NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065366

Metagenome / Metatranscriptome Family F065366

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065366
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 73 residues
Representative Sequence MFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKG
Number of Associated Samples 105
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.60 %
% of genes near scaffold ends (potentially truncated) 49.61 %
% of genes from short scaffolds (< 2000 bps) 93.70 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.638 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(46.457 % of family members)
Environment Ontology (ENVO) Unclassified
(68.504 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(58.268 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 0.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.64 %
UnclassifiedrootN/A2.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005280|Ga0065696_1221984Not Available515Open in IMG/M
3300005330|Ga0070690_100932431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum681Open in IMG/M
3300005331|Ga0070670_101005157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum758Open in IMG/M
3300005340|Ga0070689_101038256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum731Open in IMG/M
3300005343|Ga0070687_101259532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300005347|Ga0070668_101171662All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum695Open in IMG/M
3300005353|Ga0070669_101325979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300005365|Ga0070688_100122557All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1743Open in IMG/M
3300005365|Ga0070688_101634028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300005406|Ga0070703_10084018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1091Open in IMG/M
3300005441|Ga0070700_100215731All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1357Open in IMG/M
3300005445|Ga0070708_101629089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum600Open in IMG/M
3300005466|Ga0070685_10407923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum942Open in IMG/M
3300005467|Ga0070706_101364134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum649Open in IMG/M
3300005544|Ga0070686_100489457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum952Open in IMG/M
3300005617|Ga0068859_100577822All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1217Open in IMG/M
3300005719|Ga0068861_100724663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum926Open in IMG/M
3300005841|Ga0068863_101809578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum620Open in IMG/M
3300005843|Ga0068860_101820551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum630Open in IMG/M
3300005843|Ga0068860_101933025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum611Open in IMG/M
3300009101|Ga0105247_10984216All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300009101|Ga0105247_11702156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300009553|Ga0105249_11118298All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum858Open in IMG/M
3300009973|Ga0105136_105999All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300009975|Ga0105129_101255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1085Open in IMG/M
3300009976|Ga0105128_103539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum859Open in IMG/M
3300009977|Ga0105141_120566All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300009981|Ga0105133_113685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum652Open in IMG/M
3300009988|Ga0105035_107237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum931Open in IMG/M
3300009995|Ga0105139_1021638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum967Open in IMG/M
3300010396|Ga0134126_12958951All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300010397|Ga0134124_12445194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300010397|Ga0134124_13222528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300010401|Ga0134121_11578789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum675Open in IMG/M
3300010401|Ga0134121_11691343All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300014326|Ga0157380_11169414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum811Open in IMG/M
3300014326|Ga0157380_13075955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300014968|Ga0157379_10727231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum933Open in IMG/M
3300015270|Ga0182183_1058007All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum591Open in IMG/M
3300015270|Ga0182183_1079089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum535Open in IMG/M
3300015280|Ga0182100_1015519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum912Open in IMG/M
3300015280|Ga0182100_1088475All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum525Open in IMG/M
3300015290|Ga0182105_1036048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum730Open in IMG/M
3300015290|Ga0182105_1071084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300015301|Ga0182184_1012704All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum989Open in IMG/M
3300015309|Ga0182098_1034156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum787Open in IMG/M
3300015315|Ga0182120_1091597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum593Open in IMG/M
3300015316|Ga0182121_1031905All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum892Open in IMG/M
3300015318|Ga0182181_1004187All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1483Open in IMG/M
3300015318|Ga0182181_1079353All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
3300015320|Ga0182165_1117779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300015320|Ga0182165_1120703All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300015324|Ga0182134_1071228All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum667Open in IMG/M
3300015325|Ga0182148_1096441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum591Open in IMG/M
3300015325|Ga0182148_1124608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum535Open in IMG/M
3300015329|Ga0182135_1139737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum525Open in IMG/M
3300015330|Ga0182152_1046419All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum793Open in IMG/M
3300015331|Ga0182131_1129569All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300015331|Ga0182131_1139091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300015332|Ga0182117_1009826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1386Open in IMG/M
3300015334|Ga0182132_1069488All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum722Open in IMG/M
3300015335|Ga0182116_1145077All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
3300015340|Ga0182133_1090625All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum691Open in IMG/M
3300015348|Ga0182115_1127620All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum809Open in IMG/M
3300015348|Ga0182115_1221302All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300015349|Ga0182185_1261104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum528Open in IMG/M
3300015350|Ga0182163_1191021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum641Open in IMG/M
3300015352|Ga0182169_1259715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300015353|Ga0182179_1066136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1023Open in IMG/M
3300015353|Ga0182179_1277963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300015354|Ga0182167_1364640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300017412|Ga0182199_1172250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300017414|Ga0182195_1059234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum836Open in IMG/M
3300017414|Ga0182195_1112939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum660Open in IMG/M
3300017414|Ga0182195_1131708All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum622Open in IMG/M
3300017421|Ga0182213_1256666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300017435|Ga0182194_1060471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum711Open in IMG/M
3300017440|Ga0182214_1095396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300017446|Ga0182217_1059780All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum885Open in IMG/M
3300017446|Ga0182217_1127753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
3300017692|Ga0182210_1158652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300020031|Ga0182119_105163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum561Open in IMG/M
3300025885|Ga0207653_10009028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum3112Open in IMG/M
3300025922|Ga0207646_11272139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum643Open in IMG/M
3300025923|Ga0207681_11282134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum615Open in IMG/M
3300025936|Ga0207670_10981194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum710Open in IMG/M
3300025941|Ga0207711_11001669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum775Open in IMG/M
3300026035|Ga0207703_11313957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum695Open in IMG/M
3300026075|Ga0207708_10112757All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2112Open in IMG/M
3300026095|Ga0207676_10844345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum895Open in IMG/M
3300028049|Ga0268322_1003234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1166Open in IMG/M
3300028050|Ga0268328_1018352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum803Open in IMG/M
3300028050|Ga0268328_1036104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M
3300028053|Ga0268346_1024449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum610Open in IMG/M
3300028054|Ga0268306_1000239All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2204Open in IMG/M
3300028056|Ga0268330_1033382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300028056|Ga0268330_1063261All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300028061|Ga0268314_1026286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum652Open in IMG/M
3300028062|Ga0268342_1038953All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300028139|Ga0268355_1019227All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300028144|Ga0268345_1012605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum649Open in IMG/M
3300028153|Ga0268320_1000112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2411Open in IMG/M
3300028248|Ga0268312_1027109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300028251|Ga0268324_1001848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1078Open in IMG/M
3300028381|Ga0268264_10185770All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1891Open in IMG/M
3300028468|Ga0268317_1002309All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum833Open in IMG/M
3300028471|Ga0268323_1001963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum987Open in IMG/M
3300028474|Ga0268331_1015293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum610Open in IMG/M
3300028523|Ga0268313_1018832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300028526|Ga0268339_1004977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum751Open in IMG/M
3300028526|Ga0268339_1004994All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum750Open in IMG/M
3300028527|Ga0268335_1000256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1859Open in IMG/M
3300032467|Ga0214488_1037459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1054Open in IMG/M
3300032502|Ga0214490_1018541All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1426Open in IMG/M
3300032699|Ga0214494_1002213All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2478Open in IMG/M
3300032759|Ga0314720_1012682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1025Open in IMG/M
3300032760|Ga0314754_1026762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum910Open in IMG/M
3300032791|Ga0314748_1086735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum662Open in IMG/M
3300032822|Ga0314740_1028497All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum835Open in IMG/M
3300032824|Ga0314735_1034839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum942Open in IMG/M
3300032875|Ga0314737_1058211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum666Open in IMG/M
3300032934|Ga0314741_1001685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum3014Open in IMG/M
3300032959|Ga0314738_1100576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300033525|Ga0314758_1032693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1431Open in IMG/M
3300033542|Ga0314769_1273819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere46.46%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere16.54%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere6.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.30%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.51%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated4.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.15%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.36%
Switchgrass Rhizosphere Bulk SoilHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere Bulk Soil0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005280Switchgrass rhizosphere microbial community from Michigan, USA - East Lansing bulk soilHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009977Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009988Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020031Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028053Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028061Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028139Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028144Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028153Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028248Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028251Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028468Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028474Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028523Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028526Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028527Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032759Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032760Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032824Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032875Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032934Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032959Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033525Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0065696_122198423300005280Switchgrass Rhizosphere Bulk SoilMFVVQLLGPSGARWKSSMDVTVVVELASRIQDLVQNESSELLAHSVDPISRVTFIPI*
Ga0070690_10093243113300005330Switchgrass RhizosphereMFVVKLLGPSGLRWKYSMDVTVVVELASRIQDLVQNESGELLAHNVDPIGRITFIPHLTHLSFRKKRIDILTSCALV*
Ga0070670_10100515723300005331Switchgrass RhizosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKD*
Ga0070689_10103825623300005340Switchgrass RhizosphereMLAVQLLVPSGCRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL*
Ga0070687_10125953213300005343Switchgrass RhizosphereMLFQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL*
Ga0070668_10117166213300005347Switchgrass RhizosphereMFVVQLLVPSGARWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL*
Ga0070669_10132597913300005353Switchgrass RhizosphereMLAVQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL*
Ga0070688_10012255733300005365Switchgrass RhizosphereMFAVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL*
Ga0070688_10163402823300005365Switchgrass RhizosphereMLFQLLVPSGGRWKSSIDVTVVVELTSRIQDLAQNKSGELLAHGVDPISRVTFIPHLRHLSFRK
Ga0070703_1008401813300005406Corn, Switchgrass And Miscanthus RhizosphereMLAVQLLVPSGGRWKSCIDVTVVVELTSRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL*
Ga0070700_10021573113300005441Corn, Switchgrass And Miscanthus RhizosphereMFVVQLLVPSGGRWKYSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL*
Ga0070708_10162908913300005445Corn, Switchgrass And Miscanthus RhizosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPVSRVTFITHLRHLLFRKKGLTSCVLVQL*
Ga0070685_1040792313300005466Switchgrass RhizosphereMFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCVLVQL*
Ga0070706_10136413413300005467Corn, Switchgrass And Miscanthus RhizosphereMLAVQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL*
Ga0070686_10048945713300005544Switchgrass RhizosphereMFVVQLLVPSGARWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL*
Ga0068859_10057782213300005617Switchgrass RhizosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFITHLRHLLFRKKGLTSCVLVQL*
Ga0068861_10072466313300005719Switchgrass RhizosphereMFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL*
Ga0068863_10180957823300005841Switchgrass RhizosphereMFVVQLLGPSGARWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRK
Ga0068860_10182055113300005843Switchgrass RhizosphereMFVVQLLGPSGARWKSSMDVTVVVELASRIQDLVQNESGELLAHDVDPIGIITFIPHLSHLSFRKKGLIY*
Ga0068860_10193302513300005843Switchgrass RhizosphereMFVVQLLVPSGARWKSSMDVTDVVELASRIQDLVQNESGELLAHGVDLISRVTFIPHLRHLSFRKKRINIMCVST
Ga0105247_1098421613300009101Switchgrass RhizosphereMLAVQLLVPLGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL*
Ga0105247_1170215613300009101Switchgrass RhizosphereHVCSPTTGPRPSGGRWKSSIDVTVVVELASRIQDLIQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL*
Ga0105249_1111829813300009553Switchgrass RhizosphereMFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKRINIMCVSTIMKIY*
Ga0105136_10599913300009973Switchgrass AssociatedMFVVQLLVPSGGRWKSSMDVTVMVELASRSQDLVQNESGELLTHSVDPISSVTFIPHL
Ga0105129_10125513300009975Switchgrass AssociatedMLAVQLLVPSGGRWKSSIDVTVVVELASRIQDLIQNESGELLAHGVDPISRVTFIPHLKHLSFRKKGLTSCALVQL*
Ga0105128_10353913300009976Switchgrass AssociatedMFIVQLLGPSGRRWKSSLDVIVVVELASRIQDLVQNESGELLADGVDPIGRITFIPYLRRLSFMKKGLIY*
Ga0105141_12056623300009977Switchgrass AssociatedMLAVQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLS
Ga0105133_11368513300009981Switchgrass AssociatedMFIVQLLGPSGRRWKSFMDVTVVVELASRIQDLVQNESGELLAHGIDPISRVTFIPHSRHLSFR
Ga0105035_10723723300009988Switchgrass RhizosphereMFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL*
Ga0105139_102163833300009995Switchgrass AssociatedMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPIIRVTFITHLRHLLFRKKGLTSCALVQL*
Ga0134126_1295895113300010396Terrestrial SoilMFIVQLLGLSGHRCESSMDVTVVVELASRIWDLPQNESSKMLAHGVNPIGRVNFIRDSTHLSF*
Ga0134124_1244519413300010397Terrestrial SoilMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKK
Ga0134124_1322252813300010397Terrestrial SoilMFVVQLLGPSGRRWKSTKNVTVVVELASRIQDLVQNESGELLAHGVDPIGRINFIRDLTHLSFRKKKTDILVSLC*
Ga0134121_1157878923300010401Terrestrial SoilMFVVQLLGPSGCRWKSSMDVTVVVELASKIQDLIQNESGELLAHGIDPIGRITFIPHLRHLSFR
Ga0134121_1169134323300010401Terrestrial SoilMFVVQLLGPSGRRWKSSKNVTVVVELASRIQDLVQNESGELLAHGVDPIDRITFIPESSHLLF
Ga0157380_1116941413300014326Switchgrass RhizosphereMFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHSVDPISRVIFIPHLRHLSFRKKRINIMCVSTIMKMY*
Ga0157380_1307595513300014326Switchgrass RhizosphereMFVVQLLGPSGRRWKSYMDVTVVVELASRIQDLVQNESGELLAHGVDPIGRITFIPHLSHLSFRKKRLIY*
Ga0157379_1072723123300014968Switchgrass RhizosphereMFIVKVTGISRHRSGHSTDMTVVVELASWIQDLVQKESSELLAHGIDPIGRITFIPHLRHLSFKKKGLIY*
Ga0182183_105800713300015270Switchgrass PhyllosphereMFIVQLLGPSGRRCESSMDVTVMVELASRIQDLPQNESGQLLAHGINPIGRVNFIHDSTHLPF*
Ga0182183_107908913300015270Switchgrass PhyllosphereKYPNNKTSRLEIFTNVQFMFIVQLLAPLGRRWKSFMDVTVVVELASRIQDLVQNEPGELLAHGVDTIGRINFIRDSTHLSFRKKGLIYLFHRVSIIRKIY*
Ga0182100_101551923300015280Switchgrass PhyllosphereMFIVQLLGLSGCRWKSSMDVTFMVELASRIQDLVQNESGELLAHDVYSIGRITFIPDATHLSFRKKLLIY*
Ga0182100_108847513300015280Switchgrass PhyllosphereYIYKYTNNKTSRLKIFTNVQVMYIVQLQGPSRHRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDLIGRITFIPHLRHLSFRKK*
Ga0182105_103604813300015290Switchgrass PhyllosphereMCIVQPLSPSGRRWKSSMDVTVVVELASRIQDLVQNESDELLAHGVDPIGRITFIPDATHLSFSKKGLIY*
Ga0182105_107108413300015290Switchgrass PhyllosphereMKALHLEIFTNVQIMFVVQLLGPSGARWKSSIDVTVVVELASRIQDLVQNKSDELLAHGVDPISRITFIPHLRHLSFKKK*
Ga0182184_101270413300015301Switchgrass PhyllosphereMKALHLEIFTNVQVMFVVQLLGPSGRRGKSSIHVTVMVELTSRIQDLVQNESGELLAHGVDPIGRITFIPHLSHLSFRKKRTDILTSCALV*
Ga0182098_103415613300015309Switchgrass PhyllosphereYKYTNNRTSCLEIFTNVQVMFIVQLLGPSLLRCKSSMHVTVVVELASRIQDLIQNESGELIAHGVDPIGRINFIRDSTHLSFRKKGLIF*
Ga0182120_109159713300015315Switchgrass PhyllosphereMFVVQLLGPLGARWKSSIDVTVMVQLASRIQDLVQNESGELLAHGVDPIGRITFILESTHLSFRKKGLIY*
Ga0182121_103190523300015316Switchgrass PhyllosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFITHLRHLLFRKKD*
Ga0182181_100418713300015318Switchgrass PhyllosphereMFIVQLLAPLGRRWKSFMDVTVVVELASRIHDLVQNESDELLAHDVDPIGRINFICDSTHLSFRKKGLIY*
Ga0182181_107935313300015318Switchgrass PhyllosphereTSHVCSPTTSPSGRRWKSSMDVTDMVELASRIQDLIQNESGELLAHGIDSIGRITFIPHLRHLLFRKKELIY*
Ga0182165_111777913300015320Switchgrass PhyllosphereCLKIYTNVQVMCIVQLLSPSGRRWKSSMDVTIMVELTSRIQDLVQNESGEHLAHGVDPIGRITFSPPFEPSII*
Ga0182165_112070323300015320Switchgrass PhyllosphereGPSGARWKSSMDVTVVVELASRIQDLVQNKSGELLTHGVDPISRVTFIPHLRHLSFRKKGLIY*
Ga0182134_107122813300015324Switchgrass PhyllosphereVQLLGPSRRRWKSSMDVTVVVELASRIQDLVQNEPGELLAHGVDPIGGITFIPESSHLSFRKK*
Ga0182148_109644113300015325Switchgrass PhyllosphereYIYKYTNIKASCLEIFTNIQVMFVVQLLGPSGARWKSTMDVTVVVELASRIQDLVQNESGELLAHGVDPIGRVTFIPHSRHLSFRKKGLTSCALV*
Ga0182148_112460813300015325Switchgrass PhyllosphereMFVVQLLGPSGRRWKSSIDVTVVVELTSRIQDLVQNESGELLAHGVDPINRVTFIPHLRHLSFRKKRLTSCALVQL
Ga0182135_113973713300015329Switchgrass PhyllosphereMFVVQLLGPSGARWKSYMNVTVVVELASRIQDLVQNESGELLAHDVDPIGRVTFIPHWRHLSFRKKGLTSRVL*
Ga0182152_104641913300015330Switchgrass PhyllosphereVQFMFIVQLLGPSGRRWKSFMDVTFMVELASRIQDLRQNEPCELHAHGVNPIDIVNFVPDLTHLSFRKKGLIF*
Ga0182131_112956913300015331Switchgrass PhyllosphereMFIVQLLGPSGRRWKSSMDVTVMVELASRIQDLIQNESGELLAHGVNPISRVTFIPHLRHLSFRKKRLIY*
Ga0182131_113909123300015331Switchgrass PhyllosphereMFVVQLLVPSGGRCKSSMNVTVVVELASRIQDLVQNESGKLLAHGVDPISRVTFIPHLRH
Ga0182117_100982613300015332Switchgrass PhyllosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNETGKLLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL*
Ga0182132_106948813300015334Switchgrass PhyllosphereMFIVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGEPLAHGVDPISRVTFIPHLRHLSFRKKRLTSCALVQL*
Ga0182116_114507713300015335Switchgrass PhyllosphereKYQGITLKIYTNLQVMSVVKLLGPSGRRWKSSMDVAVVVELASRIQDLVQNESGELLAHGVDPIGRVIFVRHSRHLLFRKK*
Ga0182133_109062513300015340Switchgrass PhyllosphereNVQVMFVVQLLGPSGRRWKSSMDVTVVVELASRILDLVQNESGELLAHGVDPIGRINFIRDWTHLSFRKKGLIYLFHRVSIIRKIY*
Ga0182115_112762013300015348Switchgrass PhyllosphereQLLGPSGRRWKSSMDVTVVVELASKIQDLVQNESGELLTHGVDPIGRINFICDSTHLSFRKKGLIY*
Ga0182115_122130213300015348Switchgrass PhyllosphereSCLEIFTNVQVMFIVQLLGPSGCQWKSSMDVTIMVELTSRIQDLVQNESGELLAHGVDPIGRINFIHNSTHLSFRKKGMIY*
Ga0182185_126110413300015349Switchgrass PhyllosphereYTNLQVMFEVKLLGPSGRRWKSSMDMTVVVELVSRIQDLVQNESGELLAHSVDPIGRVTFVRHSRHL*
Ga0182163_119102113300015350Switchgrass PhyllosphereMFVVQLLGPSGDRWKYSMDVTVVVELASRIQDLVQNKSDELLAHGVDPISRITFIPHLRHLSF
Ga0182169_125971513300015352Switchgrass PhyllosphereVMFVVQLLGPSGARWKSSMDVTVVVELASRIQNLVQNESDELLAHDVDPIGRINFICDSTHLSFRKKGLIF*
Ga0182179_106613613300015353Switchgrass PhyllosphereLEIFTNVQVMFVVQLLGPSGHRWKSPMDVTVVVEFTSRIQDLVQNESGELLAHGIDPIGRITFIPHLRHLSFRKKD*
Ga0182179_127796313300015353Switchgrass PhyllosphereYIYKYTNIKASRLEILSNVQVMFIVQLLVPSGARWKSSMDVTIVVELSSRIQDLVQNESGELLAHGVDPISRLTFIPHLRHISFRKK*
Ga0182167_136464023300015354Switchgrass PhyllosphereMFVVQLLDPSGHRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLS
Ga0182199_117225013300017412Switchgrass PhyllosphereNNKTSRLEIFTNVQFMFIVQLLAPLGRRWKSFMDVTVVVELASRIQDLVQNESDELLAHDVDPIGRINFICDLTHLSFRKKGLIF
Ga0182195_105923423300017414Switchgrass PhyllosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFITHLRHLLFRKKRINIMCVSTIMKIY
Ga0182195_111293913300017414Switchgrass PhyllosphereTNNKTSHLEISTNVQVMFIVQLLCPSGRRWKSSMEVTVVVELASRIQDLPHNETCELLAHGINPIGRVNFVPDSTHLLFWKKGLIY
Ga0182195_113170813300017414Switchgrass PhyllosphereQVIFVVQLLGPSGARWKSSIDVTVVVELASWIQDLVQNESSELLAHGVDPIGRGTFIAHSRHLSFRKKRLTSCAL
Ga0182195_120099023300017414Switchgrass PhyllosphereMFIVQLLGPSGRRWKSSMDVTIIVELASRIQDLVQNESGELLAHGVDPIGRI
Ga0182213_125666613300017421Switchgrass PhyllosphereMFIVQLLCPSGRRWKSSMDVTVVVELASRIQDLVQNESDELLAHDIDPIGRINFIRDSTHLSFRKK
Ga0182194_106047113300017435Switchgrass PhyllosphereMFVVQLLGPSGARWKSSMDVTIVVELASRIQDLVQNESGELLTHGVDPIGTVTFVRHSFETSII
Ga0182214_109539613300017440Switchgrass PhyllosphereASRLEIFTNVQVMFVVQLLVPSGARWKSSIDVTVVVELASTIQDLVQNESGELLAHGVDPISRVTFIPHLIHLSFRKKGLSSCALVQL
Ga0182217_105978013300017446Switchgrass PhyllosphereLEIFTNVQVMFVVQLLGPSGARWKSSIDVTVVVELASRIQDLVQNESDELLAHDVDPIGRINFICDSTHLSFRKKGLIF
Ga0182217_112775313300017446Switchgrass PhyllosphereMFIVQLLGPSGRRWKSFMDVIVMVELASKIQNLVQNESDELLAHDVDPIGRINFI
Ga0182210_115865213300017692Switchgrass PhyllosphereMDVTIMVELTSRIQDLVQNESGELLAHGVDPIGRITFIPIXDIYHLGKKDXYINIMCVSIIMKMY
Ga0182216_120766913300017693Switchgrass PhyllosphereMFIVQLLGLSGRRCESSMDVTIMVELASRIWDLVQNESGELLAQGVDPIDRITF
Ga0182119_10516313300020031Switchgrass PhyllosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFITHLRHLLFRKKGLTSCVLVQ
Ga0207653_1000902823300025885Corn, Switchgrass And Miscanthus RhizosphereMLAVQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL
Ga0207646_1127213923300025922Corn, Switchgrass And Miscanthus RhizosphereMFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL
Ga0207681_1128213423300025923Switchgrass RhizosphereMFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKG
Ga0207670_1098119413300025936Switchgrass RhizosphereMLAVQLLVPSGCRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKD
Ga0207711_1100166913300025941Switchgrass RhizosphereMLAVQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKAL
Ga0207703_1131395723300026035Switchgrass RhizosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLTHGVDPISRVTFITHLRHLLFRKK
Ga0207708_1011275723300026075Corn, Switchgrass And Miscanthus RhizosphereMLAVQLLVPSGGRQKYSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL
Ga0207676_1084434513300026095Switchgrass RhizosphereMLAVQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL
Ga0268322_100323413300028049PhyllosphereMFIVQLLGPLGRRWKSFMDVTVVVELASRIQDLVQNESDELLAHDVDPIGRINFICDSTHLSFRKKGLIF
Ga0268328_101835213300028050PhyllosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFITHLRHLLFRKKGLTSCVLVQL
Ga0268328_103610423300028050PhyllosphereVQLLGPSGRRKKSSMDVTVVVELASRIQDLVQNESGELLAHDVDPIGRINFIHDSTHLSFRKKGPVILISSC
Ga0268346_102444913300028053PhyllosphereLGPLGRRWKSFMDVTVVVELASRIQDLVQNESDELLAHDVDPIGRINFICDSTHLSFRKKGLIF
Ga0268306_100023913300028054PhyllosphereMLAVQLLVPSGGRRKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL
Ga0268330_103338213300028056PhyllosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFITHLRHLLFRKKGLTSCVL
Ga0268330_106326113300028056PhyllosphereMFVVQLLGPSGARWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPIGRVTFIPHS
Ga0268314_102628613300028061PhyllosphereMFVVQLLGPSGRQWKSSMDVTVVVELASRIQDLVQNESDELLAHGVDPIGRITFIPYLSHLSFRKKGLIY
Ga0268342_103895313300028062PhyllosphereMFIVQLLGPSGRRWKSFMDVTVMVELASRIQDLVQNESDELLAHDVDPIGRINFICDSTHLSFRKK
Ga0268355_101922713300028139PhyllosphereKFIVQLLGPSGCQWKSSMDVTIMVELTSRIQDLVQNESGELLAHGVDPIGRINFIHNSTHLSFRKKGMIY
Ga0268345_101260523300028144PhyllosphereMLAVQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGIDPISRVTFIPHLRHLSFRKKG
Ga0268320_100011223300028153PhyllosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL
Ga0268312_102710923300028248PhyllosphereMFIVQLLGPSGRRKKSSMDVTVVVELASRIQDLVQNESGELLAHDVDPIGRINFIHDSTHLSFRKKGH
Ga0268324_100184823300028251PhyllosphereMFIVQLLGPLGRRWKSFMDVTVVVELASRIQDLVQNKSGGLLAHGVDPIGRITFIPESSYLSFRKKGLIY
Ga0268264_1018577023300028381Switchgrass RhizosphereVQVMFAVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPYLRHLSFRKKGLTSCALVQL
Ga0268317_100230913300028468PhyllosphereIFTNVQVMLAVQLLVPSGGRRKSSIDVTVMVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTFCALVQL
Ga0268323_100196323300028471PhyllosphereFTNVQVMFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL
Ga0268331_101529323300028474PhyllosphereMLAVQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCVF
Ga0268313_101883213300028523PhyllosphereMFVVQLLVPSGGRWKSSMDVTVMVELASRIQDLVQNESGDQLAHGVDPINRVTFIPHL
Ga0268339_100497713300028526PhyllosphereMKALRLEIFTNVQIMFVVQLLGPSGRQWKSSMDVTAVVELASRIQDLVQNESGELLAHGVDPIGRIIFIPYLSHLSFRKKGLIY
Ga0268339_100499413300028526PhyllosphereMLFQLLVPSGGRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFITHLRHLLF
Ga0268335_100025613300028527PhyllosphereNVQVMFIVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKGLTSCALVQL
Ga0214488_103745913300032467Switchgrass PhyllosphereMLAVQLLVPSGCRWKSSIDVTVVVEFASRIQDLVQNESGELFAHGVDPISRVTFILHLRHLSFRKKALTLCALIQL
Ga0214490_101854123300032502Switchgrass PhyllosphereMFIVQMLSPSRRQSGYSIDVTVMVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRK
Ga0214494_100221313300032699Switchgrass PhyllosphereMLAVQLLVPSGCRWKSSIDVTVVVEFASRIQDLVQNESGELFAHGVDPISRVTFIPHLRHLSFRKKTLTLCALVQL
Ga0314720_101268223300032759Switchgrass PhyllosphereMLAVQLLVPSGCRWKSSIDVTVVVEFASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKTLTLCALVQL
Ga0314754_102676213300032760Switchgrass PhyllosphereVMFIVQLLGPSEHRWKSSMDVTVVVELASRIQDLIQNESGELLAHGIDPIGRITFISEPSHLSLRKNGLIY
Ga0314748_108673523300032791Switchgrass PhyllosphereMFVVQLLVPSGGRWKSSMDAIVVVELASRIQDFVQNESGELLAHGVDPISRVTFITHLRHLLFRKKGLTSCVLVQL
Ga0314740_102849713300032822Switchgrass PhyllosphereMFKNMYKCTSHVCCPTTGPSGGQWKSSMDVTVVVELASRIQDLVQNESGELLTHGVDPISRVTFIPHLRYISFRKKGLIY
Ga0314735_103483913300032824Switchgrass PhyllosphereMFVVQLLVPSGGRWKSSMDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHISFRKKKN
Ga0314737_105821113300032875Switchgrass PhyllosphereMFVVQLLGPSGARWKSSMDVTVVVELASRIQDLVQNESDELLAHGVDPISRVTFIPHLRHLSFRKKRINIMCVSTIMKIY
Ga0314741_100168523300032934Switchgrass PhyllosphereMLAVQLLVPSGCRWKSSIDVTVVVEFASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL
Ga0314738_110057613300032959Switchgrass PhyllosphereVQVMFVVQLLVPSGGRWKSSMNVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIRHLRHLSFRKKGLTSCALVQL
Ga0314758_103269323300033525Switchgrass PhyllosphereKIFKNVQVMLAVQLLVLSGCRWKSSIDVTVVVELASRIQDLVQNESGELLAHGVDPISRVTFIPHLRHLSFRKKALTLCALVQL
Ga0314769_127381913300033542Switchgrass PhyllosphereMFVVQLLGPSGARWKSSMDVTVVVELASRIQDLVQNESGELLTHGVDPISRVTFIPHLRYISFRKKG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.