Basic Information | |
---|---|
Family ID | F065813 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 51 residues |
Representative Sequence | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKKQPQEGEIETPDVES |
Number of Associated Samples | 75 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 24.60 % |
% of genes near scaffold ends (potentially truncated) | 18.11 % |
% of genes from short scaffolds (< 2000 bps) | 94.49 % |
Associated GOLD sequencing projects | 59 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (74.016 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (51.968 % of family members) |
Environment Ontology (ENVO) | Unclassified (91.339 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (59.843 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.37% β-sheet: 3.92% Coil/Unstructured: 64.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF00149 | Metallophos | 0.79 |
PF00078 | RVT_1 | 0.79 |
PF00182 | Glyco_hydro_19 | 0.79 |
PF05105 | Phage_holin_4_1 | 0.79 |
PF02738 | MoCoBD_1 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.79 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.79 |
COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 74.02 % |
All Organisms | root | All Organisms | 25.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2027040000|ADn_FTWC1V110F5GI8 | Not Available | 525 | Open in IMG/M |
2027040000|ADn_FUOFX6F01AI7PV | Not Available | 536 | Open in IMG/M |
3300002168|JGI24712J26585_10064796 | Not Available | 1433 | Open in IMG/M |
3300002378|JGI24502J29692_10065362 | Not Available | 1431 | Open in IMG/M |
3300002837|bg3kmer60_1075310 | Not Available | 692 | Open in IMG/M |
3300002898|draft_10180659 | Not Available | 1254 | Open in IMG/M |
3300002898|draft_10191845 | Not Available | 1191 | Open in IMG/M |
3300003667|LSCM3L_1005516 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes | 3331 | Open in IMG/M |
3300003667|LSCM3L_1028614 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 910 | Open in IMG/M |
3300006376|Ga0079101_1341921 | Not Available | 918 | Open in IMG/M |
3300006381|Ga0079102_1356909 | Not Available | 674 | Open in IMG/M |
3300006389|Ga0079064_1381977 | Not Available | 565 | Open in IMG/M |
3300009588|Ga0116232_1175101 | Not Available | 538 | Open in IMG/M |
3300009589|Ga0116233_1085068 | Not Available | 506 | Open in IMG/M |
3300009589|Ga0116233_1230167 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1344 | Open in IMG/M |
3300009589|Ga0116233_1258537 | Not Available | 619 | Open in IMG/M |
3300009652|Ga0123330_1269072 | Not Available | 583 | Open in IMG/M |
3300009659|Ga0123328_1339772 | Not Available | 545 | Open in IMG/M |
3300009666|Ga0116182_1197522 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 896 | Open in IMG/M |
3300009666|Ga0116182_1289519 | Not Available | 679 | Open in IMG/M |
3300009666|Ga0116182_1359566 | Not Available | 583 | Open in IMG/M |
3300009666|Ga0116182_1377019 | Not Available | 564 | Open in IMG/M |
3300009669|Ga0116148_1448596 | Not Available | 503 | Open in IMG/M |
3300009670|Ga0116183_1171628 | Not Available | 1040 | Open in IMG/M |
3300009670|Ga0116183_1339998 | Not Available | 640 | Open in IMG/M |
3300009670|Ga0116183_1344742 | Not Available | 634 | Open in IMG/M |
3300009670|Ga0116183_1357182 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 619 | Open in IMG/M |
3300009671|Ga0123334_1136956 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1187 | Open in IMG/M |
3300009671|Ga0123334_1365871 | Not Available | 612 | Open in IMG/M |
3300009675|Ga0116149_1442456 | Not Available | 534 | Open in IMG/M |
3300009680|Ga0123335_1161857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1201 | Open in IMG/M |
3300009680|Ga0123335_1162700 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1196 | Open in IMG/M |
3300009680|Ga0123335_1308683 | Not Available | 759 | Open in IMG/M |
3300009680|Ga0123335_1341393 | Not Available | 707 | Open in IMG/M |
3300009681|Ga0116174_10326047 | Not Available | 731 | Open in IMG/M |
3300009681|Ga0116174_10408873 | Not Available | 630 | Open in IMG/M |
3300009681|Ga0116174_10476863 | Not Available | 571 | Open in IMG/M |
3300009682|Ga0116172_10377148 | Not Available | 672 | Open in IMG/M |
3300009685|Ga0116142_10178513 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1097 | Open in IMG/M |
3300009685|Ga0116142_10340773 | Not Available | 732 | Open in IMG/M |
3300009687|Ga0116144_10605723 | Not Available | 532 | Open in IMG/M |
3300009688|Ga0116176_10398907 | Not Available | 672 | Open in IMG/M |
3300009690|Ga0116143_10079593 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1937 | Open in IMG/M |
3300009693|Ga0116141_10226651 | Not Available | 1018 | Open in IMG/M |
3300009693|Ga0116141_10498133 | Not Available | 614 | Open in IMG/M |
3300009696|Ga0116177_10280360 | Not Available | 895 | Open in IMG/M |
3300009696|Ga0116177_10701662 | Not Available | 524 | Open in IMG/M |
3300009713|Ga0116163_1164854 | Not Available | 799 | Open in IMG/M |
3300009772|Ga0116162_10240567 | Not Available | 762 | Open in IMG/M |
3300009775|Ga0116164_10325549 | Not Available | 646 | Open in IMG/M |
3300009778|Ga0116151_10218013 | Not Available | 945 | Open in IMG/M |
3300009779|Ga0116152_10524719 | Not Available | 540 | Open in IMG/M |
3300009779|Ga0116152_10574799 | Not Available | 510 | Open in IMG/M |
3300009780|Ga0116156_10282989 | Not Available | 845 | Open in IMG/M |
3300009781|Ga0116178_10563963 | Not Available | 552 | Open in IMG/M |
3300009781|Ga0116178_10650879 | Not Available | 510 | Open in IMG/M |
3300009782|Ga0116157_10329842 | Not Available | 803 | Open in IMG/M |
3300009782|Ga0116157_10478568 | Not Available | 636 | Open in IMG/M |
3300009782|Ga0116157_10541808 | Not Available | 590 | Open in IMG/M |
3300009783|Ga0116158_10291040 | Not Available | 914 | Open in IMG/M |
3300010310|Ga0116235_1022819 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 816 | Open in IMG/M |
3300010310|Ga0116235_1204045 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1952 | Open in IMG/M |
3300010346|Ga0116239_11005763 | Not Available | 511 | Open in IMG/M |
3300010349|Ga0116240_10518566 | Not Available | 790 | Open in IMG/M |
3300010349|Ga0116240_10682461 | Not Available | 669 | Open in IMG/M |
3300010350|Ga0116244_10045866 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 3661 | Open in IMG/M |
3300010350|Ga0116244_10375309 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 954 | Open in IMG/M |
3300010350|Ga0116244_10410002 | Not Available | 904 | Open in IMG/M |
3300010351|Ga0116248_10723939 | Not Available | 701 | Open in IMG/M |
3300010353|Ga0116236_10710131 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 816 | Open in IMG/M |
3300010356|Ga0116237_11753248 | Not Available | 505 | Open in IMG/M |
3300010365|Ga0116251_10204701 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1184 | Open in IMG/M |
3300014203|Ga0172378_10615882 | Not Available | 799 | Open in IMG/M |
3300014203|Ga0172378_10629725 | Not Available | 788 | Open in IMG/M |
3300014204|Ga0172381_10625801 | Not Available | 821 | Open in IMG/M |
3300014204|Ga0172381_10810129 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 702 | Open in IMG/M |
3300014204|Ga0172381_10832438 | Not Available | 690 | Open in IMG/M |
3300014204|Ga0172381_11159627 | Not Available | 565 | Open in IMG/M |
3300014204|Ga0172381_11233967 | Not Available | 544 | Open in IMG/M |
3300014205|Ga0172380_10546916 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 851 | Open in IMG/M |
3300014205|Ga0172380_11047003 | Not Available | 577 | Open in IMG/M |
3300014206|Ga0172377_10571888 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 912 | Open in IMG/M |
3300014206|Ga0172377_11430728 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 519 | Open in IMG/M |
3300015214|Ga0172382_10456695 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 947 | Open in IMG/M |
3300015214|Ga0172382_10880503 | Not Available | 605 | Open in IMG/M |
3300019220|Ga0179936_1037962 | Not Available | 855 | Open in IMG/M |
3300019224|Ga0180029_1013891 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1864 | Open in IMG/M |
3300019226|Ga0179934_1106825 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella | 868 | Open in IMG/M |
3300019231|Ga0179935_1278028 | Not Available | 844 | Open in IMG/M |
3300019237|Ga0180028_1240259 | Not Available | 668 | Open in IMG/M |
3300019237|Ga0180028_1380775 | Not Available | 612 | Open in IMG/M |
3300019239|Ga0180030_1062303 | Not Available | 1412 | Open in IMG/M |
3300020072|Ga0180031_1002702 | Not Available | 1114 | Open in IMG/M |
3300025611|Ga0209408_1027926 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1813 | Open in IMG/M |
3300025611|Ga0209408_1127313 | Not Available | 647 | Open in IMG/M |
3300025611|Ga0209408_1147880 | Not Available | 582 | Open in IMG/M |
3300025611|Ga0209408_1175051 | Not Available | 516 | Open in IMG/M |
3300025737|Ga0208694_1141015 | Not Available | 846 | Open in IMG/M |
3300025748|Ga0208459_1129197 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 934 | Open in IMG/M |
3300025748|Ga0208459_1150392 | Not Available | 837 | Open in IMG/M |
3300025762|Ga0208040_1231607 | Not Available | 627 | Open in IMG/M |
3300025784|Ga0209200_1275746 | Not Available | 560 | Open in IMG/M |
3300025859|Ga0209096_1095474 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1233 | Open in IMG/M |
3300025866|Ga0208822_1252810 | Not Available | 620 | Open in IMG/M |
3300025871|Ga0209311_1270663 | Not Available | 649 | Open in IMG/M |
3300025882|Ga0209097_10192361 | Not Available | 877 | Open in IMG/M |
3300025882|Ga0209097_10266724 | Not Available | 693 | Open in IMG/M |
3300026311|Ga0209723_1025179 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 3557 | Open in IMG/M |
(restricted) 3300028564|Ga0255344_1039839 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2636 | Open in IMG/M |
3300028602|Ga0265294_10136769 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1876 | Open in IMG/M |
3300028602|Ga0265294_10174671 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1581 | Open in IMG/M |
3300028602|Ga0265294_10389978 | Not Available | 885 | Open in IMG/M |
3300028602|Ga0265294_10482849 | Not Available | 758 | Open in IMG/M |
3300028602|Ga0265294_10614937 | Not Available | 636 | Open in IMG/M |
3300028602|Ga0265294_10667287 | Not Available | 599 | Open in IMG/M |
3300028602|Ga0265294_10752295 | Not Available | 548 | Open in IMG/M |
3300028603|Ga0265293_10019564 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 7886 | Open in IMG/M |
3300028631|Ga0302241_1083812 | Not Available | 690 | Open in IMG/M |
3300029252|Ga0167179_1006782 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3196 | Open in IMG/M |
3300029252|Ga0167179_1054272 | Not Available | 660 | Open in IMG/M |
3300029255|Ga0168097_1020189 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin139 | 1747 | Open in IMG/M |
3300029255|Ga0168097_1060049 | Not Available | 740 | Open in IMG/M |
3300029288|Ga0265297_10974742 | Not Available | 505 | Open in IMG/M |
3300029311|Ga0167331_1068184 | Not Available | 653 | Open in IMG/M |
3300029311|Ga0167331_1072409 | Not Available | 621 | Open in IMG/M |
3300029942|Ga0168096_1063211 | Not Available | 682 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 51.97% |
Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 16.54% |
Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 10.24% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 7.09% |
Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 5.51% |
Coalbed Water | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water | 1.57% |
Wastewater | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Unclassified → Wastewater | 1.57% |
Biogas Fermenter | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter | 1.57% |
Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 1.57% |
Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 0.79% |
Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 0.79% |
Biogas Reactor | Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2027040000 | Wastewater viral communities from wastewater treatment facility in Singapore - AD-no assembly | Engineered | Open in IMG/M |
3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
3300002378 | Biogas fermentation microbial communities from Germany - Plant 3 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300002837 | Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer | Engineered | Open in IMG/M |
3300002898 | Metagenome Biopara biogasfermenter May 2013 pooled | Engineered | Open in IMG/M |
3300003667 | Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2)) | Environmental | Open in IMG/M |
3300006376 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1013_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006381 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1113_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006389 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300009588 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300009589 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300009652 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA | Engineered | Open in IMG/M |
3300009659 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA | Engineered | Open in IMG/M |
3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
3300009713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG | Engineered | Open in IMG/M |
3300009772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG | Engineered | Open in IMG/M |
3300009775 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG | Engineered | Open in IMG/M |
3300009778 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG | Engineered | Open in IMG/M |
3300009779 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC119_MetaG | Engineered | Open in IMG/M |
3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
3300009783 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG | Engineered | Open in IMG/M |
3300010310 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300010346 | AD_USMOca | Engineered | Open in IMG/M |
3300010349 | AD_HKTAca | Engineered | Open in IMG/M |
3300010350 | AD_HKSTca | Engineered | Open in IMG/M |
3300010351 | AD_USPNca | Engineered | Open in IMG/M |
3300010353 | AD_USCAca | Engineered | Open in IMG/M |
3300010356 | AD_USDEca | Engineered | Open in IMG/M |
3300010365 | AD_USDIca | Engineered | Open in IMG/M |
3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
3300019220 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC059_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019224 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-B RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019226 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC055_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019237 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-A RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019239 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-A RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300020072 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-B RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300025611 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025748 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025762 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025866 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025871 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025882 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
3300028631 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Arg | Engineered | Open in IMG/M |
3300029252 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP26 - Henriksdal-digested 138 | Engineered | Open in IMG/M |
3300029255 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP9 - Uppsala-digested 110 | Engineered | Open in IMG/M |
3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
3300029311 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP12 - Kappala-digested 113 | Engineered | Open in IMG/M |
3300029942 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP8 - Uppsala-digested 109 | Engineered | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
AD_na_3769130 | 2027040000 | Wastewater | ISFFGWFDVIIATPFAIYFGYKIIKWIISKLKKQPQEGEIETPDVES |
AD_na_4633370 | 2027040000 | Wastewater | MTPLISFFGWFDIFIATPFVLYFGYKGAKWIIGKLKKQPQEGEIETPDVES |
JGI24712J26585_100647964 | 3300002168 | Biogas Fermentantion | MIPLISFFGWFDIIIATPFLLYFGYRGVKWIIGKLKKQPQEGEIETPDVES* |
JGI24502J29692_100653624 | 3300002378 | Biogas Fermentantion | MIPLMKFFGWFDIIVVTPFVLYFGYKIIKWIIGKLKKQPQEGEIETPDVES* |
bg3kmer60_10753101 | 3300002837 | Biogas Reactor | MIPLISFFGWFDIIIATPFVLYFGYKIIKWIIGKLKKQPQEGEIETPDVES* |
draft_101806591 | 3300002898 | Biogas Fermenter | MTTLISFFGWFDIIIVTPFVLYFGYKIIKWIISKLKKQPQEGEIDTPDVES* |
draft_101918452 | 3300002898 | Biogas Fermenter | MIPLISFFGWFDIIIATPFAIYFGYKIIKWIIGKLKKQPQEGEIETHDVES* |
LSCM3L_10055167 | 3300003667 | Coalbed Water | MTPLISFFGWFDIIVVTPFVLYFGYKGVKWIIGKLKNKQPQEEIDTPDVES* |
LSCM3L_10286142 | 3300003667 | Coalbed Water | MTPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKNKQPQEGEIETPDVES* |
Ga0079101_13419212 | 3300006376 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKNKQPQEGEIDTPDVES* |
Ga0079102_13569092 | 3300006381 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFGYKGIKWIIGKLKNKQPQEGEIDTPDVES* |
Ga0079064_13819772 | 3300006389 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKIIKWIIGKLKKQPQEGEIDTPDVES* |
Ga0116232_10028741 | 3300009588 | Anaerobic Biogas Reactor | VVTPFVLYFGYKGVKWIIGKLKNKQPQEGEIETPDVES* |
Ga0116232_11751011 | 3300009588 | Anaerobic Biogas Reactor | KGGANMTLLMKFFGWLDVIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIETPDVES* |
Ga0116233_10850682 | 3300009589 | Anaerobic Biogas Reactor | MTLLMKFFGWFDVIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIDTPDVES* |
Ga0116233_12301671 | 3300009589 | Anaerobic Biogas Reactor | LDVIIATPFAIYLGYKIIKWIIGKLKNKQPQEGEIDTPDVES* |
Ga0116233_12585372 | 3300009589 | Anaerobic Biogas Reactor | KFFGWFDVIIATPFAIYLGYKIIKWIIGKLKNKQPQEGEIETPDVES* |
Ga0123330_12690722 | 3300009652 | Anaerobic Biogas Reactor | MTPLMKFFGWLDVIIATPFAIYLGYKIIKWIIGKLKNKQPQEGEIETPDVES* |
Ga0123328_13397722 | 3300009659 | Anaerobic Biogas Reactor | MIPLMKFFGWLDVIIATPFAIYLGYKIIKWIIGKLKNKQPQEGEIETPDVES* |
Ga0116182_11975222 | 3300009666 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKNKQPQEEIDTPDVES* |
Ga0116182_12895191 | 3300009666 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIVVTPFVLYFGYKIIKWIIGKLKNKQPQEEIETPD |
Ga0116182_13595662 | 3300009666 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKKQPQEGEIETPDVES* |
Ga0116182_13770192 | 3300009666 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIETPDVES* |
Ga0116148_14485962 | 3300009669 | Anaerobic Digestor Sludge | MIALSFFGWWLSLWDFLILLPFAIYFGYKGIKWIIGKLKNKQPQEGEIDTPDVES* |
Ga0116183_11716281 | 3300009670 | Anaerobic Digestor Sludge | QMTTLISFFGWFDIIIATPFVLYFGYKIIKWLIGKLKKQPQEGEIETPDVES* |
Ga0116183_13399983 | 3300009670 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIVVTPFVLYFGYKGIKWIIGKLKKQPQEKIETPDVES* |
Ga0116183_13447422 | 3300009670 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKGVKWLIGKLKKQPQEGEIETPDVES* |
Ga0116183_13571822 | 3300009670 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIVVTPFVLYFGYKGIKWIIGKLKKQPQEGEIETPDVES* |
Ga0123334_11369562 | 3300009671 | Anaerobic Biogas Reactor | MIPLMKFFGWFDVIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIDTPDVES* |
Ga0123334_13658712 | 3300009671 | Anaerobic Biogas Reactor | MIPLISFFGWFDIIVVTPFVLYFGYKGIKWIIGKLKKQPQEEIETPDVES* |
Ga0116149_14424562 | 3300009675 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKGIKWIIGKLKNKQPQEGEIDTPDVES* |
Ga0123335_11618572 | 3300009680 | Anaerobic Biogas Reactor | MTPLISFFGWFDIIVVTPFVLYFGYKGVKWIIGKLKKQPQEGEIETPDVES* |
Ga0123335_11627003 | 3300009680 | Anaerobic Biogas Reactor | MTPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKKQPQEGEIETPDVES* |
Ga0123335_13086832 | 3300009680 | Anaerobic Biogas Reactor | MTPLISFFGWFDIIVVTPFVLYFGYKGIRWIIGKLKKQPQEGEIETPDVES* |
Ga0123335_13413931 | 3300009680 | Anaerobic Biogas Reactor | MKFFGWLDVIIATPFAIYLGYKIIKWIIGKLKNKQPQEGEIETPDVES* |
Ga0116174_103260471 | 3300009681 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFVYKGVKWIIGKLKKQPQEGEIETPDAES* |
Ga0116174_104088732 | 3300009681 | Anaerobic Digestor Sludge | MTTLISFFGWFDIIVVTPFVLYFGYKGIKWIIGKLKKQPQEEIDTPDVES* |
Ga0116174_104768633 | 3300009681 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFGYKIIKWIIGKLKKQPQE |
Ga0116172_103771482 | 3300009682 | Anaerobic Digestor Sludge | MTTLISFFGWFDIIVVTPFVLYFGYKIIKWIIGKLKKQPQEGEIETPDVES* |
Ga0116142_101785132 | 3300009685 | Anaerobic Digestor Sludge | MIALSFFGWWLSLWDFLILLPFAIYFGYKGVKWIIGKLKNKQPQEGEIDTPDVES* |
Ga0116142_103407733 | 3300009685 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKGVKWIIGKLKKQPQEGEIETPDAES* |
Ga0116144_106057232 | 3300009687 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKKQPQEGEIDTPDVES* |
Ga0116176_103989072 | 3300009688 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIETPDAES* |
Ga0116143_100795934 | 3300009690 | Anaerobic Digestor Sludge | MTPLISFFGWFDVIIATPFVLYFGYKGVKWIIGKLKNKQPQEEIDTPDVES* |
Ga0116141_102266512 | 3300009693 | Anaerobic Digestor Sludge | MIPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKNKQPQEGEIETPDAES* |
Ga0116141_104981332 | 3300009693 | Anaerobic Digestor Sludge | MTTLISFFGWFDIIVVNPFVLYFGYKGIKWIIGKLKKQPQEEIETPDVES* |
Ga0116177_102803603 | 3300009696 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKNKQPQEGEIDTPDVES* |
Ga0116177_107016621 | 3300009696 | Anaerobic Digestor Sludge | FFGWFDIIIATPFAIYLGYKGVKWIIGKLKKQPQEGEIETPDVES* |
Ga0116163_11648541 | 3300009713 | Anaerobic Digestor Sludge | MIPLMKFFGWFDIIIATPFVLYFGYKGVKWIIGKLKKQPQEGEIETPDVES* |
Ga0116162_102405674 | 3300009772 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKGVKWIIGKLKKQPQEGEI |
Ga0116164_103255492 | 3300009775 | Anaerobic Digestor Sludge | MIPLMKFFGWFDVIIATPFAIYFGYKIIKWIIGKLKKQPQEGEIETPDVES* |
Ga0116151_102180133 | 3300009778 | Anaerobic Digestor Sludge | MTPLMKFFGWWLSLWDFLILLPFAIYFGYKGVKWIIGKLKNKQPQEKIETPDVES* |
Ga0116152_105247192 | 3300009779 | Anaerobic Digestor Sludge | MILMKFFGWFDIIIATPFVLYFGYKGVKWIIGKLKKQPQEGEIETPDVES* |
Ga0116152_105747992 | 3300009779 | Anaerobic Digestor Sludge | MIPLISFFGWFDIIVVTPFVLYFGYKGIKWIIGKLKKQPQEEIDTPDVES* |
Ga0116156_102829891 | 3300009780 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKNKQPQEEIDTPDVES* |
Ga0116178_105639632 | 3300009781 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKGVKWIIGKLKNKQPQEEIDTPDVES* |
Ga0116178_106508791 | 3300009781 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKNKQPQEEIDTP |
Ga0116157_103298421 | 3300009782 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKGVKWIIGKLKNKQPQEGEIDTPDVES* |
Ga0116157_104785682 | 3300009782 | Anaerobic Digestor Sludge | MIALSFFGWWLSLWDFLILLPFAIYFGYKGIKWIIGKLKNKQPQEGEID |
Ga0116157_105418082 | 3300009782 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKIIKWIIGKLKNKQPQEKIETPDVES* |
Ga0116158_102910403 | 3300009783 | Anaerobic Digestor Sludge | MIALSFFGWWLSLWDFLILLPFAIYFGYKGIKWIIGKLKNKQPQEKIETPDVES* |
Ga0116235_10228192 | 3300010310 | Anaerobic Biogas Reactor | MTPLMKFFGWLDVIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIDTPDVES* |
Ga0116235_12040453 | 3300010310 | Anaerobic Biogas Reactor | MIPLMKFFGWFDIIVVTPFVLYFGYKGVKWIIGKLKNKQPQEGEIETPDVES* |
Ga0116239_110057632 | 3300010346 | Anaerobic Digestor Sludge | TPLISFFGWFDIIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIETPDAES* |
Ga0116240_105185661 | 3300010349 | Anaerobic Digestor Sludge | MIALSFFGWWLSLWDFLILLPFAIYFGYKGVKWIINKLKNKQPQEEIETPDVES* |
Ga0116240_106824613 | 3300010349 | Anaerobic Digestor Sludge | MIPLISFFGWFDIIIATPFVLYFGYKGVKWIINKLKNKQPQEGEIETPDVES* |
Ga0116244_100458666 | 3300010350 | Anaerobic Digestor Sludge | MIPLMKFFGWFDIIIATPFVLYFGYKGIKWIIGKLKKQPQEGEIETPDVES* |
Ga0116244_103753093 | 3300010350 | Anaerobic Digestor Sludge | MIPLMKFFGWFDIIVVTPFVLYFGYKGIKWIIGKLKKQPQEEIETPDVES* |
Ga0116244_104100022 | 3300010350 | Anaerobic Digestor Sludge | MIPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKNKQPQEGEIETPDVES* |
Ga0116248_107239391 | 3300010351 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIVVTPFVLYFGYKIIKWIIGKLKKQPQEGEIETPDVES* |
Ga0116236_107101312 | 3300010353 | Anaerobic Digestor Sludge | IPLISFFGWFDIIVVTPFVLYFGYKGVKWIIGKLKNKQPQEGEIETPDVES* |
Ga0116237_117532482 | 3300010356 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKNKQPQEG |
Ga0116251_102047013 | 3300010365 | Anaerobic Digestor Sludge | MTTLISFFGWFDIIIATPFVLYFGYKIIKWLIGKLKKQPQEGEIETPDVES* |
Ga0172378_106158821 | 3300014203 | Groundwater | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKKQPQEGEIDTPDVES* |
Ga0172378_106297251 | 3300014203 | Groundwater | MIPLISFFGWFDVIIATPFAIYFGYKGIKWIIGKLKKQPQEGEIETPDVES* |
Ga0172381_106258011 | 3300014204 | Landfill Leachate | MIPLISFFGWFDIIIATPFAIYFGYKGIKWIIGKLKNKQPQEEIDTPDVES* |
Ga0172381_108101291 | 3300014204 | Landfill Leachate | PLISFFGWFDIIIATPFAIYLGYKGVKWIIGKLKNKQPQEGEIDTPDVES* |
Ga0172381_108324383 | 3300014204 | Landfill Leachate | MTPLMKFFGWWLSLWDFLILLPFAIYFGYKGVKWLIGKLKNKQPQEEIDTPDVES* |
Ga0172381_111596272 | 3300014204 | Landfill Leachate | MIPLISFFGWFDVIVVTPFVLYFGYKGIKWIIGKLKNKQPQEGEIETPDVES* |
Ga0172381_112339671 | 3300014204 | Landfill Leachate | MTPLISFFGWFDIITATPFAIYFGYKGVKWIIGKLKNKQPQEEIDTPDVES* |
Ga0172380_105469161 | 3300014205 | Landfill Leachate | PLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKKQPQEGEIETPDAES* |
Ga0172380_110470032 | 3300014205 | Landfill Leachate | MTLLISFFGWFDVIIATPFAIYLGYKGIKWIIGKLKKQPQEGEIETPDVES* |
Ga0172377_105718882 | 3300014206 | Landfill Leachate | MTPLISFFGWFDIIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIETHDVES* |
Ga0172377_114307281 | 3300014206 | Landfill Leachate | MILLMKFFGWWLSLWDFLILLPFAIYFGYKGVKWIIGKLKKQPQEGEIDTPDVES* |
Ga0172382_104566952 | 3300015214 | Landfill Leachate | MILLMKFFGWLDVIIATPFAIYFGYKGIKWIIGKLKKQPQEGEIDTPDVES* |
Ga0172382_108805032 | 3300015214 | Landfill Leachate | MTLLISFFGWFDVIIATPFAIYLGYKGIKWIIGKLKKQPQEGEIETHDVES* |
Ga0179936_10379622 | 3300019220 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKKQPQEGEIETPDVES |
Ga0180029_10138914 | 3300019224 | Anaerobic Biogas Reactor | MIPLMKFFGWFDVIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIDTPDVES |
Ga0179934_11068254 | 3300019226 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIDTPDVES |
Ga0179935_12780283 | 3300019231 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKIIKWIIGKLKKQPQEGEIETPDVES |
Ga0180028_12402592 | 3300019237 | Anaerobic Biogas Reactor | MIPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKNKQPQEGEIDTPDVES |
Ga0180028_13807751 | 3300019237 | Anaerobic Biogas Reactor | MIPLISFFGWFDIIVVTPFVLYFGYKGVKWIIGKLKNKQPQEEIETPDVES |
Ga0180030_10623033 | 3300019239 | Anaerobic Biogas Reactor | MTPLISFFGWFDIIIATPFAIYLGYKIIKWIIGKHKNKQPQEGEIETPDVES |
Ga0180031_10027023 | 3300020072 | Anaerobic Biogas Reactor | MTPLMKFFGWLDVIIATPFAIYLGYKIIKWIIGKLKNKQPQEGEIETPDVES |
Ga0209408_10279265 | 3300025611 | Anaerobic Digestor Sludge | MIPLMKFFGWFDIIIATPFVLYFGYKGIKWIIGKLKKQPQEGEIETPDVES |
Ga0209408_11273131 | 3300025611 | Anaerobic Digestor Sludge | MIPLMKFFGWFDVIIATPFAIYFGYKIIKWIIGKLKKQPQEGEIETPDVES |
Ga0209408_11478802 | 3300025611 | Anaerobic Digestor Sludge | MIPLISFFGWFDIIIATPFVLYFGYKGVKWIINKLKNKQPQEGEIETPDVES |
Ga0209408_11750511 | 3300025611 | Anaerobic Digestor Sludge | MTPLMKFFGWWLSLWDFLILLPFAIYFGYKGVKWLIGKLKNKQPQEKIETPDVES |
Ga0208694_11410152 | 3300025737 | Anaerobic Digestor Sludge | MTTLISFFGWFDIIIATPFVLYFGYKIIKWLIGKLKKQPQEGEIETPDVES |
Ga0208459_11291973 | 3300025748 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKIIKWIIGKLKKQPQEGEIETPDVES |
Ga0208459_11503922 | 3300025748 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKNKQPQEGEIETPDVES |
Ga0208040_12316073 | 3300025762 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFVLYFGYKGVKWIIGKLKKQPQEGEIETPDVES |
Ga0209200_12757462 | 3300025784 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKGVKWIIGKLKKQPQEGEIETPDAES |
Ga0209096_10954743 | 3300025859 | Anaerobic Digestor Sludge | MTPLISFFGWFDVIIATPFVLYFGYKGVKWIIGKLKNKQPQEEIDTPDVES |
Ga0208822_12528103 | 3300025866 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYLGYKGVKWIIGKLKKQPQEGEIDTPDVES |
Ga0209311_12706631 | 3300025871 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKNKQPQEGEIDT |
Ga0209097_101923612 | 3300025882 | Anaerobic Digestor Sludge | MIALSFFGWWLSLWDFLILLPFAIYFGYKGIKWIIGKLKNKQPQEKIETPDVES |
Ga0209097_102667241 | 3300025882 | Anaerobic Digestor Sludge | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKNKQPQEKIETPDVE |
Ga0209723_10251794 | 3300026311 | Anaerobic Biogas Reactor | MTPLISFFGWFDIIVVTPFVLYFGYKGVKWIIGKLKKQPQEGEIETPDVES |
(restricted) Ga0255344_10398394 | 3300028564 | Wastewater | MTPLISFFGWFDIIVVTPFVLYFGYKGVKWIIGKLKNKQPQEGEIETPDVES |
Ga0265294_101367695 | 3300028602 | Groundwater | MTPLISFFGWFDIIIATPFAIYLGYKGVKWIIGKLKNKQPQEEIDTPDVES |
Ga0265294_101746714 | 3300028602 | Groundwater | QMIPLISFFGWFDIIVVTPFVLYFGYKGIKWIIGKLKKQPQEEIDAPDAES |
Ga0265294_103899782 | 3300028602 | Groundwater | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKNKQPQEEIDTPDVES |
Ga0265294_104828493 | 3300028602 | Groundwater | MIPLISFFGWFDVIIATPFAIYFGYKGIKWIIGKLKKQPQEGEIETPDVES |
Ga0265294_106149372 | 3300028602 | Groundwater | MTPLISFFGWFDIIIATPFAIYFGYKGVKWIIGKLKKQPQEGEIETPDAES |
Ga0265294_106672872 | 3300028602 | Groundwater | MKFFGWLDVIIATPFAIYFGYKGIKWIIGKLKKQPQEGEIETPDVES |
Ga0265294_107522952 | 3300028602 | Groundwater | MKFFGWLDVIVVTPFVLYFGYKGIKWIIGKLKNKQPQEEIETPDVES |
Ga0265293_100195644 | 3300028603 | Landfill Leachate | MILLMKFFGWLDVIIATPFAIYFGYKGIKWIIGKLKKQPQEGEIDTPDVES |
Ga0302241_10838122 | 3300028631 | Activated Sludge | MTPLISFFGWFDIIIATPFAIYFGYKIIKWIIGKLKKQPQEGEIDTPDVES |
Ga0167179_10067826 | 3300029252 | Biosolids | SFFGWFDIIIATPFVLYFGYKGVKWIIGKLKKQPQEGEIETPDVES |
Ga0167179_10542721 | 3300029252 | Biosolids | MIPLISFFGWFDIIVVTPFVLYFGYKGVKWIIGKLKKQPQEGEIDTPDAE |
Ga0168097_10201892 | 3300029255 | Biosolids | MIALSFFGWWLSLWDFLILLPFAIYFGYKGVKWIIGKLKNKQPQEEIDTPDVES |
Ga0168097_10600491 | 3300029255 | Biosolids | MTTLISFFGWFDVIIATPFAIYLGYKGIKWIIGKLKNKQPQEGEIDT |
Ga0265297_109747422 | 3300029288 | Landfill Leachate | MIPLISFFGWFDIIVVTPFVLYFGYKGIKWIIGKLKKQPQEGEIDTPDVES |
Ga0167331_10681841 | 3300029311 | Biosolids | MIALSFFGWWLSLWDFLILLPFAIYFGYKGVKWIIGKLKNKQPQEEIDTP |
Ga0167331_10724092 | 3300029311 | Biosolids | MIPLISFFGWFDIIVVTPFVLYFGYKGIKWIIGKLKKQPQEGEIETPDVES |
Ga0168096_10632112 | 3300029942 | Biosolids | MIPLISFFGWFDIIVVTPFVLYFGYKGVKWIIGKLKNKQPQEEIDTPDVES |
⦗Top⦘ |