLSNAYQQKAELLSAMMDRGGSLH |
Ga0315742_116744762 | 3300032756 | Forest Soil | VTEEPQDTLAREYLSGAYEQKAELLSAMMDRGGSVN |
Ga0335085_105375141 | 3300032770 | Soil | DCEQRIKDEPGDDLTREYLSGAYEQKAELISAMMERRGSVN |
⦗Top⦘ |