NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065671

Metagenome / Metatranscriptome Family F065671

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065671
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 63 residues
Representative Sequence MTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVADD
Number of Associated Samples 93
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.10 %
% of genes near scaffold ends (potentially truncated) 26.77 %
% of genes from short scaffolds (< 2000 bps) 80.31 %
Associated GOLD sequencing projects 76
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.378 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(37.008 % of family members)
Environment Ontology (ENVO) Unclassified
(65.354 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(95.276 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 32.26%    β-sheet: 0.00%    Coil/Unstructured: 67.74%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF01510Amidase_2 18.11
PF02954HTH_8 8.66
PF11351GTA_holin_3TM 7.87
PF01381HTH_3 7.09
PF05565Sipho_Gp157 6.30
PF13539Peptidase_M15_4 2.36
PF05866RusA 2.36
PF12844HTH_19 1.57
PF12708Pectate_lyase_3 0.79
PF11651P22_CoatProtein 0.79
PF04466Terminase_3 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG4570Holliday junction resolvase RusA (prophage-encoded endonuclease)Replication, recombination and repair [L] 2.36
COG1783Phage terminase large subunitMobilome: prophages, transposons [X] 0.79

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.83 %
UnclassifiedrootN/A14.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10086479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1070Open in IMG/M
3300000116|DelMOSpr2010_c10043099All Organisms → cellular organisms → Bacteria2021Open in IMG/M
3300000117|DelMOWin2010_c10032388All Organisms → cellular organisms → Bacteria2526Open in IMG/M
3300000117|DelMOWin2010_c10050839Not Available1830Open in IMG/M
3300000117|DelMOWin2010_c10103500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1037Open in IMG/M
3300001278|BBAY75_10128931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1051Open in IMG/M
3300002482|JGI25127J35165_1001041Not Available8046Open in IMG/M
3300002930|Water_100273All Organisms → cellular organisms → Bacteria11614Open in IMG/M
3300004829|Ga0068515_126524All Organisms → cellular organisms → Bacteria → Proteobacteria724Open in IMG/M
3300004951|Ga0068513_1017277All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium770Open in IMG/M
3300006026|Ga0075478_10001789All Organisms → cellular organisms → Bacteria7854Open in IMG/M
3300006029|Ga0075466_1013509All Organisms → Viruses → Predicted Viral2745Open in IMG/M
3300006029|Ga0075466_1038475All Organisms → Viruses → Predicted Viral1458Open in IMG/M
3300006752|Ga0098048_1000484Not Available18994Open in IMG/M
3300006752|Ga0098048_1069322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1088Open in IMG/M
3300006752|Ga0098048_1216111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium564Open in IMG/M
3300006793|Ga0098055_1372912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium529Open in IMG/M
3300006802|Ga0070749_10227948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1061Open in IMG/M
3300006802|Ga0070749_10229921All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1055Open in IMG/M
3300006802|Ga0070749_10235798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1040Open in IMG/M
3300006802|Ga0070749_10513907All Organisms → cellular organisms → Bacteria → Proteobacteria651Open in IMG/M
3300006803|Ga0075467_10253218All Organisms → cellular organisms → Bacteria → Proteobacteria954Open in IMG/M
3300006803|Ga0075467_10269174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium917Open in IMG/M
3300006803|Ga0075467_10691849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium519Open in IMG/M
3300006810|Ga0070754_10222253All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium872Open in IMG/M
3300006810|Ga0070754_10236036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium840Open in IMG/M
3300006810|Ga0070754_10318498All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium694Open in IMG/M
3300006810|Ga0070754_10512110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium516Open in IMG/M
3300006868|Ga0075481_10121744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium960Open in IMG/M
3300006868|Ga0075481_10356544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium505Open in IMG/M
3300006870|Ga0075479_10369402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium556Open in IMG/M
3300006916|Ga0070750_10183987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium932Open in IMG/M
3300006916|Ga0070750_10258738All Organisms → cellular organisms → Bacteria → Proteobacteria754Open in IMG/M
3300006919|Ga0070746_10440808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium579Open in IMG/M
3300006919|Ga0070746_10450671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium571Open in IMG/M
3300006922|Ga0098045_1124467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium601Open in IMG/M
3300007231|Ga0075469_10025002All Organisms → cellular organisms → Bacteria1969Open in IMG/M
3300007344|Ga0070745_1009668All Organisms → cellular organisms → Bacteria4628Open in IMG/M
3300007344|Ga0070745_1075486All Organisms → Viruses → Predicted Viral1346Open in IMG/M
3300007344|Ga0070745_1349006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium519Open in IMG/M
3300007345|Ga0070752_1178641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium857Open in IMG/M
3300007539|Ga0099849_1047441All Organisms → cellular organisms → Bacteria → Proteobacteria1798Open in IMG/M
3300007539|Ga0099849_1144037All Organisms → cellular organisms → Bacteria → Proteobacteria925Open in IMG/M
3300007539|Ga0099849_1192219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium771Open in IMG/M
3300007540|Ga0099847_1196479All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium589Open in IMG/M
3300009001|Ga0102963_1033925All Organisms → cellular organisms → Bacteria2131Open in IMG/M
3300009086|Ga0102812_10648580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium580Open in IMG/M
3300009435|Ga0115546_1080255All Organisms → cellular organisms → Bacteria → Proteobacteria1207Open in IMG/M
3300010149|Ga0098049_1159736All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium696Open in IMG/M
3300010296|Ga0129348_1206901All Organisms → cellular organisms → Bacteria → Proteobacteria667Open in IMG/M
3300016776|Ga0182046_1371658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1107Open in IMG/M
3300017706|Ga0181377_1000860All Organisms → cellular organisms → Bacteria10555Open in IMG/M
3300017713|Ga0181391_1032447All Organisms → Viruses → Predicted Viral1269Open in IMG/M
3300017717|Ga0181404_1018774All Organisms → Viruses → Predicted Viral1794Open in IMG/M
3300017724|Ga0181388_1055499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium954Open in IMG/M
3300017727|Ga0181401_1061340All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1008Open in IMG/M
3300017741|Ga0181421_1204160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium505Open in IMG/M
3300017742|Ga0181399_1008667Not Available3025Open in IMG/M
3300017749|Ga0181392_1232593All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium522Open in IMG/M
3300017752|Ga0181400_1086805All Organisms → cellular organisms → Bacteria → Proteobacteria930Open in IMG/M
3300017767|Ga0181406_1148754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium702Open in IMG/M
3300017783|Ga0181379_1050170All Organisms → cellular organisms → Bacteria → Proteobacteria1603Open in IMG/M
3300017824|Ga0181552_10188722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1072Open in IMG/M
3300017824|Ga0181552_10215387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium984Open in IMG/M
3300017951|Ga0181577_10400194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium874Open in IMG/M
3300018410|Ga0181561_10037683Not Available3177Open in IMG/M
3300018410|Ga0181561_10088764Not Available1729Open in IMG/M
3300018413|Ga0181560_10295333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium760Open in IMG/M
3300018415|Ga0181559_10329439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium847Open in IMG/M
3300018416|Ga0181553_10137057Not Available1470Open in IMG/M
3300018416|Ga0181553_10190382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1193Open in IMG/M
3300018876|Ga0181564_10249080Not Available1009Open in IMG/M
3300018876|Ga0181564_10361047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium798Open in IMG/M
3300019459|Ga0181562_10254814All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium891Open in IMG/M
3300019751|Ga0194029_1079550All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium563Open in IMG/M
3300020176|Ga0181556_1088576Not Available1446Open in IMG/M
3300020347|Ga0211504_1017850All Organisms → cellular organisms → Bacteria → Proteobacteria1944Open in IMG/M
3300021373|Ga0213865_10014314All Organisms → cellular organisms → Bacteria4525Open in IMG/M
3300021375|Ga0213869_10204210All Organisms → cellular organisms → Bacteria → Proteobacteria889Open in IMG/M
3300021378|Ga0213861_10225747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1004Open in IMG/M
3300021389|Ga0213868_10013660Not Available6633Open in IMG/M
3300021425|Ga0213866_10017865Not Available4253Open in IMG/M
3300021957|Ga0222717_10126415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1578Open in IMG/M
3300021958|Ga0222718_10045841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae2812Open in IMG/M
3300021958|Ga0222718_10215760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1039Open in IMG/M
3300021958|Ga0222718_10256212All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium927Open in IMG/M
3300021959|Ga0222716_10242694All Organisms → Viruses → Predicted Viral1116Open in IMG/M
3300021959|Ga0222716_10359140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium860Open in IMG/M
3300021960|Ga0222715_10225321All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1105Open in IMG/M
3300021962|Ga0222713_10520497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium708Open in IMG/M
3300021964|Ga0222719_10385230Not Available877Open in IMG/M
3300022053|Ga0212030_1042033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium645Open in IMG/M
3300022072|Ga0196889_1037860All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300022164|Ga0212022_1043529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium695Open in IMG/M
3300022168|Ga0212027_1042651All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium582Open in IMG/M
3300022218|Ga0224502_10246490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium687Open in IMG/M
3300022900|Ga0255771_1026859All Organisms → cellular organisms → Bacteria → Proteobacteria3653Open in IMG/M
3300022900|Ga0255771_1092901Not Available1432Open in IMG/M
3300022905|Ga0255756_1307602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium502Open in IMG/M
3300022922|Ga0255779_1116800Not Available1355Open in IMG/M
3300022925|Ga0255773_10094651Not Available1592Open in IMG/M
3300022925|Ga0255773_10317982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium627Open in IMG/M
3300022928|Ga0255758_10186492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium979Open in IMG/M
3300024415|Ga0228662_1000196Not Available33493Open in IMG/M
(restricted) 3300024517|Ga0255049_10484543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium574Open in IMG/M
3300025070|Ga0208667_1000126Not Available34575Open in IMG/M
3300025070|Ga0208667_1003427All Organisms → cellular organisms → Bacteria → Proteobacteria4819Open in IMG/M
3300025070|Ga0208667_1022643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1202Open in IMG/M
3300025083|Ga0208791_1050003All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium732Open in IMG/M
3300025127|Ga0209348_1000241Not Available30533Open in IMG/M
3300025508|Ga0208148_1042195All Organisms → cellular organisms → Bacteria → Proteobacteria1169Open in IMG/M
3300025543|Ga0208303_1035208All Organisms → Viruses → Predicted Viral1304Open in IMG/M
3300025570|Ga0208660_1032687All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300025610|Ga0208149_1004378All Organisms → cellular organisms → Bacteria4705Open in IMG/M
3300025652|Ga0208134_1155524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium571Open in IMG/M
3300025671|Ga0208898_1032704All Organisms → cellular organisms → Bacteria → Proteobacteria2097Open in IMG/M
3300025671|Ga0208898_1043733All Organisms → Viruses → Predicted Viral1689Open in IMG/M
3300025674|Ga0208162_1038648All Organisms → Viruses → Predicted Viral1682Open in IMG/M
3300025674|Ga0208162_1131526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium706Open in IMG/M
3300025759|Ga0208899_1037360All Organisms → cellular organisms → Bacteria2206Open in IMG/M
3300025853|Ga0208645_1119054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium1057Open in IMG/M
3300025853|Ga0208645_1302288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium501Open in IMG/M
3300025870|Ga0209666_1192749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium882Open in IMG/M
3300028115|Ga0233450_10177185All Organisms → Viruses → Predicted Viral1022Open in IMG/M
3300029302|Ga0135227_1016815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium688Open in IMG/M
3300032274|Ga0316203_1027435All Organisms → Viruses → Predicted Viral1665Open in IMG/M
3300034418|Ga0348337_036940All Organisms → Viruses → Predicted Viral2146Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous37.01%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh17.32%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.24%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.87%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water7.09%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.72%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.94%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.79%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.79%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.79%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.79%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.79%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.79%
Estuary WaterEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water0.79%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.79%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.79%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water0.79%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.79%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.79%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.79%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001278Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY75Host-AssociatedOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002930Estuary water microbial communities from Pearl Estuary, Zhujiang, ChinaEnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022168Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v2)EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022900Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaGEnvironmentalOpen in IMG/M
3300022905Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaGEnvironmentalOpen in IMG/M
3300022922Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaGEnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022928Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaGEnvironmentalOpen in IMG/M
3300024415Seawater microbial communities from Monterey Bay, California, United States - 76DEnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300028115Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly)EnvironmentalOpen in IMG/M
3300029302Marine harbor viral communities from the Indian Ocean - SRB3EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1008647933300000115MarineMTEPAFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEDYDD*
DelMOSpr2010_1004309953300000116MarineMTEPAFMAFVIFSSLSDCKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVADD*
DelMOWin2010_1003238863300000117MarineMTEPAFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEDYDD*
DelMOWin2010_1005083963300000117MarineMTEPTFMAFAIFSSLNVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEIADE*
DelMOWin2010_1010350033300000117MarineMTEPTFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND*
BBAY75_1012893123300001278Macroalgal SurfaceMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVADD*
JGI25127J35165_1001041113300002482MarineMTEPAFMAFVIFSSLSECKDFAEYYDLERLFEPQCVQMGGPPEYQLPIPNIRPMPKPEASDD*
Water_100273163300002930Estuary WaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYKRPIPNIRPMPRPEVSND*
Ga0068515_12652423300004829Marine WaterMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVADD*
Ga0068513_101727723300004951Marine WaterMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEIADD*
Ga0075478_10001789183300006026AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSDD*
Ga0075466_101350933300006029AqueousMTEPAFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPENYDD*
Ga0075466_103847533300006029AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVADD*
Ga0098048_1000484243300006752MarineMTLAEPAFMAFVVFSSIDECKEFSKYYDLQRIFEPQCIQMGGGVEYQRPIPNIRPKPRPQING*
Ga0098048_106932223300006752MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYKRPIPNIRPMPRPEVADD*
Ga0098048_121611113300006752MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVSND*
Ga0098055_137291213300006793MarineMTEPAFMAFAIFSSLSVCEDFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPKPEVADD*
Ga0070749_1022794823300006802AqueousMTEPAFMAFVIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD*
Ga0070749_1022992133300006802AqueousMTEPAFMAFVIFSSLSVCEEFAEYYDLERIFEPQCVQMSGAPEYQPPIPNTRPMQRPEASDD*
Ga0070749_1023579823300006802AqueousMTEPAFMAFVIFSSLSDCKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPTPRPEVADD*
Ga0070749_1051390713300006802AqueousTMTEPAFMAFSIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVADD*
Ga0075467_1025321813300006803AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYKRPIPNIRP
Ga0075467_1026917423300006803AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYKRPIPNIRPMPRPEVADE*
Ga0075467_1069184923300006803AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND*
Ga0070754_1022225313300006810AqueousMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGVPEYQLPIPNIRPMPKPEVADD*
Ga0070754_1023603623300006810AqueousMTEPAFMAFVIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND*
Ga0070754_1031849833300006810AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEVADE*
Ga0070754_1051211013300006810AqueousMFTFIGGKAMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVSND*
Ga0075481_1012174413300006868AqueousWRKTMTEPAFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPENYDD*
Ga0075481_1035654413300006868AqueousKTMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD*
Ga0075479_1036940213300006870AqueousTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND*
Ga0070750_1018398733300006916AqueousFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD*
Ga0070750_1025873833300006916AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIR
Ga0070746_1044080823300006919AqueousMTEPAFMAFVIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVADD*
Ga0070746_1045067113300006919AqueousTMTEPAFMAFAIFSSLSVCEDFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPVPRPEVSND*
Ga0098045_112446723300006922MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGASEYKRPIPNIRPMPRPEVADD*
Ga0075469_1002500223300007231AqueousMTEPTFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSDD*
Ga0070745_100966823300007344AqueousMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD*
Ga0070745_107548633300007344AqueousMTEPAFMAFVIFSSLSECKDFAEYYDLEKIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND*
Ga0070745_134900633300007344AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLEKIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND*
Ga0070752_117864123300007345AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVSND*
Ga0099849_104744143300007539AqueousMTEPAFMAFAIFSSLSVCEDFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPVPRPEVSND*
Ga0099849_114403733300007539AqueousMTEPAFMAFVIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYKRPIPNIRPMPRPEVADE*
Ga0099849_119221923300007539AqueousMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEVADE*
Ga0099847_119647923300007540AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPR
Ga0102963_103392533300009001Pond WaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD*
Ga0102812_1064858023300009086EstuarineGGKTMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPSPNIRPMPRPEVSND*
Ga0115546_108025533300009435Pelagic MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYHLPIPNIRPMQRPEDYDD*
Ga0098049_115973633300010149MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYHLPIPNIRPMPRPEVADD*
Ga0129348_120690133300010296Freshwater To Marine Saline GradientMTEPAFMAFAIFSSLSVCEDFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIR
Ga0182046_137165843300016776Salt MarshMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEAADD
Ga0181377_1000860113300017706MarineMTEPAFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYNLPIPNIRPMQRPEASDD
Ga0181391_103244723300017713SeawaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMNGAPEYQRPIPNIRPMPKPEVNDD
Ga0181404_101877423300017717SeawaterMTEPAFMAFVIFSSLSHCKEFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPKPEDADD
Ga0181388_105549923300017724SeawaterMTEPAFMAFVIFSSLSHCKEFSEYYDLERIFEPQCVQMGGAPEYQRPIPNTRPMPRPEVADD
Ga0181401_106134043300017727SeawaterTGGKTMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND
Ga0181421_120416023300017741SeawaterMTEPAFMAFVIFSSLSHCEEFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPKPEDADD
Ga0181399_1008667103300017742SeawaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSSD
Ga0181392_123259333300017749SeawaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNI
Ga0181400_108680523300017752SeawaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEASDD
Ga0181406_114875433300017767SeawaterMTEPAFMAFVIFSSLSHCKEFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRRMPKPEDAYD
Ga0181379_105017033300017783SeawaterMTEPAFMAFAIFSSLSVCEDFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND
Ga0181552_1018872213300017824Salt MarshFIGGKTMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0181552_1021538723300017824Salt MarshMTEPAFMAFVIFSSLSECKEFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMQRPEAADD
Ga0181577_1040019423300017951Salt MarshMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMQRPEAADD
Ga0181561_1003768373300018410Salt MarshMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGATEYQLPIPNIRPMPRPEAADD
Ga0181561_1008876433300018410Salt MarshMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0181560_1029533313300018413Salt MarshFWLKTNIRKQFLIELIFMFTFIGGKTMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0181559_1032943923300018415Salt MarshIELIFMFTFIGGKTMTEPAFMAFVIFSSLSECKEFAEYYGLERIFEPQCVQMGGATEYQLPIPNIRPMPRPEAADD
Ga0181553_1013705743300018416Salt MarshNIRKQFLIELIFMFTFIGGKTMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0181553_1019038233300018416Salt MarshNIRKQFLIELIFMFTFIGGKTMTEPAFMAFVIFSSLSECKEFAEYYGLERIFEPQCVQMGGATEYQLPIPNIRPMPRPEAADD
Ga0181564_1024908033300018876Salt MarshFTFIGGKTMTEPAFMAFVIFSSLSECKEFAEYYGLERIFEPQCVQMGGATEYQLPIPNIRPMPRPEAADD
Ga0181564_1036104733300018876Salt MarshRKQFLIELIFMFTFIGGKTMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0181562_1025481433300019459Salt MarshTNIRKQFLIELIFMFTFIGGKTMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0194029_107955023300019751FreshwaterMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND
Ga0181556_108857623300020176Salt MarshMTEPAFMAFVIFSSLSECKEFAEYYGLERIFEPQCVQMGGATEYQLPIPNIRPMPRPEAADD
Ga0211504_101785033300020347MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYKRPIPNIRPMPRPEVSND
Ga0213865_1001431443300021373SeawaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPIPRPEVSND
Ga0213869_1020421013300021375SeawaterMTEPTFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVADD
Ga0213861_1022574733300021378SeawaterMTEPAFMAFAIFSSLSVCEEFVEYYDLGRIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVADD
Ga0213868_10013660103300021389SeawaterMTEPTFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND
Ga0213866_1001786563300021425SeawaterMFTFIGGKTMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0222717_1012641533300021957Estuarine WaterMTEPAFMAFVIFSSLSHCKEFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEASDD
Ga0222718_1004584123300021958Estuarine WaterMTEPAFMAFVIFSSLSHCEEFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEASDD
Ga0222718_1021576033300021958Estuarine WaterMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEIADE
Ga0222718_1025621213300021958Estuarine WaterMTEPAFMAFVIFSSLSECKEFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPR
Ga0222716_1024269423300021959Estuarine WaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND
Ga0222716_1035914033300021959Estuarine WaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVKMGGAPEYQHPIPNIRPMPRPEVSND
Ga0222715_1022532133300021960Estuarine WaterMTEPAFMAFVIFSSLSHCKEFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPKPEDAND
Ga0222713_1052049723300021962Estuarine WaterMTEPAFMAFVIFSSLSHCKEFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEDADD
Ga0222719_1038523023300021964Estuarine WaterMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADE
Ga0212030_104203323300022053AqueousMTEPAFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEDYDD
Ga0196889_103786033300022072AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYKRPIPNIRPMPRPEVADE
Ga0212022_104352923300022164AqueousMTEPAFMAFVIFSSLSVCEEFAEYYDLERIFEPQCVQMSGAPEYQPPIPNTRPMQRPEASDD
Ga0212027_104265123300022168AqueousMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVSDD
Ga0224502_1024649013300022218SedimentMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMLRP
Ga0255771_102685913300022900Salt MarshMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMQRPE
Ga0255771_109290113300022900Salt MarshKQFLIELIFMFTFIGGKTMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0255756_130760223300022905Salt MarshEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0255779_111680013300022922Salt MarshIRKQFLIELIFMFTFIGGKTMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0255773_1009465143300022925Salt MarshRKQFLIELIFMFTFIGGKTMTEPAFMAFVIFSSLSECKEFAEYYGLERIFEPQCVQMGGATEYQLPIPNIRPMPRPEAADD
Ga0255773_1031798213300022925Salt MarshMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEAA
Ga0255758_1018649233300022928Salt MarshMTEPAFMAFVIFSSLSECKEFAEYYDLERIFEPQCVQMGGATEYQLPIPNIRPMPRPEAADD
Ga0228662_1000196393300024415SeawaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVHMGGAPEYQRPIPNIRPMPRPEVSND
(restricted) Ga0255049_1048454323300024517SeawaterMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIKPMPRPEVSND
Ga0208667_100012653300025070MarineMTLAEPAFMAFVVFSSIDECKEFSKYYDLQRIFEPQCIQMGGGVEYQRPIPNIRPKPRPQING
Ga0208667_1003427113300025070MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVADD
Ga0208667_102264333300025070MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYKRPIPNIRPMPRPEVADD
Ga0208791_105000323300025083MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVSND
Ga0209348_100024153300025127MarineMTEPAFMAFVIFSSLSECKDFAEYYDLERLFEPQCVQMGGPPEYQLPIPNIRPMPKPEASDD
Ga0208148_104219533300025508AqueousMTEPAFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPENYDD
Ga0208303_103520823300025543AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVSND
Ga0208660_103268743300025570AqueousMTEPAFMAFAIFSSLSVCEEFVEHYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPENYDD
Ga0208149_100437843300025610AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSDD
Ga0208134_115552423300025652AqueousFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND
Ga0208898_103270423300025671AqueousMTEPAFMAFVIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD
Ga0208898_104373323300025671AqueousMTEPAFMAFAIFSSLSVCEEFVEYYDLEKIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND
Ga0208162_103864833300025674AqueousMTEPAFMAFAIFSSLSVCEDFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPVPRPEVSND
Ga0208162_113152633300025674AqueousMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPEVADE
Ga0208899_103736033300025759AqueousMTEPAFMAFVIFSSLSDCKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPTPRPEVADD
Ga0208645_111905433300025853AqueousMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVSND
Ga0208645_130228823300025853AqueousMTEPAFMAFVIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQRPIPNIRPMPRPEVSND
Ga0209666_119274923300025870MarineMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMNGAPEYQRPIPNIRPMPRPEVADD
Ga0233450_1017718543300028115Salt MarshMTEPAFMAFVIFSSLSECKEFAEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPC
Ga0135227_101681523300029302Marine HarborMTEPAFMAFVIFSSLSECKDFAEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMPRPEVADD
Ga0316203_102743543300032274Microbial MatMTEPAFMAFAIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEYQLPIPNIRPMQRPENYDD
Ga0348337_036940_1621_17913300034418AqueousMAFVIFSSLSVCEEFVEYYDLERIFEPQCVQMGGAPEHQLPIPNIRPMPRPEVADD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.