NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065039

Metagenome / Metatranscriptome Family F065039

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065039
Family Type Metagenome / Metatranscriptome
Number of Sequences 128
Average Sequence Length 37 residues
Representative Sequence GDPVNLEADLIAKYVEKMMTGEPAESSLTVEELVRQGF
Number of Associated Samples 118
Number of Associated Scaffolds 128

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 3.91 %
% of genes from short scaffolds (< 2000 bps) 0.78 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (96.094 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(10.938 % of family members)
Environment Ontology (ENVO) Unclassified
(21.875 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.562 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.36%    β-sheet: 0.00%    Coil/Unstructured: 63.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 128 Family Scaffolds
PF00005ABC_tran 51.56
PF12804NTP_transf_3 7.03
PF08238Sel1 3.12
PF11925DUF3443 1.56
PF01979Amidohydro_1 1.56
PF00583Acetyltransf_1 1.56
PF00903Glyoxalase 1.56
PF14552Tautomerase_2 1.56
PF00128Alpha-amylase 1.56
PF00990GGDEF 1.56
PF04073tRNA_edit 1.56
PF03743TrbI 0.78
PF05598DUF772 0.78
PF00440TetR_N 0.78
PF08545ACP_syn_III 0.78
PF07238PilZ 0.78
PF01645Glu_synthase 0.78
PF13559DUF4129 0.78
PF04389Peptidase_M28 0.78
PF08459UvrC_RNaseH_dom 0.78
PF13181TPR_8 0.78
PF07690MFS_1 0.78
PF13231PMT_2 0.78
PF08530PepX_C 0.78

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 128 Family Scaffolds
COG02961,4-alpha-glucan branching enzymeCarbohydrate transport and metabolism [G] 1.56
COG0366Glycosidase/amylase (phosphorylase)Carbohydrate transport and metabolism [G] 1.56
COG1523Pullulanase/glycogen debranching enzymeCarbohydrate transport and metabolism [G] 1.56
COG3280Maltooligosyltrehalose synthaseCarbohydrate transport and metabolism [G] 1.56
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.78
COG0322Excinuclease UvrABC, nuclease subunitReplication, recombination and repair [L] 0.78
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.78
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.78
COG2948Type IV secretory pathway, VirB10 componentIntracellular trafficking, secretion, and vesicular transport [U] 0.78


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A96.09 %
All OrganismsrootAll Organisms3.91 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300012944|Ga0137410_10126853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1921Open in IMG/M
3300018090|Ga0187770_10099092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2172Open in IMG/M
3300021403|Ga0210397_10001046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae17913Open in IMG/M
3300027591|Ga0209733_1008957All Organisms → cellular organisms → Bacteria2615Open in IMG/M
3300028866|Ga0302278_10010055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8201Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.25%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.25%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.69%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.91%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.91%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.12%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.12%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.12%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.12%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.34%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.34%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.34%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.56%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.56%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.56%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.56%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.78%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.78%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.78%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.78%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.78%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.78%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.78%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.78%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.78%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.78%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.78%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.78%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.78%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300027334Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25613J43889_1007216213300002907Grasslands SoilRPGAHVNLEADLIAKYVEKMMASESAESTLTVEELVRQGF*
Ga0070676_1109571023300005328Miscanthus RhizospherePGDPVNLEVDMVAKYVEKMIKGESANSGLTVERLVGEGF*
Ga0070685_1038846313300005466Switchgrass RhizosphereSLKPGDPVNLEADLIAKYIEKMTKGASSSTITVENLIRQGF*
Ga0073909_1008669713300005526Surface SoilSLKPGDPVNLEADLIAKYVEKMTKGASSSIITVENLVRQGF*
Ga0070731_1119357023300005538Surface SoilNLEVDMVAKYVEKMLRGESANSSLTVERLVSEGF*
Ga0070672_10000978193300005543Miscanthus RhizosphereGDPVNLEADLIAKYVEKMMKGASSGSLTIEQLVAQGF*
Ga0066702_1036262513300005575SoilNLEADLIAKYVEKMLRERSGGSSITLERLVSEGF*
Ga0070702_10002002753300005615Corn, Switchgrass And Miscanthus RhizosphereHSLKAGDPVNLEADLIAKYVEKMMKSASSSSLTIEQLVAQGF*
Ga0075274_100673433300005901Rice Paddy SoilDPLNLEVDLVAKYVEKMVRGEEASAELTVERLMAEGF*
Ga0097691_112845213300006055Arctic Peat SoilPVNLEADVIAKYVEKMMKNEPAQSSITVEELVRQGF*
Ga0075030_10054185823300006162WatershedsAGDPVNLEADLIAKYVEKMMKGEASESSLTIEELVAEGF*
Ga0070716_10063265923300006173Corn, Switchgrass And Miscanthus RhizosphereKLGDPVNLEVDMIAKYVEKMIRGESVNSSLTVERLVTEGF*
Ga0097621_10028557813300006237Miscanthus RhizosphereGDPVNLEADLIAKYIEKMTKGASSSTITVENLIRQGF*
Ga0079222_1207753623300006755Agricultural SoilGDPVNLEADLIAKYVEKMMRGSESQKSISFEQLVSQGF*
Ga0079221_1180924113300006804Agricultural SoilVNLEVDMIAKYVEKMMKGESANSPVTLERLVEQGF*
Ga0105240_1011501753300009093Corn RhizosphereVNLEVDMIAKYVEKMIRGESVNSSLTVERLVTEGF*
Ga0105245_1000356313300009098Miscanthus RhizosphereGDPVNLEADLIAKYVEKMMKGASSSSLTIEQLVAQGF*
Ga0105242_1178024223300009176Miscanthus RhizosphereVNLEVDMVAKYVEKMIKGESANSGLTVERLVGEGF*
Ga0116218_132465613300009522Peatlands SoilVNLEVDVIAKYIEKMIRGDSAGETITVERLVSEGF*
Ga0116221_106098913300009523Peatlands SoilKPGDPVNLEVYMIAKYVEKMMRGDSTNSSINVERLEREGF*
Ga0116138_121289513300009552PeatlandGDPVNLEADLIAKYVEKMMTSEPAVSSLTVEELVRQGF*
Ga0116124_108421413300009634PeatlandPVNLEADLIAKYVEKMMSSEPMENSLTVEELVRQGF*
Ga0116224_1060139923300009683Peatlands SoilGDPVNLEADLIAKYVEKMMRGDASESSLTVEDLVQQGF*
Ga0116130_104844613300009762PeatlandPGDPVNLEADVIAKYVEKMMKGDSAQSSLNVEQLVRQGF*
Ga0126384_1033786533300010046Tropical Forest SoilVNLEADLIAKYVEKMMKGEAGQIALTIEDLVEQGF*
Ga0099796_1034218713300010159Vadose Zone SoilVNLEADLIAKYVEKMMISESAASTLTVEELVRQGF*
Ga0074046_1015179823300010339Bog Forest SoilVNLEVDMIAKYVEKMMKGDSENSPITLERLVSAGF*
Ga0126372_1322699413300010360Tropical Forest SoilDPVNLEADLIAKYVEKMMKGDASESSLTIEELVSQGF*
Ga0134066_1004550223300010364Grasslands SoilLRAGDPVNLEADLVAKYVEKMLRERSSSSITLERLVSEGF*
Ga0126379_1066852813300010366Tropical Forest SoilPVNLEADLIAKYVEKMMKGEPAQSSLTIEDLVEQGF*
Ga0126381_10115808513300010376Tropical Forest SoilPGDPVNLEADLIAKYVEKMMKGETSPSLTVEELVGKGF*
Ga0126381_10234225623300010376Tropical Forest SoilGDPVNLEVDMIAKYVEKLMAGDSTNSPLTLERLVAQGF*
Ga0126381_10501476923300010376Tropical Forest SoilPVNLEADLIAKYVEKMMKGDAGQSALTIEDLVEQGF*
Ga0126383_1058133813300010398Tropical Forest SoilQPGDPVNLEADVIAKYVEKMMKGETQSSLTVEELVKQGF*
Ga0134121_1132564613300010401Terrestrial SoilGDPVNLEVDLVAKYVEKMIKGESAGSGLTVERLAGEGF*
Ga0137391_1043372813300011270Vadose Zone SoilGDPVNLEVDMIAKYVEKMMSRESHSSITLERLVREGF*
Ga0137388_1011163113300012189Vadose Zone SoilVNLEVDLVAKYVEKMIKGESANSSLTVERLVREGF*
Ga0137383_1135089823300012199Vadose Zone SoilKVGDPVNLEADLIAKYVEKMMRGDAESSLTVEDLVQQGF*
Ga0137399_1014446333300012203Vadose Zone SoilGDPVNLETDMIAKYLEKMMQRESANRPLTIERLVEQGF*
Ga0137376_1100421223300012208Vadose Zone SoilVNLETDLVAKYVEKMLRREPTTPITLERLVAEGF*
Ga0137360_1022246113300012361Vadose Zone SoilGDPVNLEADLIAKYVEKMMKRDPTESSLTIEQLVQQGF*
Ga0137398_1121592523300012683Vadose Zone SoilNLEADLIAKYVEKMMTNEPAESSLTVEELVRQGF*
Ga0137413_1044793313300012924Vadose Zone SoilVNLEVDVVAKYVEKMMRSRNPESVLTVEQLVREGF*
Ga0137416_1106263323300012927Vadose Zone SoilDPLNLEADLIAKYVEKMMKGETSVSSLSVEELVRQGF*
Ga0137416_1204422023300012927Vadose Zone SoilRAGDPVNLEADLIAKYVEKMTKRDPAESSLTIEELVQQGF*
Ga0137404_1197401013300012929Vadose Zone SoilDPVNLEADLIAKYVEKMMRREPEATHLTIEELVKQGF*
Ga0137410_1012685353300012944Vadose Zone SoilDPVNLEVDVVAKYVEKMMRSTAPSSALTVEQLVREGF*
Ga0181524_1046273213300014155BogNLEADVIAKYVEKMMKGDQAQSSLTVDELVKQGF*
Ga0181526_1061920123300014200BogDPVNLEADLIAKYVEKMMRGDASESSLTVEDLVQQGF*
Ga0182030_1063286733300014838BogDPVNLEADLIAKYVEKMMTSEPAVSSLTVEELVRQGF*
Ga0132256_10234994823300015372Arabidopsis RhizospherePGDPVNLEVDMIAKYVEKMMKGESANSPLTLERLVEQGF*
Ga0182034_1077871213300016371SoilVNLEVDMIAKYVEKMMRGESENSSLTLDRLVRQGF
Ga0187776_1103418013300017966Tropical PeatlandVNLEVDVVAKYIEKMIRGESGGSSLTVERLVGEGF
Ga0187780_1074703213300017973Tropical PeatlandVNLEVDMIAKYVEKMMQGDSANSAITLEKLVEAGF
Ga0187810_1050991423300018012Freshwater SedimentDPVNLEVDMIAKYVEKMMRGDYTNSSINVERLVREGF
Ga0187810_1052174323300018012Freshwater SedimentVNLEVDMIAKYIEKMMRGESGNSSITLEKLVQAGF
Ga0187873_115317113300018013PeatlandVNLEADLIAKYVEKMMSSEPMENSLTVEELVRQGF
Ga0187873_127120123300018013PeatlandPGDPVNLEADVIAKYVEKMMKGDSAQSSLNVEQLVRQGF
Ga0187880_127122023300018016PeatlandDPVNLEADVIAKYVEKMMKGDSAQSSITVEELVRQGF
Ga0187880_144131723300018016PeatlandGDPVNLEADLIAKYVEKMMKGERSENSLTVEELVQQGF
Ga0187859_1000505213300018047PeatlandVNLEADVIAKYVEKMMGKATGQKSFTVEELVRQGF
Ga0187859_1020891613300018047PeatlandDPVNLEADVIAKYVEKMMKGEPSQNSLTVENLVAQGF
Ga0187784_1116415013300018062Tropical PeatlandPGDPVNLEADLIAKYVEKMMKGEASANSLTIEELVEQGF
Ga0187772_1002959253300018085Tropical PeatlandGDPVNLEADLIAKYVEKMMTGEPAESSLTVEELVRQGF
Ga0187772_1057873923300018085Tropical PeatlandPVNLEVDMIAKYVEKMMQGESANSSITMERLMREGF
Ga0187769_1082479723300018086Tropical PeatlandDPVNLEADLIAKYVEKMMSPEPTESSLTVEELVRQGF
Ga0187771_1046633233300018088Tropical PeatlandVNLEADLIAKYVEKMMKGEASENSLTIEGLVEQGF
Ga0187770_1009909213300018090Tropical PeatlandPVNLEADLIAKYVEKMMKGEAAEKSLTIEDLVEQGF
Ga0182031_143224833300019787BogVNLEADVIAKYVEKMMKGEPSQNSLSVEELVEQGF
Ga0193723_105518923300019879SoilGDPVNLETDLVAKYVEKMLRREPTTAITLERLVAEGF
Ga0210407_1036296133300020579SoilVNLEVDMIAKYVEKMVGGEGARSSITIERLVKEGF
Ga0210405_1082858423300021171SoilVNLEVDMIAKYVERMMRGDSAKRSITIERLLREGF
Ga0210396_1026312113300021180SoilVNLEADLIAKYVEKMMRGDADENSLTVEDLVRQGF
Ga0210397_1000104613300021403SoilMNLEADLIAKYVEKMMRGEASENSLTVEDLVQQGF
Ga0210387_1059545713300021405SoilVNLEADLIAKYVEKMIKNEPAESSLTVAELIKQGF
Ga0210386_1107367823300021406SoilGDPVNLEVDMIAKYVERMMRGDSNNSSITIERLVREGF
Ga0210398_1080831223300021477SoilSLKPGDPVNLEADLIAKYVEKMMKGNGQDSFTIDELVAQGF
Ga0210402_1075453023300021478SoilPLNLEADLIAKYVEKMVKGEPAQGSITVEELVRQGF
Ga0126371_1035874033300021560Tropical Forest SoilGDPMNLEADLIAKYVEKMLHGDSGNAGLTVEELVRKGF
Ga0212123_1032453723300022557Iron-Sulfur Acid SpringSLTPADPVNLEVDMIAKYVEKMMKGESANHPITLEKLVSEGF
Ga0209171_1008419133300025320Iron-Sulfur Acid SpringVNLEADLIAKYVEKMILNKSEAESSLTVEDLVRQGF
Ga0208323_108187223300025439PeatlandDPVNLEADVIAKYVEKMMKSEPAQSSITVEELVRQGF
Ga0208188_106285913300025507PeatlandDPVNLEADVIAKYVEKMMKGDSAQSSLNVEQLVRQGF
Ga0207645_1039151223300025907Miscanthus RhizosphereVNLEVDMVAKYVEKMIKGESANSGLTVERLVGEGF
Ga0207694_1025106333300025924Corn RhizosphereAGDPVNLETDLIAKYVEKMMGGESSNSSLTVEELVRQGF
Ga0207661_1053900913300025944Corn RhizosphereRPGDPVNLEVDMVAKYVEKMIKGESANSGLTVERLVGEGF
Ga0209237_112999433300026297Grasslands SoilDPVNLEADLIAKYVEKMLRERSGGSSITLERLVSEGF
Ga0209688_102192123300026305SoilVNLEADLIAKYVEKMMQRESQQGALTIEDLVEQGF
Ga0209153_104575033300026312SoilDPVNLEADLVAKYVEKMLRERSSSSITLERLVSEGF
Ga0209804_121196123300026335SoilGDPVNLEADLVAKYVEKMLRERSSSSITLERLVSEGF
Ga0257171_107567713300026377SoilLEADLIAKYVEKYVEKMIKGGPAQSSITVEELVRQGF
Ga0209529_104478913300027334Forest SoilKPGDPVNLEADLIAKYVEKMILNQTDAEASLTVEDLVRQGF
Ga0209421_111910513300027432Forest SoilLGTAAPGTAVNIEVDLIAKYVEKMIKGDSANSTITVERLVKAGF
Ga0208993_107533023300027480Forest SoilDPVNLEADLIAKYVEKMMRGEPSASSLTVEELVRQGF
Ga0209733_100895713300027591Forest SoilPVNLEADLIAKYVEKMMSGRSSLTPGSLTIEELVRQGF
Ga0208827_119257033300027641Peatlands SoilPVNLEADLIAKYVEKMMKGEASENSLTVEELVRQGF
Ga0209038_1006444123300027737Bog Forest SoilPINLEADLIAKYVEKMMARESEESSLTVEELVRQGF
Ga0209074_1008939823300027787Agricultural SoilLKSLRPGDPLNLEVDLVAKYVEKMVRGEEASAELTVERLMAEGF
Ga0209811_1030898423300027821Surface SoilKSLKPGDPVNLEADLIAKYVEKMTKGASSSIITVENLVRQGF
Ga0209167_1038664713300027867Surface SoilGDPVNLEADLIAKYVEKMMNNIPAQSSLTVEELVRQGF
Ga0209283_1035001013300027875Vadose Zone SoilGDPVNLEVDMIAKYVEKMMSRESHSSITLERLVREGF
Ga0265357_101714623300028023RhizosphereGDPVNLEADLIAKYVEKMMNGDAESSLTVEDLVQQGF
Ga0302267_1029818713300028745BogGDPVNLEADLLAKYVEKMMQRDSAATGLTVNELVEQGF
Ga0302221_1016918023300028806PalsaDPVNLEADLIAKYVEKMTQGKSAQSSPTISSLTIGELVRQGF
Ga0307312_1060532623300028828SoilPVNLETDLVAKYVEKMLRREPTTPITLERLVAEGF
Ga0302278_1001005573300028866BogGDPVNLEADLIAKYVEKLMSREAAESSFTIEELVRQGF
Ga0308309_1103190513300028906SoilLKPGDPINLEVDMVAKYVEKMMKAESANPKITVKRLVSEGF
Ga0311371_1089524813300029951PalsaNLEADLIAKYIEKMMMKRESASSTITVEELVQQGF
Ga0311342_1040435013300029955BogDPVNLEADVIAKYVEQMMKGESGQSSITVEELVQQGF
Ga0302182_1009620133300030054PalsaEADLIAKYVEKMTQGKSAQSSPTISSLTIGELVRQGF
Ga0311356_1067609023300030617PalsaDLVNLEADLIAKYVEKMMTSEPEESTLTVEELVRQGF
Ga0073994_1205498523300030991SoilAVNLEADLIAKYVEKMVKGEPAQSSITVEELVRQGF
Ga0307499_1019548823300031184SoilGDPVNLEADLIAKYVEKMMKGESSQSSLTIEDPVEQGF
Ga0302325_1187503213300031234PalsaKPGDPVNLEADLIAKYVEKMMKGVPVPSSIVIEELVRQGF
Ga0310686_10212162313300031708SoilNLEADLIAKYVEKMILNKSEAESSLTVEDLVRQGF
Ga0310686_10326733513300031708SoilPGDPVNLEADVIAKYVEKMMKREPGQSHFTVEDLVKQGF
Ga0310686_11663732613300031708SoilGDPVNLEVDMIAKYVERMMRGDSANRSITIERLLREGF
Ga0307477_1036230523300031753Hardwood Forest SoilGDPVNLEADLIAKYVEKMMGREPEESALTAEELVQQGF
Ga0307473_1042181613300031820Hardwood Forest SoilKAGDPVNLETDMIAKYVEKMMKGESANRPLTIEKLVQQGF
Ga0306919_1060942523300031879SoilDPVNLEVDMIAKYVEKMMQGESANSPLTLERLVQQGF
Ga0310902_1112103413300032012SoilPLNLEADLVAKYVEKMMKGASSSSLTIEHLVAQGF
Ga0308173_1173683123300032074SoilLKAGDPVNLETDLIAKYVEKMMGGESSNNSLTVEELVRQGF
Ga0335079_1008693313300032783SoilGDPVNLEVDVIAKYVEKMIQGDSTNSSLTVDRLVSQGF
Ga0335080_1045760613300032828SoilGDPVNLEVDMVAKYVEKMMKGDSGTGNITLESLVRKGF
Ga0335083_1116917523300032954SoilPVNLEADLIAKYVEKMMKGESQSSLTIEDLVEQGF
Ga0335077_1010883153300033158SoilVNLEVDVIAKYVEKMIQGDSTNSSLTVDRLVSQGF
Ga0370483_0006044_2_1093300034124Untreated Peat SoilINLEADVIAKYVEKMMSREAAESSLTVEELVRQGF
Ga0370492_0359804_480_5873300034282Untreated Peat SoilVNLEADLIAKYVEKMMKGEPQPGSLTVEELVQQGF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.