NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065684

Metagenome / Metatranscriptome Family F065684

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065684
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 121 residues
Representative Sequence MAYIGAAPTYGVFDRQVLAGDGTTTQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEILTATSATSSTHIDEFNGNGSATAFTLTR
Number of Associated Samples 103
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.06 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 85.83 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.929 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(43.307 % of family members)
Environment Ontology (ENVO) Unclassified
(63.780 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(93.701 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 2.13%    β-sheet: 29.08%    Coil/Unstructured: 68.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00386C1q 0.79
PF03906Phage_T7_tail 0.79
PF16075DUF4815 0.79
PF13385Laminin_G_3 0.79



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.85 %
UnclassifiedrootN/A3.15 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000973|BBAY93_10056840All Organisms → Viruses → Predicted Viral1018Open in IMG/M
3300004097|Ga0055584_102443784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52528Open in IMG/M
3300004460|Ga0066222_1347129All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52510Open in IMG/M
3300004460|Ga0066222_1347130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52614Open in IMG/M
3300006735|Ga0098038_1131486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52844Open in IMG/M
3300006870|Ga0075479_10151125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52948Open in IMG/M
3300006874|Ga0075475_10262620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52722Open in IMG/M
3300007236|Ga0075463_10228263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52599Open in IMG/M
3300008012|Ga0075480_10558605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52545Open in IMG/M
3300009001|Ga0102963_1018808All Organisms → Viruses → Predicted Viral2917Open in IMG/M
3300009027|Ga0102957_1279629All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52608Open in IMG/M
3300009056|Ga0102860_1144211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52672Open in IMG/M
3300009423|Ga0115548_1237414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52561Open in IMG/M
3300009606|Ga0115102_10705289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52599Open in IMG/M
3300009790|Ga0115012_11410655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52595Open in IMG/M
3300010300|Ga0129351_1377353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52530Open in IMG/M
3300011258|Ga0151677_1115110All Organisms → Viruses → Predicted Viral1457Open in IMG/M
3300012920|Ga0160423_10049993All Organisms → Viruses → Predicted Viral3039Open in IMG/M
3300012954|Ga0163111_10755871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52922Open in IMG/M
3300012954|Ga0163111_11518363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52663Open in IMG/M
3300016751|Ga0182062_1205116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52604Open in IMG/M
3300016751|Ga0182062_1519771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52520Open in IMG/M
3300017706|Ga0181377_1015950All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium1705Open in IMG/M
3300017708|Ga0181369_1040542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521068Open in IMG/M
3300017709|Ga0181387_1050044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52831Open in IMG/M
3300017710|Ga0181403_1001380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales5764Open in IMG/M
3300017713|Ga0181391_1013680All Organisms → Viruses → Predicted Viral2067Open in IMG/M
3300017713|Ga0181391_1046823All Organisms → Viruses → Predicted Viral1027Open in IMG/M
3300017714|Ga0181412_1122083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52600Open in IMG/M
3300017717|Ga0181404_1003454All Organisms → Viruses → Predicted Viral4412Open in IMG/M
3300017717|Ga0181404_1148116All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52567Open in IMG/M
3300017719|Ga0181390_1010183All Organisms → Viruses → Predicted Viral3319Open in IMG/M
3300017719|Ga0181390_1038879All Organisms → Viruses → Predicted Viral1449Open in IMG/M
3300017720|Ga0181383_1211177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52514Open in IMG/M
3300017725|Ga0181398_1001875Not Available5959Open in IMG/M
3300017725|Ga0181398_1013962All Organisms → Viruses → Predicted Viral2030Open in IMG/M
3300017725|Ga0181398_1050492All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300017726|Ga0181381_1014541All Organisms → Viruses → Predicted Viral1821Open in IMG/M
3300017726|Ga0181381_1140572All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52502Open in IMG/M
3300017727|Ga0181401_1097335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52751Open in IMG/M
3300017731|Ga0181416_1053332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52955Open in IMG/M
3300017733|Ga0181426_1118145All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52533Open in IMG/M
3300017737|Ga0187218_1007147All Organisms → Viruses → Predicted Viral3081Open in IMG/M
3300017737|Ga0187218_1014694All Organisms → Viruses → Predicted Viral2076Open in IMG/M
3300017737|Ga0187218_1018603All Organisms → Viruses → Predicted Viral1825Open in IMG/M
3300017737|Ga0187218_1023965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521585Open in IMG/M
3300017739|Ga0181433_1008697All Organisms → Viruses → Predicted Viral2843Open in IMG/M
3300017746|Ga0181389_1039814All Organisms → Viruses → Predicted Viral1403Open in IMG/M
3300017748|Ga0181393_1044180All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521232Open in IMG/M
3300017749|Ga0181392_1022029All Organisms → Viruses → Predicted Viral2033Open in IMG/M
3300017749|Ga0181392_1036683All Organisms → Viruses → Predicted Viral1528Open in IMG/M
3300017749|Ga0181392_1056180All Organisms → Viruses → Predicted Viral1204Open in IMG/M
3300017749|Ga0181392_1136624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52721Open in IMG/M
3300017752|Ga0181400_1104643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52829Open in IMG/M
3300017755|Ga0181411_1050156All Organisms → Viruses → Predicted Viral1287Open in IMG/M
3300017755|Ga0181411_1061236All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521147Open in IMG/M
3300017757|Ga0181420_1051301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-20111322Open in IMG/M
3300017757|Ga0181420_1128356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52767Open in IMG/M
3300017757|Ga0181420_1130633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52758Open in IMG/M
3300017759|Ga0181414_1038645All Organisms → Viruses → Predicted Viral1285Open in IMG/M
3300017762|Ga0181422_1022547Not Available2062Open in IMG/M
3300017763|Ga0181410_1089748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52898Open in IMG/M
3300017763|Ga0181410_1090420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52894Open in IMG/M
3300017764|Ga0181385_1042449All Organisms → Viruses → Predicted Viral1423Open in IMG/M
3300017764|Ga0181385_1237389All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52547Open in IMG/M
3300017765|Ga0181413_1226730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52554Open in IMG/M
3300017768|Ga0187220_1264029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52514Open in IMG/M
3300017769|Ga0187221_1073271All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521071Open in IMG/M
3300017770|Ga0187217_1000969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales11873Open in IMG/M
3300017770|Ga0187217_1008733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae3753Open in IMG/M
3300017770|Ga0187217_1062240All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521291Open in IMG/M
3300017771|Ga0181425_1126081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52816Open in IMG/M
3300017776|Ga0181394_1024575All Organisms → Viruses → Predicted Viral2144Open in IMG/M
3300017776|Ga0181394_1074243All Organisms → Viruses → Predicted Viral1112Open in IMG/M
3300017779|Ga0181395_1104060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52908Open in IMG/M
3300017781|Ga0181423_1311926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52578Open in IMG/M
3300017782|Ga0181380_1248100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52591Open in IMG/M
3300017786|Ga0181424_10331108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52629Open in IMG/M
3300017951|Ga0181577_10726431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52603Open in IMG/M
3300017962|Ga0181581_10695618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52612Open in IMG/M
3300017968|Ga0181587_10917025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52541Open in IMG/M
3300017969|Ga0181585_10854400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52586Open in IMG/M
3300018041|Ga0181601_10499109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52635Open in IMG/M
3300018048|Ga0181606_10170449All Organisms → Viruses → Predicted Viral1291Open in IMG/M
3300018418|Ga0181567_10134645Not Available1710Open in IMG/M
3300018420|Ga0181563_10183955All Organisms → Viruses → Predicted Viral1287Open in IMG/M
3300019262|Ga0182066_1168283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52516Open in IMG/M
3300020173|Ga0181602_10362487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52580Open in IMG/M
3300020362|Ga0211488_10135618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52701Open in IMG/M
3300020404|Ga0211659_10107464All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521283Open in IMG/M
3300020424|Ga0211620_10327654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52651Open in IMG/M
3300020430|Ga0211622_10079428All Organisms → Viruses → Predicted Viral1426Open in IMG/M
3300020469|Ga0211577_10759298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52563Open in IMG/M
3300021364|Ga0213859_10412224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52597Open in IMG/M
3300021379|Ga0213864_10588949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52551Open in IMG/M
3300021957|Ga0222717_10501326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52653Open in IMG/M
3300021959|Ga0222716_10308219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52953Open in IMG/M
3300021960|Ga0222715_10020663All Organisms → Viruses → Predicted Viral4927Open in IMG/M
3300021964|Ga0222719_10665565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52594Open in IMG/M
3300022062|Ga0224901_100834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52734Open in IMG/M
3300022926|Ga0255753_1288243All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52642Open in IMG/M
3300023105|Ga0255782_10277920All Organisms → cellular organisms → Bacteria → Proteobacteria793Open in IMG/M
3300023699|Ga0228695_1053960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52569Open in IMG/M
3300023709|Ga0232122_1096620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52687Open in IMG/M
(restricted) 3300024255|Ga0233438_10269245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52665Open in IMG/M
3300024320|Ga0233398_1085690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52758Open in IMG/M
3300025101|Ga0208159_1029243All Organisms → cellular organisms → Bacteria1263Open in IMG/M
3300025108|Ga0208793_1063659All Organisms → Viruses → Predicted Viral1102Open in IMG/M
3300025120|Ga0209535_1002427Not Available12155Open in IMG/M
3300025840|Ga0208917_1202303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52661Open in IMG/M
3300025892|Ga0209630_10448654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52545Open in IMG/M
3300026138|Ga0209951_1130403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52506Open in IMG/M
3300026187|Ga0209929_1077632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52893Open in IMG/M
3300026418|Ga0247564_1082838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52525Open in IMG/M
3300026427|Ga0247556_1102660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52553Open in IMG/M
3300026460|Ga0247604_1038689All Organisms → Viruses → Predicted Viral1153Open in IMG/M
3300026470|Ga0247599_1119301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52550Open in IMG/M
3300027077|Ga0208941_1020910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52883Open in IMG/M
3300028109|Ga0247582_1132607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52644Open in IMG/M
3300028131|Ga0228642_1029447All Organisms → Viruses → Predicted Viral1569Open in IMG/M
3300028134|Ga0256411_1071785All Organisms → Viruses → Predicted Viral1186Open in IMG/M
3300028134|Ga0256411_1204518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52623Open in IMG/M
3300028196|Ga0257114_1119862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521047Open in IMG/M
3300028416|Ga0228614_1070036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52695Open in IMG/M
3300028419|Ga0228625_1119096All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED52507Open in IMG/M
3300031851|Ga0315320_10240360All Organisms → Viruses → Predicted Viral1316Open in IMG/M
3300032088|Ga0315321_10281233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → unclassified Candidatus Puniceispirillum → Candidatus Puniceispirillum sp. TMED521066Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater43.31%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh11.81%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater11.02%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.51%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.72%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.15%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water3.15%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.94%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.36%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.57%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.57%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.57%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.79%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.79%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.79%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.79%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.79%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.79%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000973Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93Host-AssociatedOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017962Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017968Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020362Marine microbial communities from Tara Oceans - TARA_A100001234 (ERX556035-ERR599049)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020424Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)EnvironmentalOpen in IMG/M
3300020430Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022062Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 (v2)EnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300023105Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaGEnvironmentalOpen in IMG/M
3300023699Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 81R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025892Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes)EnvironmentalOpen in IMG/M
3300026138Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026418Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 12R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026427Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 1R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026460Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027077Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028131Seawater microbial communities from Monterey Bay, California, United States - 53DEnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028416Seawater microbial communities from Monterey Bay, California, United States - 15DEnvironmentalOpen in IMG/M
3300028419Seawater microbial communities from Monterey Bay, California, United States - 30DEnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
BBAY93_1005684033300000973Macroalgal SurfaceMTDYIGAEPAYGVFQRQVLTGDGSTTQFNLDYAVAQPTSLMVVLDGVVQEPEYSYDTGIVSGQPVITFSEAPDAAGRASVIYMGRQLLTATSASTETHIDEFNGDGSTTAFTM
Ga0055584_10244378413300004097Pelagic MarineMAYIGAQPSYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPQITFSEAPDAAGRASIVYLGNEVLTATSATSETHIDEFNGDGSTLTFTLTRTPAANSAANFAVFVDNVYQR
Ga0066222_134712913300004460MarineMAYIGAEPSYGVFERQVITGDGTTTQYALDHTVASPTQLLVVLGGIVQEPEYSYSTSTTSGVSYINFSEAPDNGDRGSIVYMGRQLLTAAATNSNTHIDEFNGDGSTVAFTLTEVPASNTAENFMVF
Ga0066222_134713023300004460MarineMAYIGASPSYGVFDRQVLTGDGTLTAFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNGGRVSIVYLGNQILTATSATSETHIDEFNGDNSDTTFTLTRTP
Ga0098038_113148613300006735MarineMSDYIGATPSYGVFDRQVLTGNGTATTFNLDFMAPPSSLLVVLDGVVQEPEYSYTTSNISGQPQITFAEVVPNTARISIVFMGNELITAKPANSNTHMDEFNGDGSTVAFTLTRTPVATAENFVVFVDNVY
Ga0075479_1015112513300006870AqueousMADYIGAEPAYGVFQRQVLTGDGSTTQFNLDYAVAQPTSLMVVLDGVVQEPEYSYDTSIVNGQPVITFSEAPDAAGRASVIYMGRQLLTAQSANTETHIDEFNGDGSTTAFTMTRVP
Ga0075475_1026262013300006874AqueousMAYIGAQPSYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPQITFSEAPDAAGRASIVYLGNEVLTATSATSETHIDEFNGDGSTLTFTLTRTPAANSAANFAVFVDNVYQRYGASYSYTVVGSVLTFTS
Ga0075463_1022826323300007236AqueousMAYIGAQPSYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPQITFSEAPDAAGRASIVYLGNEVLTATSATSETHIDEFNGDGSTVAFTMTRTPAANNAANF
Ga0075480_1055860513300008012AqueousMAYIGASPSYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLVSGQPKITFSEAPDNGGRVSIVYLGNEVLTATPATSSTHIDEFNGDGSDTTFT
Ga0102963_101880843300009001Pond WaterMAYIGAEPSYGVFDRQVITGDGSTVSFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSITSGQPQITFSEAPDVDARVSIVYLGNELLTATPATSETHIDEFNGDGSTVAFTLTRTPAANNAANYAVFLDNVYQR
Ga0102957_127962923300009027Pond WaterMAYIGAQPSYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPQITFSEAPDAAGRASIVYLGNEVLTATSATSETHIDEFNGDNSTLTFTLTRTPAANS
Ga0102860_114421123300009056EstuarineMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKITFSEAPDNAGRISIIYLGNELLTATPAN
Ga0115548_123741423300009423Pelagic MarineMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRVSIVYLGNEVLTPTSATSET
Ga0115102_1070528913300009606MarineMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTRTPSANNA
Ga0115012_1141065513300009790MarineMAYIGASPTYGVFDRQVLTGDGSTTQFNLDHMAVPTSLLVVLDGVVQEPEHSYSTALVSGQPVINFSEAPDNSGRISIVYLGNELLTATSANSNTHIDEFNGNGSTTAFTLTRTPAANSAANYAVFIDNVYQRYGSSYAYTVTGTTI
Ga0129351_137735313300010300Freshwater To Marine Saline GradientMAYIGASPSYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLVSGQPKITFSQAPDNGGRVSIVYLGNEVLTATPATSSTHIDEFNGDGSDTTFTLTRTPAANAAQNFAVFVDN
Ga0151677_111511013300011258MarineMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNGGRISIVYLGNEVLTPTSATSETYIDEFNGTGSATTFTLTRTPAANNA
Ga0160423_1004999353300012920Surface SeawaterMAYIGASPTYGVFDRQVLTGDGSTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKIVFSEAPDNLGRISIIYLGNELLTPTPANSNTHIDEFNGDNNATAFTLTRTP
Ga0163111_1075587113300012954Surface SeawaterMSDYIGATPAYGVFDRQVITGNGTATTFNLDFMAPPSSLLVVLDGVVQEPEYSYTTSNISGQPQITFAEVVPNTARVSIVFMGNELITSTTANSNTHIDEFNGDGSTVAFTLTRTPVANAANFAVFVDNVYQRFGSSFAYTVTG
Ga0163111_1151836313300012954Surface SeawaterMAYIGASPTYGVFDRQVLTGDGTTTQFNLDHMAVPTSLLVVLDGIVQEPEHSYSTALSGGQPVINFSEAPDNLGRISIVYLGNELLTATSANSNTHIDEFDGNNNATAFTLTRTPAANSAANFAVFVDNVYQRYGSSYAYTVTGSTINFTSPPPTGT
Ga0182062_120511613300016751Salt MarshMADYIGATPSYGVFDRQIITGDGSTVAFNLDHMATPTALLVVLDGVVQEPEYSYSTSITSGQAQITFSEAPDVSARVSIVYLGNELLTATSATSETYIDEFNGDGSTVAFTLTRTPAANNAANYAVFVDNVYQRYGASYSYTVTGDVLTFTGAP
Ga0182062_151977113300016751Salt MarshMAYIGAQPSYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPKITFSEAPDAAGRASIVYLGNEVLTATSVNSNTHIDEFNGDGSTTAFT
Ga0181377_101595013300017706MarineMSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEFSYTTSNISGQPKITFSEVIPNTDRVSIVFMGNELITAKSANSNTHMDEFNGDG
Ga0181369_104054213300017708MarineMSDYIGATPSYGVFDRQVLTGNGTATTFNLDFMAPPSSLLVVLDGVVQEPEYSYTTSNISGQPQITFAEVVPNTARISIVFMGNELITAKPANSNTHMDEFNGDGSTVAFTLTRTPVASAANFVVFVDNVYQRFGSSFSYT
Ga0181387_105004433300017709SeawaterMSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEFSYTTSNISGQPKITFSEVIPNTDRVSIVFMGNELITAKSANSNTHMDEFNGDGSTVAFTLTRTPVATAENFVVFVDNVYQRFGSSFAYTVTGDVLTFTGAPTAGT
Ga0181403_100138013300017710SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEVLTATPATSSTHIDEFNGNNSATTFTLTRTPAANNAHNYVVFIDNVFQRYGSSYAYTVSG
Ga0181391_101368033300017713SeawaterMAYIGAAPTYGVFDRQVLAGDGTATQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRISIVYLGNEVLTATPATSSTHIDEFNGNGSATAFTLTRTPAA
Ga0181391_104682313300017713SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKIVFSEAPDNAGRISIIYLGNELLTATSANSNTHIDEFNGTG
Ga0181412_112208313300017714SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLAAGQPKITFSEAPDNGGRISIVYLGNEILTATPATSSTFIDEFNGDGSDTTFTLTRTPAANIAGNFVV
Ga0181404_100345483300017717SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKIVFSEAPDNAGRISIIYLGNELLTATSANSNTHIDEFNGTGSATAFTLTRTPAANTAANYAVFIDNVYQR
Ga0181404_114811623300017717SeawaterMSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEYSYTTSNISGQPKITFSEVIPNTDRVSIVFMGNELITAKSANSNTHMDEFNGDGSTVAFTLTRTPVATAENFVVFVDNVYQRFGSSFAY
Ga0181390_101018313300017719SeawaterMAYIGAAPSYGVFDRQVLTGNGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTRTPSANNAANFAVFVDNVYQRYGSSYAYTVVGATLTFTSAPP
Ga0181390_103887913300017719SeawaterMAYIGASPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEHSYSTNLTAGQPKITFSEAPDAGGRISIVYLGNEVLTATPATSSTHIDEFNGDGSDTTFTLT
Ga0181383_121117713300017720SeawaterMAYIGAEPSYGVFERQVITGDGTTTQYNLDHTVASPTQLLVVLGGIVQEPEYSYSVSTTSGVSKINFSEAPDNGDRGSIVYMGRQLLTAAATNSNTHIDEFNGNGSTTAFTLTEVPASNTAENFMVFVDNVYQRHGSGLAYTVSGST
Ga0181398_100187513300017725SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLAAGQPKITFSEAPDNGGRISIVYLGNEILTATPATSSTFID
Ga0181398_101396213300017725SeawaterMAYIGAAPTYGVFDRQVLAGDGTATQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRVSIVYLGNEVLTATSATSSTHIDEFNGNGS
Ga0181398_105049213300017725SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKIVFSEAPDNAGRISIVYLGNELLTATSANSNTHIDEFNGTGSATAFTLTRTPAANTAANYAVFIDNVYQRYGS
Ga0181381_101454113300017726SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDSGGRISIVYLGNEVLTATPATSSTHIDEFNGNGSATAFTLTRTPAANNAHNYVVFIDNVF
Ga0181381_114057223300017726SeawaterMSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEFSYTTSNISGQPKITFSEVIPNTDRVSIVFMGNELIT
Ga0181401_109733513300017727SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRVSIVYLGNEVLTATSATSSTHIDEFNGNGSAT
Ga0181416_105333213300017731SeawaterMSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEFSYTTSNISGQPKITFSEVIPNTDRVSIVFMGNELI
Ga0181426_111814523300017733SeawaterMSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEFSYTTSNISGQPKITFSEVIPNTDRVSIVFMGNE
Ga0187218_100714713300017737SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEVLTATPATSSTHIDEFNGNNSATTFTLTRTPAANNAHNYVVFIDNVFQRYGSSYAYTVSGATITFTS
Ga0187218_101469433300017737SeawaterMAYIGAAPTYGVFDRQVLAGDGTATQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRISIVYLGNEVLTATPATSSTHIDEFNGNGSATAFTLTRTPAANNA
Ga0187218_101860333300017737SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKIVFSEAPDNAGRISIIYLGNELLTATSANSNTHIDEFNGTGSATAFT
Ga0187218_102396533300017737SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEILTATSATSS
Ga0181433_100869743300017739SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRISIVYLGNEVLTATPATSSTHIDEFI
Ga0181389_103981423300017746SeawaterMAYIGATPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRVSIVYLGNEVLTATSATSSTHIDEFNGNGSATAFTLTRTPAANN
Ga0181393_104418013300017748SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEILTATSATSSTHIDE
Ga0181392_102202933300017749SeawaterMAYIGAAPTYGVFDRQVLAGDGTATQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRISIVYLGNEVLTATPATSSTHIDEFNGNGSA
Ga0181392_103668313300017749SeawaterMAYIGAAPTYGVFDRQVLAGDGTATQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEVLTATPATSSTHIDEFNGNNSATTFTLTRTPAANNAHNYVVFIDNVFQRYGSSYAYTVSGATITFTS
Ga0181392_105618033300017749SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRISIVYLGNEVLTATPATSSTHIDEFNGNGSA
Ga0181392_113662413300017749SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKITFSEAPDNAGRISIIYLGNELLTATSANSNTH
Ga0181400_110464323300017752SeawaterMAYIGAQPSYGVFDRQVLTGDGSTTTYNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLNSGQPQITFSEAPDAAGRASIVYLGNEVLTATSATSETHIDEFNGDNSTLTFTLTRTPSANNAAN
Ga0181411_105015623300017755SeawaterMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEFSYSTSISSGQPKITFSEAPDNAGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTRTPSANNAAN
Ga0181411_106123613300017755SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKITFSEAPDNAGRISIIYLGNELLTATPANSNTH
Ga0181420_105130133300017757SeawaterMSDYIGAAPSYGVFDRQVIIGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEYSYTTSNISGQPQITFSEAIPNTDRVSIVFMGNELITAKSANSNTHMDEFNGDGSTVAFTLTRTPVATAENFVVFVDNVYQRFGSSFA
Ga0181420_112835623300017757SeawaterMAYIGAAPTYGVFDRQVLAGDGTATQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRVSIVYLGNEVLTATSATSSTHIDEFNGNGSTTAFTLTRTPAANNAHNYVVFIDNVFQR
Ga0181420_113063313300017757SeawaterMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTRTPSANNAANFAVF
Ga0181414_103864513300017759SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRISIVYLGNEVLTATPATSSTHIDEFNGNGSAT
Ga0181422_102254713300017762SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKITFSEAPDNAGRISIIYLGNELLTATPANSNTHIDEFNGTGSATAFTLTRTPAANTAANYAVFIDNVYQRYGSSYAYTVTGSTINF
Ga0181410_108974823300017763SeawaterMAYIGAAPSYGVFDRQVLTGNGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTRTPS
Ga0181410_109042013300017763SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRVSIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTRTPS
Ga0181385_104244913300017764SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDAGGRISIVYLGNEVLTATSATSSTHIDEFNGNGSATAFT
Ga0181385_123738913300017764SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKIVFSEAPDNAGRISIIYLGNELLTATSANSNTHIDEFNGTGSATAFTLTRTPAANTAANYAVFIDNVYQRYGSSYAYTVTGSPIN
Ga0181413_122673023300017765SeawaterLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLT
Ga0187220_126402913300017768SeawaterMAYIGAEPSYGVFERQVITGDGTTTQYNLDHTVASPTQLLVVLGGIVQEPEYSYSVSTTSGVSKINFSEAPDNADRGSIVYMGRQLLTAAATNSNTHIDEFNGNGSTTAFTLTEVPASNTAENFMVFVDNVYQRHGSGLAYTVSGST
Ga0187221_107327133300017769SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKIVFSEAPDNAGRISIIYLGNELLTATSANSNTHIDEFNGTGSATAFTLTRTPAA
Ga0187217_100096913300017770SeawaterMSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEFSYTTSNISGQPKITFSEVIPNTDRVSIVFMGNELITAKSANSNTHMDEFNGDGSTVAFTLTRTPVATAENFVVFVDNVYQRFGSSFAYTVTG
Ga0187217_100873313300017770SeawaterMSDYIGAAPSYGVFDRQVIIGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEYSYTTSNISGQPQITFSEAIPNTDRVSIVFMGNELITAKSANSNTHMDEFNGDGSTVAFTLTRTPVATAENFVVFVDNVYQRFGSSFAYTVTG
Ga0187217_106224013300017770SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEILTATSATSSTHIDEFNGNGSATAFTLTRTPAANN
Ga0181425_112608133300017771SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKIVFSEAPDNAGRISIIYLGNELLTATSANSNTHIDEFNGTGSATAFTLTRTPAANTA
Ga0181394_102457543300017776SeawaterMAYIGASPTYGVFDRQVLAGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSNIAGQPKIVFSEAPDNAGRISIIYLGNELLTATSANSNTHIDEFNGTGSATAFTLTRTPAANTAANYAVFIDNVYQRYGSSYAYTVTGSTINFTSAPPSGTNN
Ga0181394_107424313300017776SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRVSIVYLGNEVLTATSATSSTHIDE
Ga0181395_110406013300017779SeawaterMAYIGASPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEVLTATSATSSTHIDEFNGNNSATTFTLTRTPAANNAHNYVVFIDNVFQRYGSSYAYTVSGATITFTS
Ga0181423_131192613300017781SeawaterMAYIGSQPAYGIFDIQNLAGDGTTTTFNLDYPVSQASALLVSLDGVIQEPVYSYDVGISGGQPKITFSEAPDNGGRVFITYMGRQLITPTPANTESHIDEFNGTGS
Ga0181380_124810023300017782SeawaterMAYIGAAPSYGVFDRQVLTGNGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRVSIVYLGNEVLTPTSATSE
Ga0181424_1033110813300017786SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEVLTATPATSSTHIDEFNGNNSATTFTLTRTPAANSAHNYVVFIDNVFQRYGSSYAYTV
Ga0181577_1072643123300017951Salt MarshMADYIGATPSYGVFDRQVITGDGSTVAFNLDHMATPTALLVVLDGVVQEPEYSYSTSITSGQAQITFSEAPDVSARVSIVYLGNELLTATAATSETHIDEFNGDGST
Ga0181581_1069561823300017962Salt MarshMADYIGATPSYGVFDRQVITGDGSTVAFNLDFMATPTALLVVLDGVVQEPEYSYSTSITSGQAQITFSEAPDASARVSIVYLGNELLTATSATSETYIDEFNGDGSTVAFTLTRTPAANNAANYAVFVDNVYQRYGA
Ga0181587_1091702513300017968Salt MarshMAYIGAQPSYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPKITFSEAPDAAGRASIVYLGNEVLTATSASSETHIDEFNGDG
Ga0181585_1085440013300017969Salt MarshMADYIGATPSYGVFDRQVITGDGSTVAFNLDFMATPTALLVVLDGVVQEPEYSYSTSITSGQAQITFSEAPDASARVSIVYLGNELLTATAATSETYIDEFNGDGSTVAFTLTRTPAANNAANYAVFVDNVYQ
Ga0181601_1049910913300018041Salt MarshMADYIGAEPAYGVFQRQVLTGDGSTTQFNLDYAVAQPTSLMVVLDGVVQEPEYSYDTSIVNGQPVITFSEAPDAAGRASVIYMGRQLLTAQSANTETHIDEFNGDGSTT
Ga0181606_1017044933300018048Salt MarshMSYIGTEPSYGVFQRQVLTGDGSTTQFNLDYPAPQATSLLVSLDGIIQEPEYSYDVAISNGQPVINFSAAPDASGRVFIVYMGRQLLTSTPANTETHIDEFNGDGSTTAFTLT
Ga0181567_1013464533300018418Salt MarshMADYIGATPSYGVFDRQVITGDGSTVAFNLDFMATPTALLVVLDGVVQEPEYSYSTSITSGQAQITFSEAPDASARVSIVYLGNELLTATAATSE
Ga0181563_1018395513300018420Salt MarshMAYIGAQPSYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPKITFSEAPDAAGRASIVYLGNEVLTATSANSNTHIDEFNG
Ga0182066_116828313300019262Salt MarshMADYIGATPSYGVFDRQVITGDGSTVAFNLDFMATPTALLVVLDGVVQEPEYSYDTSIVNGQPVITFSEAPDASARVSIVYLGNELLTATAATSETYIDEFNGDGSTVAFTLTRTPA
Ga0181602_1036248723300020173Salt MarshMAYIGAQPSYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPKITFSEAPDAAGRASIVYLGNEVLTATSASSETHIDEFNGDGSTLTFTLTRTPAANSAANF
Ga0211488_1013561813300020362MarineMAYIGASPTYGVFDRQVLTGDGTTTQFNLDHMAVPTSLLVVLDGIVQEPEHSYSTAMSGGQPKINFSEAPDNLGRISIVYLGNELLTATPATSNTHIDEFNGNNNTTAFTLTRTPAG
Ga0211659_1010746413300020404MarineMAYIGASPTYGVFDRQVLTGDGTTTQFNLDHMAVPTSLLVVLDGIVQEPEHSYSTALSGGQPVINFSEAPDNLGRISIVYLGNELLTATSANSNTHIDEFNGDNNATAFTLTRAPAANAAGNFAVFVDNVYQRYGSSYAYTVTGST
Ga0211620_1032765423300020424MarineMAYIGASPTYGVFDRQVLTGDGTTTQFNLDHMAVPTSLLVVLDGIVQEPEHSYSTALSGGQPVINFSEAPDNNGRISIVYLGNELLTATSATSNTHIDEFNGNNNTTAFTLTR
Ga0211622_1007942833300020430MarineMAYIGASPTYGVFDRQVLTGDGTTTQFNLDHMAVPTSLLVVLDGIVQEPEHSYSTALVSGQPKINFSEAPDNLGRISIVYLGNELLTATSANSQTHIDEFNGNNVLQAFTLTRTPAANQASNFAVFVDNVYQRYGSSYAYTVTGS
Ga0211577_1075929823300020469MarineMAYIGAAPTYGVFDRQVLAGDGTTTSFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLAAGQPKITFSEAPDNGGRISIVYLGNEILTATPATSSTFIDEFNGD
Ga0213859_1041222413300021364SeawaterMAYIGAQPTYGVFDRQVLTGDGTTTQYNLDHMAVPTSLLVVLDGVVQEPEHSYSTNLVSGQPVINFSEAPDANGRISIVYLGNEILTATSATSSTHIDEFNGNGSTTAFTLTRTPAANNAGNYAVFVDNVYQRYGS
Ga0213864_1058894913300021379SeawaterMADYIGATPSYGVFDRQVITGDGSTVAFNLDFMATPTALLVVLDGVVQEPEYSYSTSITSGQAQITFSEAPDASARVSIVYLGNELLTATAATSETYIDEFNGDGSTVAFTLTRTPAANNAANYAVFVDNVYQRYGASYSYTVTGDVLTFTGAP
Ga0222717_1050132613300021957Estuarine WaterMAYIGAEPSYGVFERQVITGDGTTTQFNLDHTVASPTQLLVVLGGIVQEPEYSYSVSTTSGVSKINFSEAPDNADRGSIVYMGRQLLTAAATNSNTHIDEFNGNGSTTAFTLTEVPASNTAENFMVFVDNVYQRHGT
Ga0222716_1030821913300021959Estuarine WaterMAYIGAQPTYGVFDRQVLTGDGSTTTYNLDHMAVPTSLLVVLDGVVQEPEYSYSTSNVAGQPKITFSQAPDAAGRISVVYLGNEVLTATPASSETHIDEFNGDGSTLTFTMTRTPAANSAANFAVFVDNVWQRYGSSYSY
Ga0222715_1002066313300021960Estuarine WaterMAYIGAQPTYGVFDRQVLTGDGSTTTYNLDHMAVPTSLLVVLDGVVQEPEYSYSTSNVAGQPKITFSQAPDAAGRISVVYLGNEVLTATPASSETHIDEFNGDGSTLTFTMTRTPAANSAANFAVFVDNVWQRYGSSYSYTVVGDVL
Ga0222719_1066556513300021964Estuarine WaterMAYIGAEPSYGVFDRQVITGDGSTVSFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSITSGQPQITFSEAPDVDARVSIVYLGNELLTATPATSETHIDEFNGDGSTVDFTLTRTPAAN
Ga0224901_10083413300022062SeawaterMAYIGASPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDSGGRISIVYLGNEVLTATPATSSTHIDEFNGNGSTTVFTLTRTPAANNAHNYVV
Ga0255753_128824313300022926Salt MarshMSYIGTEPSYGVFQRQVLTGDGSTTQFNLDYPAPQATSLLVSLDGIIQEPEYSYDVAISNGQPVINFSAAPDASGRVFIVYMGRQLLTSTPANTETHIDEFNGDGSTTAFTL
Ga0255782_1027792033300023105Salt MarshMADYIGATPSYGVFDRQVITGDGSTVAFNLDFMATPTALLVVLDGVVQEPEYSYSTSITSGQAQITFSEAPDASARVSIVYLGNELLTATAATSETYIDEFNG
Ga0228695_105396013300023699SeawaterMAYIGAAPSYGVFDRQVLTGNGTLTTFNLDHMAVPTSLLVVLDGVVQEPEFSYSTSISSGQPKITFSEAPDNAGRISIVYLGNEVLTPTSATSETHIDEFNGDNSDTTFTLTRTPAANTAANFAVFVDNVYQRYGSSYAYTV
Ga0232122_109662023300023709Salt MarshMAYIGAQPTYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPQITFSEAPDAAGRASIVYLGNEVLTATSANSNTHIDEFNGDGSTTAFTMTRTPAANTAENYAVFVDNVWQRYGSSYAYTATGSVITFTSAPPAG
(restricted) Ga0233438_1026924523300024255SeawaterMAYIGAAPSYGVFDRQVLTGDGTTTTYNLDHMAVPTSLLVVLDGVVQEPEHSYSTSISSGQPKITFSEAPDNNGRVSIVYLGNEVLTPTSATSETHIDE
Ga0233398_108569013300024320SeawaterMAYIGTEPTYGVFQRQVLAGNGTTTQYNLDYDVVQATSLLVSLDGVIQEPEYSYDVAITNGQPVINFSEAPDNGGRIFITYLGRQLLTATPANTESHIDEF
Ga0208159_102924333300025101MarineMSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLQGIVQEPEFSYTTSNISGQPQITFSEAIPNTDRVSIVFLGNELITA
Ga0208793_106365933300025108MarineMAYIGAAPTYGVFDRQVLAGDGTTTQFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLVSGQPKITFSEAPDNGGRVSIVYLGNEILTATSATSSTHIDEFNGNGSATAFTLTR
Ga0209535_1002427103300025120MarineMSDYIGATPSYGVFDRQVILGNGTATTFNLDFMAPPSSLLVVLNGIVQEPEYSYTTSNISGQPQITFSEAIPNTNRVSIVFMGNELITAKSANSNTHMDEFNGDNSTVAFTLTRTPVATAENFVVFVDNVYQRFGSSFAYTVSGDVLTFTGAPT
Ga0208917_120230323300025840AqueousMAYIGAQPSYGVFDRQVLTGDGSTTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSLSSGQPQITFSEAPDAAGRASIVYLGNEVLTATSANSNTHIDEFNGDGSTTAFTMTRAPAANTAENYAV
Ga0209630_1044865423300025892Pelagic MarineMSYIGAEPAYGVFQRQVLTGDGSTTQYNLDYAVAQPTSLLVSLDGVVQEPVYSYSTGIVSGQPVITFSEAPDSAGRVFIVYMGRQLLTSTPANTETH
Ga0209951_113040313300026138Pond WaterMADYIGAEPAYGVFQRQVLTGDGSTTQFNLDYAVAQPTSLMVVLDGVVQEPEYSYDTSIVNGQPVITFSEAPDAAGRASVIYMGRQLLTAQSANTETHIDEFN
Ga0209929_107763213300026187Pond WaterMAYIGAEPSYGVFDRQVITGDGSTVSFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSITSGQPQITFSEAPDVDARVSIVYLGNELLTATPATSETHIDEFNGDGSTVAF
Ga0247564_108283823300026418SeawaterMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITLSEAPDNNGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTR
Ga0247556_110266013300026427SeawaterMAYIGAAPSYGVFDRQVLTGDGSAVAFNLDHMAVPTSLLVVLDGVVQEPEFSYSTSISSGQPKITFSEAPDNAGRISIVYLGNEVLTPTSATSETHITSST
Ga0247604_103868913300026460SeawaterMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEFSYSTSISSGQPKITFSEAPDNAGRISIVYLGNEVLTPTSATSETHIDEFNGDHSDTTFTLTRTPSANNAANF
Ga0247599_111930113300026470SeawaterMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTRTP
Ga0208941_102091013300027077MarineMAYIGTEPTYGVFQRQVLAGNGTTTQYNLDYDVVQATSLLVSLDGVIQEPEYSYDVAITNGQPVINFSEAPDNGGRIFITYLGRQLLTATPANTESH
Ga0247582_113260723300028109SeawaterMAYIGTEPTYGVFQRQVLAGNGTTTQYNLDYDVVQATSLLVSLDGVIQEPEYSYDVAITNGQPVINFSEAPDNGGRIFITYLGRQLLTATPANTESHIDEFNGNGSTVAFTLTK
Ga0228642_102944713300028131SeawaterMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEFSYSTSISSGQPKITFSEAPDNAGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTRTPSANNAANFDVFVDNVYQR
Ga0256411_107178523300028134SeawaterMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRISIVYLGNEVLTPTSATSETHINEFN
Ga0256411_120451813300028134SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRVSIVYLGNEVLTATSATSSTHIDEFNGNGSATAFTLT
Ga0257114_111986213300028196MarineMAYIGTEPTYGVFQRQVLAGNGTTTQYNLDYDVVQATSLLVSLDGVIQEPEYSYDVAITNGQPVINFSEAPDNGGRIFITYLGRQLLTATPANTESHIDEFNGNGSTVAFTLTKTPVSNTADNFIVFVDNVYQRLGSS
Ga0228614_107003623300028416SeawaterMAYIGAAPSYGVFDRQVLTGDGTLTTFNLDHMAVPTSLLVVLDGVVQEPEYSYSTSISSGQPKITFSEAPDNNGRISIVYLGNEVLTPTSATSETHINEFNGTGSATTFTLTRTPSANNAANFAVFVDNVY
Ga0228625_111909613300028419SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSYNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLTAGQPKITFSEAPDNGGRVSIVYLGNEVLTATSATSSTHIDEFNGNGSATAFTLTRTPAANNAHNYVVFIDNVFQRYGSSYAYTVSG
Ga0315320_1024036013300031851SeawaterMAYIGTEPTYGVFQRQVLAGNGTTTQYNLDYDVVQATSLLVSLDGVIQEPEYSYDVAITNGQPVINFSEAPDNGGRIFITYLGRQLLTATPANTESHIDEFNGNGST
Ga0315321_1028123313300032088SeawaterMAYIGAAPTYGVFDRQVLAGDGTTTSFNLDHMAVPTSLLVVLDGVVQEPEYSYSTNLAAGQPKITFSEAPDNGGRISIVYLGNEILTATPATSSTFIDEFNGDGSDTTFTLTR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.