NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F065334

Metatranscriptome Family F065334

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065334
Family Type Metatranscriptome
Number of Sequences 127
Average Sequence Length 124 residues
Representative Sequence MFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Number of Associated Samples 91
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.51 %
% of genes near scaffold ends (potentially truncated) 82.68 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(70.079 % of family members)
Environment Ontology (ENVO) Unclassified
(93.701 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.890 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 26.98%    β-sheet: 7.14%    Coil/Unstructured: 65.87%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00834Ribul_P_3_epim 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009543|Ga0115099_10360861All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica506Open in IMG/M
3300009592|Ga0115101_1032218All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica500Open in IMG/M
3300009592|Ga0115101_1567983All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica506Open in IMG/M
3300009599|Ga0115103_1228035All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica522Open in IMG/M
3300011317|Ga0138386_1003870All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica507Open in IMG/M
3300012408|Ga0138265_1267525All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica568Open in IMG/M
3300012412|Ga0138266_1508925All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica572Open in IMG/M
3300012413|Ga0138258_1576482All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica524Open in IMG/M
3300012416|Ga0138259_1381842All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica574Open in IMG/M
3300012935|Ga0138257_1198628All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica504Open in IMG/M
3300017070|Ga0186594_114245All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica540Open in IMG/M
3300018515|Ga0192960_106006All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica578Open in IMG/M
3300018609|Ga0192959_1037230All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica621Open in IMG/M
3300018609|Ga0192959_1047676All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica518Open in IMG/M
3300018649|Ga0192969_1053251All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica550Open in IMG/M
3300018649|Ga0192969_1056753All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica522Open in IMG/M
3300018683|Ga0192952_1027524All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica585Open in IMG/M
3300018684|Ga0192983_1055812All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica540Open in IMG/M
3300018684|Ga0192983_1063227All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica500Open in IMG/M
3300018695|Ga0193259_1091115All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica510Open in IMG/M
3300018704|Ga0192954_1051549All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica559Open in IMG/M
3300018710|Ga0192984_1078387All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica570Open in IMG/M
3300018710|Ga0192984_1082479All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica544Open in IMG/M
3300018717|Ga0192964_1090581All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica591Open in IMG/M
3300018717|Ga0192964_1093131All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica575Open in IMG/M
3300018717|Ga0192964_1096075All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica558Open in IMG/M
3300018717|Ga0192964_1103239All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica519Open in IMG/M
3300018724|Ga0193391_1031738All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica642Open in IMG/M
3300018730|Ga0192967_1058259All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica643Open in IMG/M
3300018732|Ga0193381_1059362All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica521Open in IMG/M
3300018739|Ga0192974_1070721All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica568Open in IMG/M
3300018739|Ga0192974_1075706All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica541Open in IMG/M
3300018762|Ga0192963_1069221All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica562Open in IMG/M
3300018762|Ga0192963_1077974All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica519Open in IMG/M
3300018776|Ga0193407_1067338All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica517Open in IMG/M
3300018781|Ga0193380_1076612All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica512Open in IMG/M
3300018788|Ga0193085_1073145All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica516Open in IMG/M
3300018789|Ga0193251_1138538All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica557Open in IMG/M
3300018789|Ga0193251_1149552All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica517Open in IMG/M
3300018791|Ga0192950_1068017All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica535Open in IMG/M
3300018792|Ga0192956_1117479All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica633Open in IMG/M
3300018792|Ga0192956_1121981All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica613Open in IMG/M
3300018792|Ga0192956_1127081All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica592Open in IMG/M
3300018823|Ga0193053_1084098All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica504Open in IMG/M
3300018825|Ga0193048_1073098All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica518Open in IMG/M
3300018828|Ga0193490_1087956All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica502Open in IMG/M
3300018831|Ga0192949_1086233All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica605Open in IMG/M
3300018831|Ga0192949_1094655All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica568Open in IMG/M
3300018831|Ga0192949_1108729All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica515Open in IMG/M
3300018845|Ga0193042_1159000All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica500Open in IMG/M
3300018846|Ga0193253_1142687All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica518Open in IMG/M
3300018858|Ga0193413_1092004All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica504Open in IMG/M
3300018871|Ga0192978_1087196All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica568Open in IMG/M
3300018871|Ga0192978_1103084All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica512Open in IMG/M
3300018874|Ga0192977_1100650All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica573Open in IMG/M
3300018874|Ga0192977_1101187All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica571Open in IMG/M
3300018885|Ga0193311_10070831All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica503Open in IMG/M
3300018896|Ga0192965_1171587All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica604Open in IMG/M
3300018896|Ga0192965_1177849All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica582Open in IMG/M
3300018896|Ga0192965_1188943All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica546Open in IMG/M
3300018899|Ga0193090_1145550All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica517Open in IMG/M
3300018911|Ga0192987_1156674All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica568Open in IMG/M
3300018911|Ga0192987_1163799All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica546Open in IMG/M
3300018926|Ga0192989_10164202All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica530Open in IMG/M
3300018930|Ga0192955_10206156All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica506Open in IMG/M
3300018943|Ga0193266_10171340All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica505Open in IMG/M
3300018948|Ga0192985_1211340All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica585Open in IMG/M
3300018948|Ga0192985_1214087All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica577Open in IMG/M
3300018948|Ga0192985_1217468All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica568Open in IMG/M
3300018955|Ga0193379_10214182All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica525Open in IMG/M
3300018972|Ga0193326_10088247All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica507Open in IMG/M
3300018976|Ga0193254_10148088All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica535Open in IMG/M
3300018980|Ga0192961_10181976All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica635Open in IMG/M
3300018980|Ga0192961_10191228All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica616Open in IMG/M
3300018980|Ga0192961_10263097All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica503Open in IMG/M
3300018981|Ga0192968_10154589All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica592Open in IMG/M
3300018981|Ga0192968_10173895All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica549Open in IMG/M
3300018981|Ga0192968_10183815All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica529Open in IMG/M
3300018982|Ga0192947_10236098All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica591Open in IMG/M
3300018997|Ga0193257_10214659All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica552Open in IMG/M
3300019000|Ga0192953_10141331All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica601Open in IMG/M
3300019012|Ga0193043_10351455All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica514Open in IMG/M
3300019021|Ga0192982_10265166All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica616Open in IMG/M
3300019021|Ga0192982_10284721All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica593Open in IMG/M
3300019021|Ga0192982_10346974All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica531Open in IMG/M
3300019022|Ga0192951_10300264All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica606Open in IMG/M
3300019022|Ga0192951_10310271All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica596Open in IMG/M
3300019032|Ga0192869_10518252All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica507Open in IMG/M
3300019036|Ga0192945_10217449All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica610Open in IMG/M
3300019036|Ga0192945_10282526All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica520Open in IMG/M
3300019050|Ga0192966_10258360All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica618Open in IMG/M
3300019050|Ga0192966_10273928All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica597Open in IMG/M
3300019084|Ga0193051_110551All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica593Open in IMG/M
3300019103|Ga0192946_1058833All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica561Open in IMG/M
3300019108|Ga0192972_1080081All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica582Open in IMG/M
3300019153|Ga0192975_10259829All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica590Open in IMG/M
3300021169|Ga0206687_1073130All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica522Open in IMG/M
3300021874|Ga0063147_102718All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica504Open in IMG/M
3300021884|Ga0063143_1009193All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica513Open in IMG/M
3300021892|Ga0063137_1028284All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica502Open in IMG/M
3300021896|Ga0063136_1002405All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica502Open in IMG/M
3300021906|Ga0063087_1011528All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica506Open in IMG/M
3300021924|Ga0063085_1022899All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica500Open in IMG/M
3300028290|Ga0247572_1199483All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica504Open in IMG/M
3300030670|Ga0307401_10446776All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica588Open in IMG/M
3300030671|Ga0307403_10738367All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica536Open in IMG/M
3300030699|Ga0307398_10687436All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica567Open in IMG/M
3300030709|Ga0307400_10850168All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica562Open in IMG/M
3300031522|Ga0307388_11106981All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica538Open in IMG/M
3300031674|Ga0307393_1148105All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica529Open in IMG/M
3300031709|Ga0307385_10374533All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica543Open in IMG/M
3300031710|Ga0307386_10686742All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica547Open in IMG/M
3300031717|Ga0307396_10561924All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica548Open in IMG/M
3300031725|Ga0307381_10302355All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica576Open in IMG/M
3300031725|Ga0307381_10310516All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica569Open in IMG/M
3300031734|Ga0307397_10490835All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica573Open in IMG/M
3300031735|Ga0307394_10382357All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica563Open in IMG/M
3300031737|Ga0307387_10890588All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica565Open in IMG/M
3300031737|Ga0307387_10918855All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica556Open in IMG/M
3300031738|Ga0307384_10616310All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica521Open in IMG/M
3300031738|Ga0307384_10639386All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica512Open in IMG/M
3300031742|Ga0307395_10558668All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica502Open in IMG/M
3300031750|Ga0307389_11049433All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica542Open in IMG/M
3300031752|Ga0307404_10396342All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica577Open in IMG/M
3300033572|Ga0307390_10800323All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica594Open in IMG/M
3300033572|Ga0307390_10869070All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica569Open in IMG/M
3300033572|Ga0307390_10908160All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Phaeocystales → Phaeocystaceae → Phaeocystis → Phaeocystis antarctica557Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine70.08%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine23.62%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine3.94%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.79%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.79%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011317Marine microbial communities from the Southern Atlantic ocean - KN S17 DCM_B metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017070Metatranscriptome of marine eukaryotic communities from Arabian Sea in L1 medium with NH4Cl, 20 C, 32 psu salinity and 478 ?mol photons light - Phaeocystis sp. CCMP2710 (MMETSP1162)Host-AssociatedOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018609Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782449-ERR1712128)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018683Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782475-ERR1712204)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018695Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789500-ERR1719457)EnvironmentalOpen in IMG/M
3300018704Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782253-ERR1711956)EnvironmentalOpen in IMG/M
3300018710Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136)EnvironmentalOpen in IMG/M
3300018717Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789634-ERR1719196)EnvironmentalOpen in IMG/M
3300018724Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789589-ERR1719194)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018732Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789574-ERR1719298)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018781Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789655-ERR1719256)EnvironmentalOpen in IMG/M
3300018788Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000933 (ERX1789381-ERR1719390)EnvironmentalOpen in IMG/M
3300018789Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001380 (ERX1809763-ERR1740128)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018792Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018828Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002925 (ERX1789466-ERR1719252)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018845Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809760-ERR1740122)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018858Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002021 (ERX1789628-ERR1719293)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018896Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789685-ERR1719483)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018911Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001042 (ERX1809744-ERR1740134)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018943Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001290 (ERX1789547-ERR1719206)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018972Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001734 (ERX1789632-ERR1719168)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021884Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S25 C1 B22 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021906Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031709Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0115099_1036086113300009543MarineSNRAVMFRAFLVVLAAASVSAFVAPGVQSNVAVRGSALTMGAKKSGKVNPALFSNGIDPKKIAALNAKKKAAAKQEAEDDKKGLPKWNLFRVLPKQTNKATRSIDGSYRFPKPWGKQWGSQGLSDGP*
Ga0115101_103221813300009592MarineNRAVMFRAFLVVLAAASVSAFVAPGVQSNVAVRGSAVTMGAKKSGKVNPALFSNGIDPKKIAALNAKKKAAAKQEAEDDKKGLPKWNLFRVLPKQTNKATRSIDGSYRFPKPWGKQWGSQGLSDGP*
Ga0115101_156798313300009592MarineKMFRSLLVVLACASASAFVAPGVQANVQTRGSAVMMAKGSGKVNPALFATGIDPKRVAALKKAKAEALAQEKADDAKGLPKWNLFRALPKQDKASTRTTDGSFVFKKPWGKQWGA*
Ga0115103_122803513300009599MarineMFRSLLVVLACASASAFVAPGVQANVQTRGSAVMMAKGSGKVNPALFATGIDPKRVAALKKAKAEALAQEKADDAKGLPKWNLFRALPKQDKASTRTTDGSFVFKKPWGKQWGA*
Ga0138386_100387013300011317MarineMFRSLLVLLACASASAFVAPGVQANVQTRGSPVMMAKRSGKVNPALFSNGIDKKKLEAVKKAKAAAAAQEKADDAKGLPKWNLFRVLPKQEAKKTRTTDGSYVFDKPWGKQWGA*
Ga0138265_126752513300012408Polar MarineMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV*
Ga0138266_150892513300012412Polar MarineMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV*
Ga0138258_157648213300012413Polar MarineMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV*
Ga0138259_138184213300012416Polar MarineIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV*
Ga0138257_119862813300012935Polar MarineLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIYPKKISALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV*
Ga0186594_11424513300017070Host-AssociatedMFRSLLVLLACASASAFVAPGVQANVQTRGSPVMMAKRSGKVNPALFSNGIDKKKLEAVKKAKAAALAQEKADDAKGLPKWNLFRVLPKQEAKKTRTTDGSYVFDKPWGKQWGA
Ga0192960_10600613300018515MarineMGNLSWDLESIDNVPCLPRCPSASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0192959_103723013300018609MarineMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0192959_104767613300018609MarineHGLVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192969_105325113300018649MarineGVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192969_105675313300018649MarineTWVLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192952_102752413300018683MarineTWGIYRGIWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0192983_105581213300018684MarineAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192983_106322713300018684MarineQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0193259_109111513300018695MarineEIAVEMFRSLLVLLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAAEKADDAKGLPKWNLFRVLPKQEKKQTRTTDGSYVFNKPWGKQWGA
Ga0192954_105154913300018704MarineHGVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWD
Ga0192984_107838713300018710MarineSPTIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192984_108247913300018710MarineRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192964_109058113300018717MarineMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192964_109313113300018717MarineVAPHTAPMLYRILFVVLAATSASAFVAPGVQSTVSVRGSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQEKLDDAKGLPKWNIFRALPKQTQKGTRSIDGSYRFPKPWGKDWGSQGLTDG
Ga0192964_109607513300018717MarineVAPHTAPMLYRILFVVLAATSASAFVAPGVQSTVSVRGSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQDKADDLKGLPKWNIFRALPKQTNKGTRSIDGSFRFPKPWGKDWGSQGLTDG
Ga0192964_110323913300018717MarineQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWD
Ga0193391_103173813300018724MarineMFRSLLVVLACASASAFVAPGVQANVQTRGSPVMMAKRSGKVNPALFSNGIDKKKLEAVKKAKAAALAQEKADDAKGLPKWNLFRVLPKQEAKKTRTTDGSYVFDKPWGKQWGA
Ga0192967_105825913300018730MarineMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0193381_105936213300018732MarineNCSEITVEMFRSLLVLLACASASAFVAPGVQANVQTRGSPVMMAKRSGKVNPALFSNGIDKKKLEAVKKAKAAALAQEKADDAKGLPKWNLFRVLPKQEAKKTRTTDGSYVFDKPWGKQWGA
Ga0192974_107072113300018739MarineAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192974_107570613300018739MarineTIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192963_106922113300018762MarineMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192963_107797413300018762MarineVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0193407_106733813300018776MarineCSEITVEMFRSLLVLLACASASAFVAPGVQANVQTRGSPVMMAKRSGKVNPALFSNGIDKKKLEAVKKAKAAALAQEKADDAKGLPKWNLFRVLPKQEAKKTRTTDGSYVFDKPWGKQWG
Ga0193380_107661213300018781MarineEITVEMFRSLLVLLACASASAFVAPGVQANVQTRGSPVMMAKRSGKVNPALFSNGIDKKKLEAVKKAKAAALAQEKADDAKGLPKWNLFRVLPKQEAKKTRTTDGSYVFDKPWGKQWGA
Ga0193085_107314513300018788MarineRRDRAVEMFRSLLVVLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKLEAVKKAKAAAAAQEKADDAKGLPKWNLFRVLPKQDKKQTRTTDGSYVFNKPWGKQWG
Ga0193251_113853813300018789MarineWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0193251_114955213300018789MarineASVSAFVAPGVQSTVSVRTSVVTMGAKKGTGKVNPALFATGIDSKKVTKLNAAKAAKAAQEKADDAKGLPKWNLFRALPKQTKQQTRSIDGSFRFPKPWGKGTWD
Ga0192950_106801713300018791MarineMGVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192956_111747913300018792MarineHGEKRPRFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192956_112198113300018792MarineWGIYRGIWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0192956_112708113300018792MarineVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0193053_108409813300018823MarineMFRSLLVVLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAALAQEKADDAKGLPKWNLFRVLPKQDKKQTRTTDGSYVFNKPWGKQWGA
Ga0193048_107309813300018825MarineISNRAIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNAKKKAAAAQEKLDDDKGLPKWNLFRVLPKQTTKATRSIDGSYRFPKPWGKQWGSQGLSDGP
Ga0193490_108795613300018828MarineMFRSLLVVLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFANGIDKKKIEAVKKAKAQALAQEKADDAKGLPKWNLFRVLPKQDKKQTRTTDGSYVFNKPWGKQWGA
Ga0192949_108623313300018831MarineSVRGSAVTMGRGIWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0192949_109465513300018831MarineEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192949_110872913300018831MarineSVRGSAVTMGRGIWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNAKKKAAAAQEKLDDDKGLPKWNLFRVLPKQTTKATRSIDGSYRFPKPWGKQWGSQGLSDGP
Ga0193042_115900013300018845MarineWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNAKKKAAAAQEKLDDDKGLPKWNLFRVLPKQTTKATRSIDGSYRFPKPWGKQWGSQGLSDGP
Ga0193253_114268713300018846MarineGEIAVEMFRSLLVLLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAAEKADDAKGLPKWNLFRVLPKQEKKQTRTTDGSYVFNKPWGKQWGA
Ga0193413_109200413300018858MarineMFRSLLVVLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKLEAVKKAKAAALAQEKADDAKGLPKWNLFRVLPKQEAKKTRTTDGSYVFDKPWGKQWGA
Ga0192978_108719613300018871MarineEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKEKLAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192978_110308413300018871MarineVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192977_110065013300018874MarineVAPHTAPMLYRILFVVLAATSASAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192977_110118713300018874MarineGREAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0193311_1007083113300018885MarineEIAVEMFRSLLVLLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAAEKADDAKGLPKWNLFRVLPKQDAKQTRTTDGSYVFNKPWGKQWGA
Ga0192965_117158713300018896MarineVIEITQLLHQVVKLSFRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192965_117784913300018896MarineLERSRPLLQRISDMLRALLVVLAAASVSAFVAPGVQSTVSVRTSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQEKLDDAKGLPKWNIFRALPKQTQKGTRSIDGSYRFPKPWGKDWGSQGLTDG
Ga0192965_118894313300018896MarineEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0193090_114555013300018899MarineFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKEKLAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192987_115667413300018911MarineKKGAFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192987_116379913300018911MarineIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192989_1016420213300018926MarineAELFGEIAVEMFRSLLVLLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAAEKADDAKGLPKWNLFRVLPKQEKKQTRTTDGSYVFNKPWGKQWGA
Ga0192955_1020615613300018930MarineHGSASAFVAPGHVAFVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0193266_1017134013300018943MarineEMFRSLLVLLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAAEKADDAKGLPKWNLFRVLPKQEKKQTRTTDGSYVFNKPWGKQWGA
Ga0192985_121134013300018948MarinePRSRSVAPHTAPMLYRVLLVVLAATSASAFVAPGVQSTVSVRTSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQEKLDDAKGLPKWNIFRALPKQTQKGTRSIDGSYRFPKPWGKDWGSQGLTDG
Ga0192985_121408713300018948MarineRFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192985_121746813300018948MarinePRSRSVAPHTAPMLYRVLLVVLAATSASAFVAPGVQSTVSVRTSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQDKADDLKGLPKWNIFRALPKQTNKGTRSIDGSFRFPKPWGKDWGSQGLTDG
Ga0193379_1021418213300018955MarineRNCSEITVEMFRSLLVLLACASASAFVAPGVQANVQTRGSPVMMAKRSGKVNPALFSNGIDKKKLEAVKKAKAAALAQEKADDAKGLPKWNLFRVLPKQEAKKTRTTDGSYVFDKPWGKQWGA
Ga0193326_1008824713300018972MarineMFRSLLVLLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAQEKADDAKGLPKWNLFRVLPKQDKKQTRTTDGSYVFNKPWGKQWGA
Ga0193254_1014808813300018976MarineFGEIAVEMFRSLLVLLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAAEKADDAKGLPKWNLFRVLPKQEKKQTRTTDGSYVFNKPWGKQWG
Ga0192961_1018197613300018980MarineGAIMFRAFLVVLAAASVSAFVAPGVQSTVSVRTSVVTMGAKKGTGKVNPALFATGIDSKKVTKLNAAKAAKAAQEKADDAKGLPKWNLFRALPKQTKQQTRSIDGSFRFPKPWGKGTWD
Ga0192961_1019122813300018980MarineHGDRGIWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0192961_1026309713300018980MarineVAPGVQANVQTRGSAVMMAKGSGKVNPALFATGIDPKRVAALKKAKDAATAQEKADDAKGLPKWNLFRALPKQDKASTRTTDGSFVFKKPWGKQWGA
Ga0192968_1015458913300018981MarineHGERPRFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192968_1017389513300018981MarineHGLAPGVQSSVSVRTSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQEKLDDAKGLPKWNIFRALPKQTQKGTRSIDGSYRFPKPWGKDWGSQGLTDG
Ga0192968_1018381513300018981MarineMGFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192947_1023609813300018982MarineHGERPRFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0193257_1021465913300018997MarineRRACRPTCRCGGGEIAVEMFRSLLVLLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAAEKADDAKGLPKWNLFRVLPKQEKKQTRTTDGSYVFNKPWGKQWGA
Ga0192953_1014133113300019000MarineMGAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0193043_1035145513300019012MarineGIWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNAKKKAAAAQEKLDDDKGLPKWNLFRVLPKQTTKATRSIDGSYRFPKPWGKQWGSQGLSDGP
Ga0192982_1026516613300019021MarineTLSPTIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0192982_1028472113300019021MarineMGAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192982_1034697413300019021MarineMGAPGVQSTVSVRTSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQEKLDDAKGLPKWNIFRALPKQTQKGTRSIDGSYRFPKPWGKDWGSQGLTDG
Ga0192951_1030026413300019022MarineGIWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0192951_1031027113300019022MarineHGEAFQIVDRKMFRLVALFLALVSASAFVAPGHVAFVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192869_1051825213300019032MarineMGVAVFLALVSASAFVAPGQVASVSARSSAVTMGAKKGKVNPALFSSGIDPKRIAALNKAKAEKAKEDSALDKLGMPKWNLFRVLPKQDAKATRTTDGSFKFPKPWGKGYWD
Ga0192945_1021744913300019036MarineHGGIWNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0192945_1028252613300019036MarineGLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192966_1025836013300019050MarineMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0192966_1027392813300019050MarineTWERPRFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0193051_11055113300019084MarineNSCAIMFRAFLVVLAAASVSAFVAPGVQSTVSVRTSVVTMGAKKGTGKVNPALFATGIDSKKVTKLNAAKAAKAAQEKADDAKGLPKWNLFRALPKQTKQQTRSIDGSFRFPKPWGKGTW
Ga0192946_105883313300019103MarineWVLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192972_108008113300019108MarineRREGEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0192975_1025982913300019153MarineGSRFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0206687_107313013300021169SeawaterVAPGVQANVQTRGSAVMMAKGSGKVNPALFATGIDPKRVAALKKAKAEALAQEKADDAKGLPKWNLFLALPKQDKASTRTTDGSFVFKKPWGKQWGA
Ga0063147_10271813300021874MarineLESCEMFRAFLVVLAAASVSAFVAPGVQSNVAVRGSAVTMGAKKSGKVNPALFSNGIDPKKIAVLNAKKKAAAKQEAEDDKKGLPKWNLFRVLPKQTNKATRSIDGSYRFPKPWGKQWGSQGLSDGP
Ga0063143_100919313300021884MarineDLESCEMFRAFLVVLAAASVSAFVAPGVQSNVAVRGSAVTMGAKKSGKVNPALFSNGIDPKKIAALNAKKKAAAKQEAEDDKKGLPKWNLFRVLPKQTNKATRSIDGSYRFPKPWGKQWGSQGLSDGP
Ga0063137_102828413300021892MarineSNRAVMFRAFLVVLAAASVSAFVAPGVQSNVAVRGSAVTMGAKKSGKVNPALFSNGIDPKKIAALNAKKKAAAKQEAEDDKKGLPKWNLFRVLPKQTNKATRSIDGSYRFPKPWGKQWGSQGHERRPLISCFFGIGFFD
Ga0063136_100240513300021896MarineLEMFRSLLVLLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAAEKADDAKGLPKWNLFRVLPKQEKKQTRTTDGSYVFNKPWGKQWGA
Ga0063087_101152813300021906MarineLESCEMFRAFLVVLAAASVSAFVAPGVQSNVAVRGSAVTMGAKKSGKVNPALFSNGIDPKKIAALNAKKKAAAKQEAEDDKKGLPKWNLFRVLPKQTNKATRSIDGSYRFPKPWGKQWGSQGLSDGP
Ga0063085_102289913300021924MarineLESCGMFRAFLVVLAAASVSAFVAPGVQSNVAVRGSAVTMGAKKSGKVNPALFSNGIDPKKIAALNAKKKAAAKQEAEDDKKGLPKWNLFRVLPKQTNKATRSIDGSYRFPKPWGKQWGSQGLSDGP
Ga0247572_119948313300028290SeawaterMFRSLLVVLACASASAFVAPGVQANVQMRGSPVMMAKRSGKVNPALFSNGIDKKKIEAVKKAKAAAAAQEKADDAKGLPKWNLFRVLPKQEKKQTRTTDGSYVFNKPWGKQWGA
Ga0307401_1044677613300030670MarinePRSRSVAPHTAPMLYRILFVVLAATSASAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0307403_1073836713300030671MarineIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0307398_1068743613300030699MarinePTIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0307400_1085016813300030709MarineAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKEKLAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0307388_1110698113300031522MarineNRSIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0307393_114810513300031674MarineLLVVLAAASVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0307385_1037453313300031709MarineSNRAIMFRAFLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0307386_1068674223300031710MarineFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0307396_1056192413300031717MarineRSVAPHTAPMLYRILFVVLAATSASAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0307381_1030235513300031725MarineFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0307381_1031051613300031725MarinePTIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKRV
Ga0307397_1049083513300031734MarineRSPTIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0307394_1038235713300031735MarinePRSVAPHTAPMLYRVLLVVLAATSASAFVAPGVQSTVSVRTSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQDKADDLKGLPKWNIFRALPKQTNKGTRSIDGSFRFPKPWGKDWGSQGLTDG
Ga0307387_1089058813300031737MarineTIYRGAIMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0307387_1091885513300031737MarineRSRSVAPHTVPILYRILFVVLARPPASGFVAPGVQSSVSVRGSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQDKADDLKGLPKWNIFRALPKQTNKGTRSIDGSFRFPKPWGKDWGSQGLTDG
Ga0307384_1061631013300031738MarineFIEALQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKQKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0307384_1063938613300031738MarineLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKISALNARKKAAAAQEKLDDAKGLPKWNLFRVLPKQTAGNTRGIDGSLRFPKPWGKQWGSQGLTDDGEKR
Ga0307395_1055866813300031742MarineMLYRVLLVVLAATSASAFVAPGVQSTVSVRTSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQDKADDLKGLPKWNIFRALPKQTNKGTRSIDGSFRFPKPWGKDWGSQGLTDG
Ga0307389_1104943313300031750MarineMFRALLVVLAAASVSAFVAPGVQSSVSVRGSAVTMGAKKSGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0307404_1039634213300031752MarineFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKEKLAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0307390_1080032313300033572MarineRSRSVDPHTAPMLYRVLFVVLAATSVSAFVAPGVQSSVSVRGSAVTMAAKKTGKVNPALFSNGIDPKKITALNAKKKAAAAQEKLDDAKGLPKWNLFRVLPKQTGGNTRGIDGSFRFPKPWGKQWGSQGLTDDGEKRV
Ga0307390_1086907013300033572MarineFIEAFQIVDRKMFRLVALFLALVSASAFVAPGHVASVSVRGSAVTMGAKKGGVNPALFSNGIDPKKIAALKKEKLAAAAQEKKDDAAGLPKWNLFRVLPKQTKDNTRPIDGSLRFPKPWGKGTWDK
Ga0307390_1090816013300033572MarinePHTAPMLYRVLLVVLAATSASAFVAPGVQSTVPVRGSAVTMGAKKAPPKKSGKVNPALFANGIAPSKIAALKKAKLAKEKQDKADDLKGLPKWNIFRALPKQTNKGTRSIDGSFRFPKPWGKDWGSQGLTDG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.