NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065397

Metagenome / Metatranscriptome Family F065397

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065397
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 88 residues
Representative Sequence VVVRVFVSRLYSPCKVSLVMAIPKTTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDKERFASAEC
Number of Associated Samples 75
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 59.06 %
% of genes near scaffold ends (potentially truncated) 18.11 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(34.646 % of family members)
Environment Ontology (ENVO) Unclassified
(59.055 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(75.591 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.23%    β-sheet: 0.00%    Coil/Unstructured: 96.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10596147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis601Open in IMG/M
3300018934|Ga0193552_10154026All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis654Open in IMG/M
3300018934|Ga0193552_10233750All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis513Open in IMG/M
3300023553|Ga0247524_111522All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis647Open in IMG/M
3300023553|Ga0247524_113764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis563Open in IMG/M
3300023556|Ga0247519_112468All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis695Open in IMG/M
3300023556|Ga0247519_117687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis514Open in IMG/M
3300023556|Ga0247519_117867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis510Open in IMG/M
3300023556|Ga0247519_118064All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis506Open in IMG/M
3300023557|Ga0247521_115530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis588Open in IMG/M
3300023557|Ga0247521_115990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis576Open in IMG/M
3300023558|Ga0247526_116203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis578Open in IMG/M
3300023560|Ga0247514_116993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis649Open in IMG/M
3300023561|Ga0247518_110084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis994Open in IMG/M
3300023561|Ga0247518_112355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis838Open in IMG/M
3300023561|Ga0247518_117970All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis595Open in IMG/M
3300023562|Ga0247516_121509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis523Open in IMG/M
3300023563|Ga0247530_115770All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis552Open in IMG/M
3300023564|Ga0247515_122784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis525Open in IMG/M
3300023664|Ga0247527_113178All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis556Open in IMG/M
3300023668|Ga0247525_116094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis579Open in IMG/M
3300023680|Ga0247528_112909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis553Open in IMG/M
3300023686|Ga0247520_112421All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis714Open in IMG/M
3300023688|Ga0247522_116306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis586Open in IMG/M
3300023690|Ga0247512_122355All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis522Open in IMG/M
3300030556|Ga0257208_1101580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis810Open in IMG/M
3300030556|Ga0257208_1190416All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis596Open in IMG/M
3300030557|Ga0257198_1149282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis536Open in IMG/M
3300030558|Ga0257197_1081158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis565Open in IMG/M
3300030558|Ga0257197_1086014All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis547Open in IMG/M
3300030559|Ga0257205_1078160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis682Open in IMG/M
3300030559|Ga0257205_1153346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis527Open in IMG/M
3300030562|Ga0257207_1114252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis514Open in IMG/M
3300030611|Ga0257182_1263093All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis555Open in IMG/M
3300030748|Ga0074043_10053185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis666Open in IMG/M
3300030748|Ga0074043_11499911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis523Open in IMG/M
3300030748|Ga0074043_11506852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis607Open in IMG/M
3300030748|Ga0074043_11560450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis597Open in IMG/M
3300030775|Ga0074021_1851890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis615Open in IMG/M
3300030776|Ga0075396_1020577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis563Open in IMG/M
3300030783|Ga0102752_1648764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis578Open in IMG/M
3300030785|Ga0102757_11450425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis508Open in IMG/M
3300030839|Ga0073999_11086310All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis642Open in IMG/M
3300030907|Ga0074013_10102071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis909Open in IMG/M
3300030931|Ga0074006_11532239All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis592Open in IMG/M
3300030931|Ga0074006_11602456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis571Open in IMG/M
3300030933|Ga0074039_10036580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis542Open in IMG/M
3300030933|Ga0074039_11641338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis588Open in IMG/M
3300030949|Ga0074031_1124530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis689Open in IMG/M
3300030949|Ga0074031_1949412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis627Open in IMG/M
3300030949|Ga0074031_1962797All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis542Open in IMG/M
3300030967|Ga0075399_10005258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis690Open in IMG/M
3300030980|Ga0074027_10019700All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis617Open in IMG/M
3300030980|Ga0074027_10068542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis671Open in IMG/M
3300030980|Ga0074027_11291242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis544Open in IMG/M
3300030981|Ga0102770_10017535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis636Open in IMG/M
3300030999|Ga0074019_11217529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis684Open in IMG/M
3300030999|Ga0074019_11228044All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis534Open in IMG/M
3300030999|Ga0074019_11247048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis787Open in IMG/M
3300031008|Ga0074038_10062712All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis683Open in IMG/M
3300031008|Ga0074038_12004721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis654Open in IMG/M
3300031013|Ga0102753_1418288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis540Open in IMG/M
3300031015|Ga0138298_1256042All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis570Open in IMG/M
3300031029|Ga0074012_10074963All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis621Open in IMG/M
3300031030|Ga0074030_10145031All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis533Open in IMG/M
3300031030|Ga0074030_11082679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis513Open in IMG/M
3300031035|Ga0074026_10090000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis564Open in IMG/M
3300031035|Ga0074026_10156317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis575Open in IMG/M
3300031035|Ga0074026_10227505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis525Open in IMG/M
3300031039|Ga0102760_10031336All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis573Open in IMG/M
3300031039|Ga0102760_10039195All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis513Open in IMG/M
3300031039|Ga0102760_10980596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis547Open in IMG/M
3300031047|Ga0073995_10747107All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis522Open in IMG/M
3300031050|Ga0074028_10045722All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis682Open in IMG/M
3300031050|Ga0074028_10071233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis519Open in IMG/M
3300031051|Ga0074029_1721683All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis544Open in IMG/M
3300031064|Ga0102767_10008855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis757Open in IMG/M
3300031064|Ga0102767_10067417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis698Open in IMG/M
3300031231|Ga0170824_104919422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis691Open in IMG/M
3300031231|Ga0170824_109326148All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis522Open in IMG/M
3300031231|Ga0170824_115092883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis507Open in IMG/M
3300031231|Ga0170824_127235466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis705Open in IMG/M
3300031446|Ga0170820_11608224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis570Open in IMG/M
3300031474|Ga0170818_115141087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis630Open in IMG/M
3300031591|Ga0310116_118085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis596Open in IMG/M
3300031614|Ga0310103_125481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis733Open in IMG/M
3300031614|Ga0310103_132967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis616Open in IMG/M
3300031614|Ga0310103_135986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis580Open in IMG/M
3300031614|Ga0310103_142050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis523Open in IMG/M
3300031615|Ga0310107_127935All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis638Open in IMG/M
3300031633|Ga0310108_122591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis566Open in IMG/M
3300031634|Ga0310106_114907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis540Open in IMG/M
3300031635|Ga0310115_123175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis606Open in IMG/M
3300031635|Ga0310115_130490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis503Open in IMG/M
3300031636|Ga0310113_117017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis775Open in IMG/M
3300031666|Ga0310105_114094All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis716Open in IMG/M
3300031666|Ga0310105_116405All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis631Open in IMG/M
3300031666|Ga0310105_120079All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis533Open in IMG/M
3300031667|Ga0310111_118167All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis869Open in IMG/M
3300031678|Ga0310114_114105All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis754Open in IMG/M
3300031678|Ga0310114_123693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis534Open in IMG/M
3300031686|Ga0310119_125618All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis622Open in IMG/M
3300031686|Ga0310119_133437All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis527Open in IMG/M
3300031815|Ga0316045_120924All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis624Open in IMG/M
3300031816|Ga0316042_119820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis731Open in IMG/M
3300031828|Ga0316043_129944All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis545Open in IMG/M
3300032169|Ga0257195_10327102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis558Open in IMG/M
3300032169|Ga0257195_10368847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis530Open in IMG/M
3300032468|Ga0214482_1079147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis629Open in IMG/M
3300032468|Ga0214482_1082112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis616Open in IMG/M
3300032515|Ga0348332_10091252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis1009Open in IMG/M
3300032515|Ga0348332_12723663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis524Open in IMG/M
3300032515|Ga0348332_13865804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis720Open in IMG/M
3300032550|Ga0321340_1043366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis631Open in IMG/M
3300032551|Ga0321339_1121908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis585Open in IMG/M
3300032551|Ga0321339_1125536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis574Open in IMG/M
3300032551|Ga0321339_1132104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis556Open in IMG/M
3300032591|Ga0214484_1064065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis777Open in IMG/M
3300032698|Ga0214485_1092317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis570Open in IMG/M
3300032714|Ga0314686_10622113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis523Open in IMG/M
3300032739|Ga0315741_11033115All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis733Open in IMG/M
3300032739|Ga0315741_11511406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis600Open in IMG/M
3300032756|Ga0315742_10588535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis972Open in IMG/M
3300032756|Ga0315742_11083762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis806Open in IMG/M
3300032756|Ga0315742_11377854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis742Open in IMG/M
3300032756|Ga0315742_11651741All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis695Open in IMG/M
3300032756|Ga0315742_12204779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea sitchensis620Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil34.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil34.65%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil10.24%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated8.66%
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere6.30%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.36%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.36%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300023553Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023556Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023557Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023558Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023560Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023561Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023562Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023563Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023564Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023664Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023668Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023680Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023686Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023688Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023690Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030556Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-3E (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030557Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-2N (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030558Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-2E (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030559Metatranscriptome of plant litter fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030562Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF3-2W (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030611Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP1-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030748Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030775Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030776Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030783Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030785Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030839Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030907Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030931Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFB (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030933Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030949Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030967Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030980Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030981Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030999Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031008Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031013Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 4A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031015Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031029Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031030Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031035Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031039Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031047Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031050Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031051Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031064Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031591Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031614Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031615Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031633Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031634Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031635Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031636Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031666Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031667Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031678Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031686Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031815Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031816Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031828Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032169Metatranscriptome of plant litter fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP2-LITTER (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032468Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032550Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1059614713300008832MarineMAISKTTITTDRKWLEIAPPRRVCAGRRRHLEKTLRPIAEERSLDNGELMDGLRPTFPAVSGFKAEGDTERFASAEC*
Ga0193552_1015402613300018934MarineVQIRVFVSILYSPDNLTLKMAIQKTTVTTDRKWLEIAPPRRLCAGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGLRAEGDNERFASGEC
Ga0193552_1023375023300018934MarineMAIPKTTVTTDKKWLEIAPPRKICVGRRRPSEKTLRPIAEECSLSDGELTDGLRPTFPAVSGFKAEGDNERFPSAEC
Ga0247524_11152223300023553SoilVQVRVFVSRLFSPDNLTLVMAIPKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIAEERSVSNGELMEGLRPSFPAVSGFKAEDDNERFSSAQC
Ga0247524_11376413300023553SoilVQVRVFVSRLYSPDKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRRRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFNAEDDNERFASAEC
Ga0247519_11246813300023556SoilVQVRVFVSRLYSPHKLTLVMAILMTKATTDMRWTEVAPPRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAVDDNERFASAEC
Ga0247519_11768713300023556SoilMAILKTTATTDMRWMEIAPPRRVCMGRRRPVEKTLWPIAEERSLSNGELMDGLRPTFPAVSGFNAEGDNERFASAEF
Ga0247519_11786713300023556SoilVQVRVFVSRLYSPDKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRRRPLEKTLRPIAEERSLSNGELMDGLRPTFSAVSGFNAEDDNERFASAEC
Ga0247519_11806413300023556SoilMAILKTTANTDMRWMEIAPPRRVCMGRRRPVEKALRPIAEERSLSNGELMDGLCPTFPAVIGFKAEGDNERFASAEY
Ga0247521_11553023300023557SoilVQVRVFVSTLYSPHKLTLVLAIPMTTATTDMRWIEIAPPQRVFMGRRRALEKTLRPITEERSLSNGELMDGLRPTFPSVSGFKAEDDNERFASAEC
Ga0247521_11599013300023557SoilVQVRVFVSRLYSPHKLTLVMAILMTKATTDMRWTEVAPPRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAADDNERFASAEC
Ga0247526_11620313300023558SoilVQVRVFVSRLYSPDKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0247514_11699323300023560SoilVQVRVFVSRLFSPDNLTLVMAITKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIAEERSVSNGELMEGLRPSFPAVSGFKAEGENERFSSAQC
Ga0247518_11008413300023561SoilLYFPDKLTLVMAILKTTATTDMRWMEIAPPRRVCMGRRRPVEKTLWPIAEERSLSNGELMDGLRPTFPAVSGFNAEGDNERFASAEF
Ga0247518_11235523300023561SoilVQVRVFVSRLFSPDNLTLVMAIPKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIAEERSVSNGELMEGLRPSFPAVSGFKAEGDNERFSSAEC
Ga0247518_11797013300023561SoilVQVRVFVSTLYSPHKLTLVLAIPMTTATTDMRWIEIAPPQRVFMGRRRALEKTLRPITEERSLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0247516_12150913300023562SoilVQVRVFVSRLYSPHKLTLVMAILMTKATTDMRWTEVAPPRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0247530_11577013300023563SoilVQVRVFVSRLFSPDNLTLVMAITKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIAEERSVSNGELMEGLRPSFPAVSGFKAEDDNERFSSAQC
Ga0247515_12278413300023564SoilAILKTTATTDMRWMEIAPPRRVCMGRRRPVEKTLWPIAEERSLSNGELMDGLRPTFPAVSGFNAEGDNERFASAEF
Ga0247527_11317813300023664SoilVQVRVFVSRLFSPDNLTLVMAITKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIAEERSVSNGELMEGLRPSFPAVSGFKAEGDNERFSSAQC
Ga0247525_11609413300023668SoilVQVRVFVSTLYSPHKLTLVMAILMTKATTDMRWTEIAPLRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFNAEDDNERFASAEC
Ga0247528_11290913300023680SoilLYFPDKLTLVMAILKTTATTDMRWMEIAPPRRVCMGRRRPVEKTLWPIAEERSLSNGELMDGLRPTFPAVSGFNAEGDNERFASAEC
Ga0247520_11242123300023686SoilVQVRVFVSRLFSPDNLTLVMAIPKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIAEERSVSNGELMEGLRPSFPAVSGFKAKDDNERFSSAQC
Ga0247522_11630613300023688SoilVQVRVFVSRLYSPDKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEDDNEIFASAEC
Ga0247512_12235513300023690SoilMAILKTTANTDMRWMEIAPPRRVCMGRRRPVEKALRPIAEERSLSNGELMDGLCPTFPAVIAFKAEGDNERFASAEY
Ga0257208_110158013300030556Host-AssociatedVQIRVFVSILYSPDNLTLKMAIQKTTVTTDKKWLEIAPPRRLCAGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAASGLRAEGDNERFASGEC
Ga0257208_119041613300030556Host-AssociatedMAIPKTTVTTDKKWLEIAPPRRVCVGRRRPLEKTLRPIAEECSLSNGELMDGLRRTFPAVSGFKAEGDNERFPSAEC
Ga0257198_114928213300030557Host-AssociatedMAIPKMTVTADRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFASAEC
Ga0257197_108115813300030558Host-AssociatedVVVRVFVSRLYSPCKVSLVMAIPKMTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFASTEC
Ga0257197_108601413300030558Host-AssociatedMAIPKTTVTTDKKWLEMAPPRRVCVGRRRPLEKTLRPIAEDCSLSNGELMDGLRPTFPAVSGFKAEGDNERFPSVER
Ga0257205_107816013300030559Host-AssociatedVQIRVFVSLLYSPDNLTLKMAIQKTTVTTDRKWLEIAPPRRVCAGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFTSTEC
Ga0257205_115334613300030559Host-AssociatedMAIPKTTVTTDKKWLEMAPPRRVCVGRRRPLEKPLRPIAEECSLSNGELMDGLRPTFPAVSGFKAEGDNERFPSAEC
Ga0257207_111425213300030562Host-AssociatedTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFTSTEC
Ga0257182_126309313300030611Host-AssociatedVVVRVFISRLYSPCKVSLVMAIPKMTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEGDNERFPSAEC
Ga0074043_1005318513300030748SoilVQVRVFVSRLYCPKNLTLVMAIPKTTITTDRKWLEIAPPRRVCAGRRRPLEKTLRPIAEERSLDNGELMDGLRPTFPAVSGFKVEGDTERFASAEC
Ga0074043_1149991113300030748SoilMAIPKTTVTTDKKWLEMAPPRRLCVGRRRPLEKTLRPIAEECSLSNGELMDGLRPTFPAVSSFKAEGDNERFPSAEC
Ga0074043_1150685213300030748SoilMAIHKTTVTTDKKWLEIAPPRRVCVGRRRPLEKTLRPIAEECSLSNGELMDGLRPTFPAVSGFKAEDDDERFPSADC
Ga0074043_1156045013300030748SoilVSGNGVAIQMTTVTTKKKWLEIAPPRRACVGRWRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRADGDYERFASEEC
Ga0074021_185189013300030775SoilMAILKTTATTDMRWMEIAPRRREFMGRRRPVEKTLWPIAEERSLSNGELMDGLRPTFPAVSGFNAEGDNERFASAEC
Ga0075396_102057713300030776SoilMAIQKTTATTDMRWMEIAPQRRVSLGKRCPFEKTLRPIAEERSLSNGELIDGLLPSFPAVSVFKADGDNETFASAGC
Ga0102752_164876413300030783SoilLSTQFDSGMAIPKTTVRTDRKWLEIAPPRRVCVGGRRPLEKTLRPIAEERSLSNGELIDGLSPNFPAVSGFKAEGNDERFASAEC
Ga0102757_1145042513300030785SoilVQVRVFVSRLYCADNLTLVMAITKTTVRTDRKWLEIAPPRKVCVGGRRPLEKTLRPIAEERSLSNGELMDGLCPNYPAISGFKAEGNDERLASAEC
Ga0073999_1108631013300030839SoilVVVRVFVSRLYSPCKVSLVMAIPKTMVTTDKKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGLRAEGDNERFASGEC
Ga0074013_1010207123300030907SoilMAIPKTTVTTDKKWLEMAPPRRVCVGRRRPLEKTLRPIAEDCSLSNGELMDGLRPTFPAVSGFKAEGDNERFPSAEC
Ga0074006_1153223913300030931SoilVFVSRLYYPHKVSLVMAITKTMVTTDKKWLEMAPPRRVCLGRRRPLEKTLRPIAEECSLSNGELMDGLRPTFPAVSGFKAEGDNERFPSAEC
Ga0074006_1160245623300030931SoilIFTLLKHSNSSRIAVCPAAVLRVFVSRLYSPCKVSLVMAIPKMTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFASAEC
Ga0074039_1003658013300030933SoilVVVRVFVSRLYSPCKVSLVMAIPKTTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDKERFASAEC
Ga0074039_1164133813300030933SoilLQIRVFLSILYSPDHLTLKMAIQKTTVTTDRKWLEIAPPWRVCAGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGLRAEGDNERFASAGC
Ga0074031_112453013300030949SoilVVVRVFVSRLYSPCKVSLVMAIPKTTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVPGFRAEGDNERFASAEC
Ga0074031_194941213300030949SoilMQSECLVMAIQMTTVTTKKKWLEIAPPRRACVGRWRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRADGDYERFASEEC
Ga0074031_196279713300030949SoilLVVVRVFVSRLYSPCKVSLVMAIPKTTVTTDKKWLEIAPPRRVCVGRRRPLEKTLRPIAEECSLSNGELMDGLRPTFPAVSGFKAEDDDERFPSADC
Ga0075399_1000525813300030967SoilMAIPKTTATTDMRWMEIAPQQRVCLGKRRPFEKTLRPIAEEGSLSNGELMDGLRPSFPAVSGFKAEGDN
Ga0074027_1001970013300030980SoilVQVRVFVSRLYSPENLTLVMAIPKTTITTDRKWLEIAPPRRVCAGRRRPLEKTLRPIAEERSLDNGELMDGLRPTFPAVSGFKAEGDTERFASAEC
Ga0074027_1006854213300030980SoilLYSPDNLTLKMAIQKTTVTTNRKWLEIAPPRRVCAGRRRPLEKTLRPIAEERSLSNGELLHGLCPTFPAVSGLRAEGDNERFASGEC
Ga0074027_1129124213300030980SoilVHGRVFVSRLYCPDNLTLVMAIPKTTVTTDRKWLEMAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCSTFPAVSGFRENGDNERFASAEF
Ga0102770_1001753513300030981SoilVVRVFVSRLYSPCKVSLVMAIPKMTVTTDRKWLEIAPPRRVCVVRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFTSAEC
Ga0074019_1121752923300030999SoilMAIPKTTVTTDKKWLEMAPPRRLCVGRRRSLEKTLRPIAEECSLSNGELMDGLRPTFPAVSSFKAEGDNERFPSAEC
Ga0074019_1122804413300030999SoilLVQIRVFVSILYSPDNLTLKMAIQKTTVTTDRKWLEIAPPRRVCAGRRRPLEKTLRPIEEERSLSNGELLDGLCPTFPAVSGLRAEGDNERFASAGC
Ga0074019_1124704823300030999SoilVQVRVFVSRLYCPKNLTLVMAIPKTTITTDRKWLEIAPPRRVCAGRRRPLEKTLRPIAEERSLDNGELMDGLRPTFPAVSGFRAEGDTERFASAEC
Ga0074038_1006271213300031008SoilVVVRVFVSRLYSPCKVSLVMAIPKTTVTTDKKWLEIAPPRRVCVGRRRALEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFASAEC
Ga0074038_1200472113300031008SoilVQIRVFVSILYSPDNLTLKMAIQKTTVTTDRKWLEIAPPWRVCAGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGLRAEGDNERFASAGC
Ga0102753_141828813300031013SoilMAIPKTTVRTDRKWLEIAPPRRVCVGGRRPLEKTLRPIAEERSLSNGELMDGLSPNFPAVSGFKAEGNDERFASAEC
Ga0138298_125604213300031015SoilVVVRVFVSRLYSPCKVSLVMAIPKTTLTTDKKWLEIAPPRRVCVGRRRALEKTLRPIAEERSLSNGELLDGLCSTFPAVSGFRENGDNERFASAEF
Ga0074012_1007496313300031029SoilGLQPIFTLLKHSNSSRIAVCPAAVLRVFVSRLYSPCKVSLVMAIPKMTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFTSKEC
Ga0074030_1014503113300031030SoilAIPKTTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDKERFASAEC
Ga0074030_1108267913300031030SoilLTLKMAIQKTTVTTDRKWLEIAPPRRVCAGRRRPSEKTLRPIAEECSLSNGELLDGLCPTFPALSGLRAEGDNERFASGEC
Ga0074026_1009000013300031035SoilMAIHKTTVTTDKKWLEIAPPRRVCVGRRRPLEKTLRPIAEECSLSNGELIDGLRPTFPAVSGFKAEDDDERFPSADC
Ga0074026_1015631713300031035SoilLVVVRVFVSRLYSPCKVSLVMAIPKTTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDKERFASAEC
Ga0074026_1022750513300031035SoilLYSPDNLTLKMAIQKTTVTTDRKWLEIAPPRRVCAGRRRPSEKTLRPIAEECSLSNGELLDGLCPTFPALSGLRAEGDNERFASGEC
Ga0102760_1003133613300031039SoilVQVRVFVSRLYCPDNLTLVMAIPKTTVRTDSKWLEMAPPRRVCVAGRRPLEKTLRPIAEERSLSNGELMDGLCPNFPAVSGFKAEGNGERFASAEC
Ga0102760_1003919513300031039SoilVQFRVFVSRLYSPHNLTLVMAILKTMVTIDRKWLEVAPEQRVCVRRRRPLEKTLRPIAEERSLSNGELMDGLCPNFPAVSGFKAEGNDERLSAEC
Ga0102760_1098059613300031039SoilVQVRVFVSRLYCADNLTLVMAIPKTTVRTDRKWLEIAPPRKVCVGGRRPLEKTLRPIAEERSLSNGELMDGLCPNYPAISGFKAEGNDERLASAEC
Ga0073995_1074710713300031047SoilMAIPKTTVTTDKKWLEMAPPRRVCVGRRRPLEKPLRPIAEECSLSNGELMDGLRPTFPAVSGFKAEGDKERFPSAEC
Ga0074028_1004572213300031050SoilMAIQMTTVTTKKKWLEIAPPRRACVGRWRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRADGDYERFASEEC
Ga0074028_1007123313300031050SoilLVQIRVFVSILYSPDNLTLKMAIQKTTVTTDRKWLEIAPPRRVCAGRRRPSEKTLRPIAEECSLSNGELLDGLCPTFPAVSGLRAEGDNERFASGEC
Ga0074029_172168313300031051SoilNLTLVMAIPKTTITTDRKWLEIAPPRRVCAGRRRPLEKTLRPIAEERSLDNGELMDGLRPTFPAVSGFKAEGDTERFASAEC
Ga0102767_1000885513300031064SoilMAIPKTTVTTDKKWLEIAPPRRVCVGRRRPLEKPLRPIAEECSLSNGELMDGLRPTFPAVSGFKAEGDNERFPSAEC
Ga0102767_1006741713300031064SoilVVVRVFVSRLYSPCKVSLVMAIPKMTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDNERFTSAEC
Ga0170824_10491942213300031231Forest SoilMAIPKTTATTDMRWMEIAPPRRVCLGNRRPFEKTLRPIAEDRSLSNVELTDGLCPIFPAVSGFKAKGDTERFASVVC
Ga0170824_10932614813300031231Forest SoilLRRNCPAGLLQVRNLFSRLFSPDRLTLVMAIQKTTATTDMRWMEIAPQRRVSLGKRRPFEKTLRPIAEERSLSNGELIDGLLPTFPSVSGFKVEGDNERFASTGC
Ga0170824_11509288313300031231Forest SoilDLQAICSHQTHRLRRNCPAGLLQVRNLFSRLFSPDRLTLVMAIQKTTATTDMRWMEIAPQRRVSLGKRRPFEKTLQPIAEERSLSNGELIDGLLPTFPSVSGFKVEGDNERFASTGC
Ga0170824_12723546613300031231Forest SoilMAIQKTTATTDIRWMEIAPQRRVSLGKRRPFEKTLRPIAEERSLSNGELIDGLLPSFPAVSVFKAEGDNETFASAGC
Ga0170820_1160822423300031446Forest SoilMAIQKTTATTDMRWMEIAPQRRVSLGKRCPFEKTLRPIAEERSLSNGELIDGLIPSFPAVSVFKAEGDNETFASAGC
Ga0170818_11514108713300031474Forest SoilAIQKTTATTDMRWMEIAPQRRVSLGKRCPFEKTLRPIAEERSLSNGELIDGLLPSFPAVSVFKADGDNETFASAGC
Ga0310116_11808513300031591SoilVQVRVFVSRLFSPHNLTLVMAIPKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIAEERSVSNGELMEGLRPSFPAVSGFKAEGDNERFSSAEC
Ga0310103_12548123300031614SoilVQVRVFVSRLFSPDNLTLVMAIPKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIGEERSVSNGELMEGLRPSFPAVSGFKAEDDNERFSSAQC
Ga0310103_13296713300031614SoilVQVRVFVSRLYSPDKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFNAEDDNERFASAEC
Ga0310103_13598623300031614SoilMAILMTKATTDMRWTEIAPLRRVFMGRWRPLEKTLRPIAEEHSLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0310103_14205013300031614SoilMAILKTTAKTDMRWMEIAPPRRVCMGRRRPVEKALRPIAEERSLSNGELMDGLCPTFPAVIAFKAEGDNERFASAEY
Ga0310107_12793513300031615SoilMAILKTTATTDMRWMEIAPPRRVCMGRRRPVEKTLWPIAEERSLSNGELMDGLRPTFPAVSGFNAEGDNERFASAEC
Ga0310108_12259113300031633SoilVVVRVFVSRLYSPCKVSLVMAIPKSTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPSFPAVSGFRAEGDNERFESAEC
Ga0310106_11490713300031634SoilVQVRVFVSRLFSPDNLTLVMAIPKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIAEERSVSNGELMEGLRPSFPAVSGFKAEGDNERFSSAQC
Ga0310115_12317513300031635SoilVQVRVFVSRLYSPHKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRWRPLEKTLRPIAEERNLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0310115_13049013300031635SoilMAILKTTATTDMRWMEIAPRRREFMGRRRPVEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFNAEGDNERFASAEC
Ga0310113_11701723300031636SoilMAILMTKATTDMRWTEIAPPRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0310105_11409413300031666SoilMAILKTTATTDMRWMEIAPRRREFMGRRRPVEKTLWPIAEERSLSNGELMDGLRPTFPAVSGFNAEGDNERFASAEF
Ga0310105_11640513300031666SoilVQVRVFVLRLYSPDKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRRRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0310105_12007913300031666SoilMAILKTTAKTDMRWMEIAPPRRVCMGRRRPVEKALRPIAEERSLSNGELMDGLCPTFPAVIGFKAEGDSERLASAEY
Ga0310111_11816723300031667SoilVQVRVFVLRLYSPDKLTLVMAILMTKATTDMRWTEIAPQRRVFMGRRRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEDDNEIFASAEC
Ga0310114_11410513300031678SoilVQVRVFVSRLFSPDNLTLVMAIPKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIGEERSVSNGELMEGLRPSFPAVSGFKAEGDNERFSSAQC
Ga0310114_12369313300031678SoilLVQVGVCVSRFFSPDKLALVMAIPKTMATTDMRWMEIAPPRRVCMGRRRPLEKTLRPIAEERSLSNGELIDGLCPTFPAVMCFKLEGDNESYVSADC
Ga0310119_12561823300031686SoilVQVRVFVSRLYSPHKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0310119_13343713300031686SoilMAILKTTANTDMRWMEIAPPRRVCMGRRRPVEKALRPIAEERSLSNGELMDGLCPTFPAVIGFKAEGDSERLASAEY
Ga0316045_12092423300031815SoilVQVRVFVSRLYSPHKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRRRPLEKTLRPIAEERSLSNGELMDGLRPTFSAVSGFNAEDDNERFASAEC
Ga0316042_11982013300031816SoilDKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRWRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0316043_12994423300031828SoilLVQVGVCVSRFFSPDKLTLVMTIPKTMATTDMRWMEIAPPRRVCMGRRRPLEKTLRPIAEERSLSDGELIDGLCPTFPAVMCFKLEGDNESYVSADC
Ga0257195_1032710213300032169Host-AssociatedLPWCCPSRLVQIRVFVSILYSPGNLNLKMAIQKTTVTTDRKWLEIAPPRRLCAGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGLRAEGDNERFASGEC
Ga0257195_1036884713300032169Host-AssociatedMAIPKTTVTTDKKWLEMAPPRRVCVGRRRPLEKPLRPIAEECSLSNGELIEGLRPTFPAFSGFKAEGDNERSASAEC
Ga0214482_107914713300032468Switchgrass PhyllosphereMAIPKTTVRTNRKWLEIAPPRRVCVGGRLPLEKTLRPIAEERSLNNGELMDGLSPNFPAVSGFKAEGNDERFASAEC
Ga0214482_108211213300032468Switchgrass PhyllosphereVQFRVFISRLYSPDNLTLVMAIPKTTVTTDRKWLEIAPQRRVCVGRRRPLEKTLRPIAEERSLSHGELMDGLCPNFPAVSGSKAERNDERFASAEC
Ga0348332_1009125213300032515Plant LitterVQVRVFVSRLYSPHKLTLVMAILMTKATTDMRWTEVAPPRRVFMGRWRPLEKTLRPIAEERSLSNGVLMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0348332_1272366313300032515Plant LitterVQVRVFVSTLYSPHKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRWRPLEKTLRPIAEEHSLSNGELMDGLRPTFSAVSGFNAEDDNERFASAEC
Ga0348332_1386580413300032515Plant LitterVQVRVFVSRLFSPDNLTLVMAITKTTVTTDMRWMEIAPPRRVCGGRRRPFEKTLRPIAEERSVSNGELMEGLRPSFPAVSGFKAKDDNERFSSAQC
Ga0321340_104336613300032550Switchgrass PhyllosphereMAIPKRTVRTDRKWLEIAPPRRVCVAGRRPLEKTLRPIAEERSLSNGELMDGLCPNFPAVSGFKAEGNGERFASAEC
Ga0321339_112190813300032551Switchgrass PhyllosphereMAIPKRTVRTDRKWLEIAPPRRVCVAGRRPLEKTLRPIAEERSLSNGELMDGLCPNFPAVSGFKAERNDERFASAEC
Ga0321339_112553613300032551Switchgrass PhyllosphereMAIPKTTVTTNRKWLEIAPPRRVCVGGRLPLEKTLSPIAEERSLNNGELMDGLSPNFPAVSGFKAEGNDERFASAEC
Ga0321339_113210413300032551Switchgrass PhyllosphereVQFRVFISRLYCPDNLTLVMAIPKTTVTTDRKWLEIAPQRRVCVGRRRPLEKTLRPIAEERSLSHGELMDGLCPNFPAVSGSKAERNDERFASAEC
Ga0214484_106406513300032591Switchgrass PhyllosphereMAIPKTTVRTNRKWLEIAPPRRVCVGGRLPLEKTLSPIAEERSLNNGELMDGLSPNFPAVSGFKAEGNDERFASAEC
Ga0214485_109231713300032698Switchgrass PhyllosphereMAIPKTTVRTDKKWLEIAPPRRVCVAGRRPLEKTLRPIAEERSLSNGELMDGLCPNFPAVSGFKAEGNGERFASAEC
Ga0314686_1062211313300032714SeawaterVVVRVFVSRLYSPCKVSLVMAIAKTTVTTDRKWLEIAPPRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDKERFASAEC
Ga0315741_1103311513300032739Forest SoilVQIRVFVSILYSPDNLTLKMAIQKTTVTTDRKWLEIAPPWRVCAGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGFRAEGDKERFASAEC
Ga0315741_1151140623300032739Forest SoilVQVRVFVSRLYSPHKLTLVMAILMTKATTDMRWTEIAPPRRVFMGRRRPLEKTLRPIAEERSLSNGELMDGLRPTFPAVSGFKAEDDNERFASAEC
Ga0315742_1058853513300032756Forest SoilMAIPKTTVTTDRKWLEIAPPRGVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVPGFRAEGDNERFASAEC
Ga0315742_1108376223300032756Forest SoilVQVRDFVSRLYSPENLTLVMAIPKTTITTDRKWLEIAPPRRVCAGRRRPLEKTLRPIAEERSLDNGELMDGLRPTFPAVSGFKAEGDTERFASAEC
Ga0315742_1137785413300032756Forest SoilMAIQKTTVTTDRKWLEIAPPWRVCAGRRRPLEKTLRPIAEERSLSNGELLDGLCPTFPAVSGLRAEGDNERFASAGC
Ga0315742_1165174113300032756Forest SoilMAIQKTTVTTDRKWLEIAPPWRVCAGRRRPLEKTLRPIAEECSLSNGELMDGLRPTFPAVSGFKAEDDDERFPSADC
Ga0315742_1220477913300032756Forest SoilLVVVRVFVSRLYSPCKVSLVMAIPKTTVTTDRKWLEIAPSRRVCVGRRRPLEKTLRPIAEERSLSNGELLDGLCPIFPAVSGFRAEGDKERFASAEC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.