Basic Information | |
---|---|
Family ID | F065039 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 128 |
Average Sequence Length | 37 residues |
Representative Sequence | GDPVNLEADLIAKYVEKMMTGEPAESSLTVEELVRQGF |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 128 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 3.91 % |
% of genes from short scaffolds (< 2000 bps) | 0.78 % |
Associated GOLD sequencing projects | 112 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (96.094 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.938 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.875 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.562 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 128 Family Scaffolds |
---|---|---|
PF00005 | ABC_tran | 51.56 |
PF12804 | NTP_transf_3 | 7.03 |
PF08238 | Sel1 | 3.12 |
PF11925 | DUF3443 | 1.56 |
PF01979 | Amidohydro_1 | 1.56 |
PF00583 | Acetyltransf_1 | 1.56 |
PF00903 | Glyoxalase | 1.56 |
PF14552 | Tautomerase_2 | 1.56 |
PF00128 | Alpha-amylase | 1.56 |
PF00990 | GGDEF | 1.56 |
PF04073 | tRNA_edit | 1.56 |
PF03743 | TrbI | 0.78 |
PF05598 | DUF772 | 0.78 |
PF00440 | TetR_N | 0.78 |
PF08545 | ACP_syn_III | 0.78 |
PF07238 | PilZ | 0.78 |
PF01645 | Glu_synthase | 0.78 |
PF13559 | DUF4129 | 0.78 |
PF04389 | Peptidase_M28 | 0.78 |
PF08459 | UvrC_RNaseH_dom | 0.78 |
PF13181 | TPR_8 | 0.78 |
PF07690 | MFS_1 | 0.78 |
PF13231 | PMT_2 | 0.78 |
PF08530 | PepX_C | 0.78 |
COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
---|---|---|---|
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 1.56 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 1.56 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 1.56 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 1.56 |
COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.78 |
COG0322 | Excinuclease UvrABC, nuclease subunit | Replication, recombination and repair [L] | 0.78 |
COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.78 |
COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.78 |
COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.78 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 96.09 % |
All Organisms | root | All Organisms | 3.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300012944|Ga0137410_10126853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1921 | Open in IMG/M |
3300018090|Ga0187770_10099092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2172 | Open in IMG/M |
3300021403|Ga0210397_10001046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17913 | Open in IMG/M |
3300027591|Ga0209733_1008957 | All Organisms → cellular organisms → Bacteria | 2615 | Open in IMG/M |
3300028866|Ga0302278_10010055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8201 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.25% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.25% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.69% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.91% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.91% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.12% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.12% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.12% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.12% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.34% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.34% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.34% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.56% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.56% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.56% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.56% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.56% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.78% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.78% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.78% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.78% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.78% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.78% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.78% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.78% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.78% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.78% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.78% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25613J43889_100721621 | 3300002907 | Grasslands Soil | RPGAHVNLEADLIAKYVEKMMASESAESTLTVEELVRQGF* |
Ga0070676_110957102 | 3300005328 | Miscanthus Rhizosphere | PGDPVNLEVDMVAKYVEKMIKGESANSGLTVERLVGEGF* |
Ga0070685_103884631 | 3300005466 | Switchgrass Rhizosphere | SLKPGDPVNLEADLIAKYIEKMTKGASSSTITVENLIRQGF* |
Ga0073909_100866971 | 3300005526 | Surface Soil | SLKPGDPVNLEADLIAKYVEKMTKGASSSIITVENLVRQGF* |
Ga0070731_111935702 | 3300005538 | Surface Soil | NLEVDMVAKYVEKMLRGESANSSLTVERLVSEGF* |
Ga0070672_1000097819 | 3300005543 | Miscanthus Rhizosphere | GDPVNLEADLIAKYVEKMMKGASSGSLTIEQLVAQGF* |
Ga0066702_103626251 | 3300005575 | Soil | NLEADLIAKYVEKMLRERSGGSSITLERLVSEGF* |
Ga0070702_1000200275 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | HSLKAGDPVNLEADLIAKYVEKMMKSASSSSLTIEQLVAQGF* |
Ga0075274_10067343 | 3300005901 | Rice Paddy Soil | DPLNLEVDLVAKYVEKMVRGEEASAELTVERLMAEGF* |
Ga0097691_11284521 | 3300006055 | Arctic Peat Soil | PVNLEADVIAKYVEKMMKNEPAQSSITVEELVRQGF* |
Ga0075030_1005418582 | 3300006162 | Watersheds | AGDPVNLEADLIAKYVEKMMKGEASESSLTIEELVAEGF* |
Ga0070716_1006326592 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KLGDPVNLEVDMIAKYVEKMIRGESVNSSLTVERLVTEGF* |
Ga0097621_1002855781 | 3300006237 | Miscanthus Rhizosphere | GDPVNLEADLIAKYIEKMTKGASSSTITVENLIRQGF* |
Ga0079222_120775362 | 3300006755 | Agricultural Soil | GDPVNLEADLIAKYVEKMMRGSESQKSISFEQLVSQGF* |
Ga0079221_118092411 | 3300006804 | Agricultural Soil | VNLEVDMIAKYVEKMMKGESANSPVTLERLVEQGF* |
Ga0105240_101150175 | 3300009093 | Corn Rhizosphere | VNLEVDMIAKYVEKMIRGESVNSSLTVERLVTEGF* |
Ga0105245_100035631 | 3300009098 | Miscanthus Rhizosphere | GDPVNLEADLIAKYVEKMMKGASSSSLTIEQLVAQGF* |
Ga0105242_117802422 | 3300009176 | Miscanthus Rhizosphere | VNLEVDMVAKYVEKMIKGESANSGLTVERLVGEGF* |
Ga0116218_13246561 | 3300009522 | Peatlands Soil | VNLEVDVIAKYIEKMIRGDSAGETITVERLVSEGF* |
Ga0116221_10609891 | 3300009523 | Peatlands Soil | KPGDPVNLEVYMIAKYVEKMMRGDSTNSSINVERLEREGF* |
Ga0116138_12128951 | 3300009552 | Peatland | GDPVNLEADLIAKYVEKMMTSEPAVSSLTVEELVRQGF* |
Ga0116124_10842141 | 3300009634 | Peatland | PVNLEADLIAKYVEKMMSSEPMENSLTVEELVRQGF* |
Ga0116224_106013992 | 3300009683 | Peatlands Soil | GDPVNLEADLIAKYVEKMMRGDASESSLTVEDLVQQGF* |
Ga0116130_10484461 | 3300009762 | Peatland | PGDPVNLEADVIAKYVEKMMKGDSAQSSLNVEQLVRQGF* |
Ga0126384_103378653 | 3300010046 | Tropical Forest Soil | VNLEADLIAKYVEKMMKGEAGQIALTIEDLVEQGF* |
Ga0099796_103421871 | 3300010159 | Vadose Zone Soil | VNLEADLIAKYVEKMMISESAASTLTVEELVRQGF* |
Ga0074046_101517982 | 3300010339 | Bog Forest Soil | VNLEVDMIAKYVEKMMKGDSENSPITLERLVSAGF* |
Ga0126372_132269941 | 3300010360 | Tropical Forest Soil | DPVNLEADLIAKYVEKMMKGDASESSLTIEELVSQGF* |
Ga0134066_100455022 | 3300010364 | Grasslands Soil | LRAGDPVNLEADLVAKYVEKMLRERSSSSITLERLVSEGF* |
Ga0126379_106685281 | 3300010366 | Tropical Forest Soil | PVNLEADLIAKYVEKMMKGEPAQSSLTIEDLVEQGF* |
Ga0126381_1011580851 | 3300010376 | Tropical Forest Soil | PGDPVNLEADLIAKYVEKMMKGETSPSLTVEELVGKGF* |
Ga0126381_1023422562 | 3300010376 | Tropical Forest Soil | GDPVNLEVDMIAKYVEKLMAGDSTNSPLTLERLVAQGF* |
Ga0126381_1050147692 | 3300010376 | Tropical Forest Soil | PVNLEADLIAKYVEKMMKGDAGQSALTIEDLVEQGF* |
Ga0126383_105813381 | 3300010398 | Tropical Forest Soil | QPGDPVNLEADVIAKYVEKMMKGETQSSLTVEELVKQGF* |
Ga0134121_113256461 | 3300010401 | Terrestrial Soil | GDPVNLEVDLVAKYVEKMIKGESAGSGLTVERLAGEGF* |
Ga0137391_104337281 | 3300011270 | Vadose Zone Soil | GDPVNLEVDMIAKYVEKMMSRESHSSITLERLVREGF* |
Ga0137388_101116311 | 3300012189 | Vadose Zone Soil | VNLEVDLVAKYVEKMIKGESANSSLTVERLVREGF* |
Ga0137383_113508982 | 3300012199 | Vadose Zone Soil | KVGDPVNLEADLIAKYVEKMMRGDAESSLTVEDLVQQGF* |
Ga0137399_101444633 | 3300012203 | Vadose Zone Soil | GDPVNLETDMIAKYLEKMMQRESANRPLTIERLVEQGF* |
Ga0137376_110042122 | 3300012208 | Vadose Zone Soil | VNLETDLVAKYVEKMLRREPTTPITLERLVAEGF* |
Ga0137360_102224611 | 3300012361 | Vadose Zone Soil | GDPVNLEADLIAKYVEKMMKRDPTESSLTIEQLVQQGF* |
Ga0137398_112159252 | 3300012683 | Vadose Zone Soil | NLEADLIAKYVEKMMTNEPAESSLTVEELVRQGF* |
Ga0137413_104479331 | 3300012924 | Vadose Zone Soil | VNLEVDVVAKYVEKMMRSRNPESVLTVEQLVREGF* |
Ga0137416_110626332 | 3300012927 | Vadose Zone Soil | DPLNLEADLIAKYVEKMMKGETSVSSLSVEELVRQGF* |
Ga0137416_120442202 | 3300012927 | Vadose Zone Soil | RAGDPVNLEADLIAKYVEKMTKRDPAESSLTIEELVQQGF* |
Ga0137404_119740101 | 3300012929 | Vadose Zone Soil | DPVNLEADLIAKYVEKMMRREPEATHLTIEELVKQGF* |
Ga0137410_101268535 | 3300012944 | Vadose Zone Soil | DPVNLEVDVVAKYVEKMMRSTAPSSALTVEQLVREGF* |
Ga0181524_104627321 | 3300014155 | Bog | NLEADVIAKYVEKMMKGDQAQSSLTVDELVKQGF* |
Ga0181526_106192012 | 3300014200 | Bog | DPVNLEADLIAKYVEKMMRGDASESSLTVEDLVQQGF* |
Ga0182030_106328673 | 3300014838 | Bog | DPVNLEADLIAKYVEKMMTSEPAVSSLTVEELVRQGF* |
Ga0132256_1023499482 | 3300015372 | Arabidopsis Rhizosphere | PGDPVNLEVDMIAKYVEKMMKGESANSPLTLERLVEQGF* |
Ga0182034_107787121 | 3300016371 | Soil | VNLEVDMIAKYVEKMMRGESENSSLTLDRLVRQGF |
Ga0187776_110341801 | 3300017966 | Tropical Peatland | VNLEVDVVAKYIEKMIRGESGGSSLTVERLVGEGF |
Ga0187780_107470321 | 3300017973 | Tropical Peatland | VNLEVDMIAKYVEKMMQGDSANSAITLEKLVEAGF |
Ga0187810_105099142 | 3300018012 | Freshwater Sediment | DPVNLEVDMIAKYVEKMMRGDYTNSSINVERLVREGF |
Ga0187810_105217432 | 3300018012 | Freshwater Sediment | VNLEVDMIAKYIEKMMRGESGNSSITLEKLVQAGF |
Ga0187873_11531711 | 3300018013 | Peatland | VNLEADLIAKYVEKMMSSEPMENSLTVEELVRQGF |
Ga0187873_12712012 | 3300018013 | Peatland | PGDPVNLEADVIAKYVEKMMKGDSAQSSLNVEQLVRQGF |
Ga0187880_12712202 | 3300018016 | Peatland | DPVNLEADVIAKYVEKMMKGDSAQSSITVEELVRQGF |
Ga0187880_14413172 | 3300018016 | Peatland | GDPVNLEADLIAKYVEKMMKGERSENSLTVEELVQQGF |
Ga0187859_100050521 | 3300018047 | Peatland | VNLEADVIAKYVEKMMGKATGQKSFTVEELVRQGF |
Ga0187859_102089161 | 3300018047 | Peatland | DPVNLEADVIAKYVEKMMKGEPSQNSLTVENLVAQGF |
Ga0187784_111641501 | 3300018062 | Tropical Peatland | PGDPVNLEADLIAKYVEKMMKGEASANSLTIEELVEQGF |
Ga0187772_100295925 | 3300018085 | Tropical Peatland | GDPVNLEADLIAKYVEKMMTGEPAESSLTVEELVRQGF |
Ga0187772_105787392 | 3300018085 | Tropical Peatland | PVNLEVDMIAKYVEKMMQGESANSSITMERLMREGF |
Ga0187769_108247972 | 3300018086 | Tropical Peatland | DPVNLEADLIAKYVEKMMSPEPTESSLTVEELVRQGF |
Ga0187771_104663323 | 3300018088 | Tropical Peatland | VNLEADLIAKYVEKMMKGEASENSLTIEGLVEQGF |
Ga0187770_100990921 | 3300018090 | Tropical Peatland | PVNLEADLIAKYVEKMMKGEAAEKSLTIEDLVEQGF |
Ga0182031_14322483 | 3300019787 | Bog | VNLEADVIAKYVEKMMKGEPSQNSLSVEELVEQGF |
Ga0193723_10551892 | 3300019879 | Soil | GDPVNLETDLVAKYVEKMLRREPTTAITLERLVAEGF |
Ga0210407_103629613 | 3300020579 | Soil | VNLEVDMIAKYVEKMVGGEGARSSITIERLVKEGF |
Ga0210405_108285842 | 3300021171 | Soil | VNLEVDMIAKYVERMMRGDSAKRSITIERLLREGF |
Ga0210396_102631211 | 3300021180 | Soil | VNLEADLIAKYVEKMMRGDADENSLTVEDLVRQGF |
Ga0210397_100010461 | 3300021403 | Soil | MNLEADLIAKYVEKMMRGEASENSLTVEDLVQQGF |
Ga0210387_105954571 | 3300021405 | Soil | VNLEADLIAKYVEKMIKNEPAESSLTVAELIKQGF |
Ga0210386_110736782 | 3300021406 | Soil | GDPVNLEVDMIAKYVERMMRGDSNNSSITIERLVREGF |
Ga0210398_108083122 | 3300021477 | Soil | SLKPGDPVNLEADLIAKYVEKMMKGNGQDSFTIDELVAQGF |
Ga0210402_107545302 | 3300021478 | Soil | PLNLEADLIAKYVEKMVKGEPAQGSITVEELVRQGF |
Ga0126371_103587403 | 3300021560 | Tropical Forest Soil | GDPMNLEADLIAKYVEKMLHGDSGNAGLTVEELVRKGF |
Ga0212123_103245372 | 3300022557 | Iron-Sulfur Acid Spring | SLTPADPVNLEVDMIAKYVEKMMKGESANHPITLEKLVSEGF |
Ga0209171_100841913 | 3300025320 | Iron-Sulfur Acid Spring | VNLEADLIAKYVEKMILNKSEAESSLTVEDLVRQGF |
Ga0208323_10818722 | 3300025439 | Peatland | DPVNLEADVIAKYVEKMMKSEPAQSSITVEELVRQGF |
Ga0208188_10628591 | 3300025507 | Peatland | DPVNLEADVIAKYVEKMMKGDSAQSSLNVEQLVRQGF |
Ga0207645_103915122 | 3300025907 | Miscanthus Rhizosphere | VNLEVDMVAKYVEKMIKGESANSGLTVERLVGEGF |
Ga0207694_102510633 | 3300025924 | Corn Rhizosphere | AGDPVNLETDLIAKYVEKMMGGESSNSSLTVEELVRQGF |
Ga0207661_105390091 | 3300025944 | Corn Rhizosphere | RPGDPVNLEVDMVAKYVEKMIKGESANSGLTVERLVGEGF |
Ga0209237_11299943 | 3300026297 | Grasslands Soil | DPVNLEADLIAKYVEKMLRERSGGSSITLERLVSEGF |
Ga0209688_10219212 | 3300026305 | Soil | VNLEADLIAKYVEKMMQRESQQGALTIEDLVEQGF |
Ga0209153_10457503 | 3300026312 | Soil | DPVNLEADLVAKYVEKMLRERSSSSITLERLVSEGF |
Ga0209804_12119612 | 3300026335 | Soil | GDPVNLEADLVAKYVEKMLRERSSSSITLERLVSEGF |
Ga0257171_10756771 | 3300026377 | Soil | LEADLIAKYVEKYVEKMIKGGPAQSSITVEELVRQGF |
Ga0209529_10447891 | 3300027334 | Forest Soil | KPGDPVNLEADLIAKYVEKMILNQTDAEASLTVEDLVRQGF |
Ga0209421_11191051 | 3300027432 | Forest Soil | LGTAAPGTAVNIEVDLIAKYVEKMIKGDSANSTITVERLVKAGF |
Ga0208993_10753302 | 3300027480 | Forest Soil | DPVNLEADLIAKYVEKMMRGEPSASSLTVEELVRQGF |
Ga0209733_10089571 | 3300027591 | Forest Soil | PVNLEADLIAKYVEKMMSGRSSLTPGSLTIEELVRQGF |
Ga0208827_11925703 | 3300027641 | Peatlands Soil | PVNLEADLIAKYVEKMMKGEASENSLTVEELVRQGF |
Ga0209038_100644412 | 3300027737 | Bog Forest Soil | PINLEADLIAKYVEKMMARESEESSLTVEELVRQGF |
Ga0209074_100893982 | 3300027787 | Agricultural Soil | LKSLRPGDPLNLEVDLVAKYVEKMVRGEEASAELTVERLMAEGF |
Ga0209811_103089842 | 3300027821 | Surface Soil | KSLKPGDPVNLEADLIAKYVEKMTKGASSSIITVENLVRQGF |
Ga0209167_103866471 | 3300027867 | Surface Soil | GDPVNLEADLIAKYVEKMMNNIPAQSSLTVEELVRQGF |
Ga0209283_103500101 | 3300027875 | Vadose Zone Soil | GDPVNLEVDMIAKYVEKMMSRESHSSITLERLVREGF |
Ga0265357_10171462 | 3300028023 | Rhizosphere | GDPVNLEADLIAKYVEKMMNGDAESSLTVEDLVQQGF |
Ga0302267_102981871 | 3300028745 | Bog | GDPVNLEADLLAKYVEKMMQRDSAATGLTVNELVEQGF |
Ga0302221_101691802 | 3300028806 | Palsa | DPVNLEADLIAKYVEKMTQGKSAQSSPTISSLTIGELVRQGF |
Ga0307312_106053262 | 3300028828 | Soil | PVNLETDLVAKYVEKMLRREPTTPITLERLVAEGF |
Ga0302278_100100557 | 3300028866 | Bog | GDPVNLEADLIAKYVEKLMSREAAESSFTIEELVRQGF |
Ga0308309_110319051 | 3300028906 | Soil | LKPGDPINLEVDMVAKYVEKMMKAESANPKITVKRLVSEGF |
Ga0311371_108952481 | 3300029951 | Palsa | NLEADLIAKYIEKMMMKRESASSTITVEELVQQGF |
Ga0311342_104043501 | 3300029955 | Bog | DPVNLEADVIAKYVEQMMKGESGQSSITVEELVQQGF |
Ga0302182_100962013 | 3300030054 | Palsa | EADLIAKYVEKMTQGKSAQSSPTISSLTIGELVRQGF |
Ga0311356_106760902 | 3300030617 | Palsa | DLVNLEADLIAKYVEKMMTSEPEESTLTVEELVRQGF |
Ga0073994_120549852 | 3300030991 | Soil | AVNLEADLIAKYVEKMVKGEPAQSSITVEELVRQGF |
Ga0307499_101954882 | 3300031184 | Soil | GDPVNLEADLIAKYVEKMMKGESSQSSLTIEDPVEQGF |
Ga0302325_118750321 | 3300031234 | Palsa | KPGDPVNLEADLIAKYVEKMMKGVPVPSSIVIEELVRQGF |
Ga0310686_1021216231 | 3300031708 | Soil | NLEADLIAKYVEKMILNKSEAESSLTVEDLVRQGF |
Ga0310686_1032673351 | 3300031708 | Soil | PGDPVNLEADVIAKYVEKMMKREPGQSHFTVEDLVKQGF |
Ga0310686_1166373261 | 3300031708 | Soil | GDPVNLEVDMIAKYVERMMRGDSANRSITIERLLREGF |
Ga0307477_103623052 | 3300031753 | Hardwood Forest Soil | GDPVNLEADLIAKYVEKMMGREPEESALTAEELVQQGF |
Ga0307473_104218161 | 3300031820 | Hardwood Forest Soil | KAGDPVNLETDMIAKYVEKMMKGESANRPLTIEKLVQQGF |
Ga0306919_106094252 | 3300031879 | Soil | DPVNLEVDMIAKYVEKMMQGESANSPLTLERLVQQGF |
Ga0310902_111210341 | 3300032012 | Soil | PLNLEADLVAKYVEKMMKGASSSSLTIEHLVAQGF |
Ga0308173_117368312 | 3300032074 | Soil | LKAGDPVNLETDLIAKYVEKMMGGESSNNSLTVEELVRQGF |
Ga0335079_100869331 | 3300032783 | Soil | GDPVNLEVDVIAKYVEKMIQGDSTNSSLTVDRLVSQGF |
Ga0335080_104576061 | 3300032828 | Soil | GDPVNLEVDMVAKYVEKMMKGDSGTGNITLESLVRKGF |
Ga0335083_111691752 | 3300032954 | Soil | PVNLEADLIAKYVEKMMKGESQSSLTIEDLVEQGF |
Ga0335077_101088315 | 3300033158 | Soil | VNLEVDVIAKYVEKMIQGDSTNSSLTVDRLVSQGF |
Ga0370483_0006044_2_109 | 3300034124 | Untreated Peat Soil | INLEADVIAKYVEKMMSREAAESSLTVEELVRQGF |
Ga0370492_0359804_480_587 | 3300034282 | Untreated Peat Soil | VNLEADLIAKYVEKMMKGEPQPGSLTVEELVQQGF |
⦗Top⦘ |