Basic Information | |
---|---|
Family ID | F065824 |
Family Type | Metagenome |
Number of Sequences | 127 |
Average Sequence Length | 43 residues |
Representative Sequence | MNRNKHLALAALGFFLTGCTGMTKNQAALVGAATCGAMGAA |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 89.76 % |
% of genes from short scaffolds (< 2000 bps) | 77.95 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (52.756 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.598 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.346 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.220 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 49.28% β-sheet: 0.00% Coil/Unstructured: 50.72% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF01741 | MscL | 18.11 |
PF00196 | GerE | 13.39 |
PF01435 | Peptidase_M48 | 8.66 |
PF08239 | SH3_3 | 2.36 |
PF04357 | TamB | 1.57 |
PF01464 | SLT | 1.57 |
PF07730 | HisKA_3 | 0.79 |
PF01040 | UbiA | 0.79 |
PF03160 | Calx-beta | 0.79 |
PF02954 | HTH_8 | 0.79 |
PF12836 | HHH_3 | 0.79 |
PF00722 | Glyco_hydro_16 | 0.79 |
PF02518 | HATPase_c | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 18.11 |
COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 1.57 |
COG2273 | Beta-glucanase, GH16 family | Carbohydrate transport and metabolism [G] | 0.79 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.79 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.79 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.79 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.76 % |
Unclassified | root | N/A | 47.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000443|F12B_12116765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 869 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1077822 | Not Available | 583 | Open in IMG/M |
3300000787|JGI11643J11755_11028101 | Not Available | 628 | Open in IMG/M |
3300000787|JGI11643J11755_11666124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1791 | Open in IMG/M |
3300000789|JGI1027J11758_12430674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
3300000858|JGI10213J12805_10040725 | Not Available | 538 | Open in IMG/M |
3300000890|JGI11643J12802_10972070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
3300000955|JGI1027J12803_102549983 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300000956|JGI10216J12902_103543450 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300002124|C687J26631_10241140 | Not Available | 599 | Open in IMG/M |
3300003890|Ga0063162_1070900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
3300003987|Ga0055471_10205398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
3300003994|Ga0055435_10188627 | Not Available | 589 | Open in IMG/M |
3300004071|Ga0055486_10032323 | Not Available | 969 | Open in IMG/M |
3300004157|Ga0062590_102185631 | Not Available | 579 | Open in IMG/M |
3300004479|Ga0062595_101733830 | Not Available | 590 | Open in IMG/M |
3300004480|Ga0062592_101254533 | Not Available | 696 | Open in IMG/M |
3300005172|Ga0066683_10465952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
3300005172|Ga0066683_10566135 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300005366|Ga0070659_100167257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1800 | Open in IMG/M |
3300005526|Ga0073909_10011333 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
3300005549|Ga0070704_100607632 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300005556|Ga0066707_10079550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1974 | Open in IMG/M |
3300005564|Ga0070664_100548621 | Not Available | 1069 | Open in IMG/M |
3300005713|Ga0066905_102061410 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005719|Ga0068861_101967064 | Not Available | 583 | Open in IMG/M |
3300005841|Ga0068863_100308477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1536 | Open in IMG/M |
3300006049|Ga0075417_10378266 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300006358|Ga0068871_101305837 | Not Available | 682 | Open in IMG/M |
3300006358|Ga0068871_101425670 | Not Available | 653 | Open in IMG/M |
3300006844|Ga0075428_102465227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 533 | Open in IMG/M |
3300006845|Ga0075421_102179472 | Not Available | 585 | Open in IMG/M |
3300006845|Ga0075421_102234693 | Not Available | 577 | Open in IMG/M |
3300006846|Ga0075430_100496208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1007 | Open in IMG/M |
3300006852|Ga0075433_10260174 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300006871|Ga0075434_100552797 | Not Available | 1171 | Open in IMG/M |
3300006880|Ga0075429_101885927 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300006894|Ga0079215_10665924 | Not Available | 695 | Open in IMG/M |
3300006903|Ga0075426_11460886 | Not Available | 520 | Open in IMG/M |
3300006914|Ga0075436_100398416 | Not Available | 997 | Open in IMG/M |
3300007004|Ga0079218_13642023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
3300007076|Ga0075435_101205250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 662 | Open in IMG/M |
3300009012|Ga0066710_100358988 | Not Available | 2157 | Open in IMG/M |
3300009094|Ga0111539_10113696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3175 | Open in IMG/M |
3300009156|Ga0111538_14120908 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300009176|Ga0105242_10114848 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
3300010047|Ga0126382_10424633 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300010047|Ga0126382_11252622 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300010323|Ga0134086_10022426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2032 | Open in IMG/M |
3300010335|Ga0134063_10155382 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300010362|Ga0126377_10115994 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
3300010375|Ga0105239_12971493 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300010396|Ga0134126_11745457 | Not Available | 683 | Open in IMG/M |
3300010400|Ga0134122_10318070 | Not Available | 1343 | Open in IMG/M |
3300010400|Ga0134122_11618161 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300011438|Ga0137451_1098510 | Not Available | 890 | Open in IMG/M |
3300011444|Ga0137463_1153635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 866 | Open in IMG/M |
3300012355|Ga0137369_10832715 | Not Available | 626 | Open in IMG/M |
3300012914|Ga0157297_10321028 | Not Available | 591 | Open in IMG/M |
3300012927|Ga0137416_12124813 | Not Available | 516 | Open in IMG/M |
3300012958|Ga0164299_10024250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2540 | Open in IMG/M |
3300012972|Ga0134077_10029964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus | 1926 | Open in IMG/M |
3300012985|Ga0164308_12062886 | Not Available | 531 | Open in IMG/M |
3300013308|Ga0157375_13251677 | Not Available | 542 | Open in IMG/M |
3300014325|Ga0163163_10764484 | Not Available | 1029 | Open in IMG/M |
3300015264|Ga0137403_10110002 | All Organisms → cellular organisms → Bacteria | 2758 | Open in IMG/M |
3300015358|Ga0134089_10276151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 693 | Open in IMG/M |
3300015373|Ga0132257_103915910 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300016422|Ga0182039_10134326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1889 | Open in IMG/M |
3300017966|Ga0187776_10997172 | Not Available | 615 | Open in IMG/M |
3300017997|Ga0184610_1279479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
3300018056|Ga0184623_10097726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1356 | Open in IMG/M |
3300018056|Ga0184623_10471599 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300018072|Ga0184635_10007896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3580 | Open in IMG/M |
3300018429|Ga0190272_12924123 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300018469|Ga0190270_12879962 | Not Available | 543 | Open in IMG/M |
3300018481|Ga0190271_11727866 | Not Available | 739 | Open in IMG/M |
3300019356|Ga0173481_10064390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1306 | Open in IMG/M |
3300019356|Ga0173481_10335330 | Not Available | 717 | Open in IMG/M |
3300019458|Ga0187892_10406705 | Not Available | 646 | Open in IMG/M |
3300019886|Ga0193727_1151478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
3300022214|Ga0224505_10142050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 929 | Open in IMG/M |
3300025160|Ga0209109_10381926 | Not Available | 659 | Open in IMG/M |
3300025165|Ga0209108_10397872 | Not Available | 676 | Open in IMG/M |
3300025310|Ga0209172_10473185 | Not Available | 582 | Open in IMG/M |
3300025791|Ga0210115_1096101 | Not Available | 602 | Open in IMG/M |
3300025930|Ga0207701_10071966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3138 | Open in IMG/M |
3300025993|Ga0208415_1028048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
3300026004|Ga0208416_1013613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
3300026041|Ga0207639_12268711 | Not Available | 504 | Open in IMG/M |
3300026075|Ga0207708_11107159 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300026088|Ga0207641_11352431 | Not Available | 713 | Open in IMG/M |
3300026320|Ga0209131_1272221 | Not Available | 649 | Open in IMG/M |
3300026323|Ga0209472_1031266 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
3300026329|Ga0209375_1015310 | All Organisms → cellular organisms → Bacteria | 4572 | Open in IMG/M |
3300026332|Ga0209803_1026566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2791 | Open in IMG/M |
3300026452|Ga0256821_1026718 | Not Available | 631 | Open in IMG/M |
3300026524|Ga0209690_1014582 | All Organisms → cellular organisms → Bacteria | 4098 | Open in IMG/M |
3300027462|Ga0210000_1059681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 617 | Open in IMG/M |
3300027722|Ga0209819_10041276 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
3300027723|Ga0209703_1206479 | Not Available | 720 | Open in IMG/M |
3300027819|Ga0209514_10383471 | Not Available | 611 | Open in IMG/M |
3300027840|Ga0209683_10552823 | Not Available | 525 | Open in IMG/M |
3300027873|Ga0209814_10134085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1059 | Open in IMG/M |
3300027886|Ga0209486_10604844 | Not Available | 696 | Open in IMG/M |
3300027909|Ga0209382_11530962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
3300028784|Ga0307282_10225129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 899 | Open in IMG/M |
3300031170|Ga0307498_10018541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1547 | Open in IMG/M |
3300031198|Ga0307500_10221731 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300031226|Ga0307497_10095489 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
3300031562|Ga0310886_10344981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 864 | Open in IMG/M |
3300032770|Ga0335085_10093761 | All Organisms → cellular organisms → Bacteria | 3902 | Open in IMG/M |
3300034149|Ga0364929_0260787 | Not Available | 585 | Open in IMG/M |
3300034690|Ga0364923_0146953 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.02% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.72% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.15% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.94% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.36% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.36% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.57% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.57% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.57% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.57% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.57% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.79% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.79% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.79% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.79% |
Hot Spring Sediments | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments | 0.79% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.79% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.79% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.79% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300003890 | Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cm | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
3300004071 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025993 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes) | Environmental | Open in IMG/M |
3300026004 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 (SPAdes) | Environmental | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F12B_121167651 | 3300000443 | Soil | MEKNKYLAISALGFFLTGCAGMTKNQAALVGAATCG |
AF_2010_repII_A100DRAFT_10778221 | 3300000655 | Forest Soil | MEKNKYLAISALGFFLTGCAGMSKNQAALVGAATCGAGGAAGGAL |
JGI11643J11755_110281011 | 3300000787 | Soil | MTNSNKYLAXTALGFFMTGXTGMTKTQAGLVGAAVCGAA |
JGI11643J11755_116661241 | 3300000787 | Soil | MQKNKYLALTAAGFFLAGCTGMTRNQAATVGALTCGVAGAG |
JGI1027J11758_124306741 | 3300000789 | Soil | MQTNKYLAMSALGFFLTGCAGMSKNQAALVGAATCGAGGAAG |
JGI10213J12805_100407252 | 3300000858 | Soil | MQNNKYLALTALGFLLAGCTGMTRNQAALVGALTCGAAGAGGGAYA |
JGI11643J12802_109720701 | 3300000890 | Soil | MNRNKHLALAALGFFLTGCTGMTKNQAALVGAATCGAMGAAGGAMAA |
JGI1027J12803_1025499833 | 3300000955 | Soil | MEKNKYLAISALGFFLTGCAGMSKNQAALVGAATCGAGG |
JGI10216J12902_1035434501 | 3300000956 | Soil | MKRNKQLALAALGFFLTGCTGITKNQAALVGAAVCGTMAGGGVAASRAHEN |
C687J26631_102411402 | 3300002124 | Soil | MEKNKYLALTALGFFLSGCTGVLTKNQAALVGALTCGAGGAAAGGIIT |
Ga0063162_10709001 | 3300003890 | Hot Spring Sediments | MKRNKQLALAALGFFLSGCTGMTKNQAALVGAATCGAMGAAGG |
Ga0055471_102053981 | 3300003987 | Natural And Restored Wetlands | MRKNKFLTIVAAGFLLSGCAGMTKRQAALVGATVCGAMGAGGG |
Ga0055435_101886271 | 3300003994 | Natural And Restored Wetlands | MNRNKYLALTALVFFMSACTGMTKRQAAIVGASVCGVAGAAGGGAAAHSGI |
Ga0055438_102611252 | 3300003995 | Natural And Restored Wetlands | MQTNKYLALSALGFFLSSCTGIMTKEQAAIVGAATCGIMGGAGGAYIGNQ |
Ga0055486_100323232 | 3300004071 | Natural And Restored Wetlands | MNRNKYLALTALGFFMVGCTGMTKKQAALVGASVSGVAGAG |
Ga0062590_1021856311 | 3300004157 | Soil | MTNSNKYLALTALGFFMTGCTGMTKTQAGLVGAAVCGAAG |
Ga0062595_1017338301 | 3300004479 | Soil | MKTSKHLALTALGFFLTAGCAGMSKTQSALVGAAACGAGGAGVGAAV |
Ga0062592_1012545332 | 3300004480 | Soil | MQKNKYLALTAAGFFLAGCTGMTRNQAATVGALTCGVAGAGAGVYAAHQGING |
Ga0066683_104659522 | 3300005172 | Soil | MKKNKQLALAALGFFLTGCTGMTKNQAALVGAAVCGTMAGAGVGAS |
Ga0066683_105661351 | 3300005172 | Soil | MIGSKQLALAAVGFFLSGCAGMTKNQAAVFGAATCGIVGGAA |
Ga0070659_1001672573 | 3300005366 | Corn Rhizosphere | MKRNKELALVALGLFMTGCTGMTKTQAAIVGASFCGISTGAGV |
Ga0073909_100113331 | 3300005526 | Surface Soil | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGG |
Ga0070704_1006076321 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKSQYAALLAGGFLLTGCTGMTKTQAAIVGASFCGVATG |
Ga0066707_100795501 | 3300005556 | Soil | MGKNKYLALSALGYFLSGCAGTGLTKNQAALLGAVGCGAV |
Ga0070664_1005486213 | 3300005564 | Corn Rhizosphere | MKRNKELALVALGLFMTGCTGMTKTQAAIVGASFCGIS |
Ga0068852_1010081041 | 3300005616 | Corn Rhizosphere | MKRNKQMAFVALGMFLTGCTGVMSKNQAALVGATLCGTAAGAGVGASRD |
Ga0066905_1020614101 | 3300005713 | Tropical Forest Soil | MNRNKQLALAVLGFFLTGCTGMTKMQAAMVGAGVC |
Ga0068861_1019670641 | 3300005719 | Switchgrass Rhizosphere | MKRNKELALVALGLFMTGCTGMTKTQAAIVGASFCGISTGAG |
Ga0068863_1003084771 | 3300005841 | Switchgrass Rhizosphere | MKRNKQMAFVALGMFLTGCTGVMSKNQAALVGATLCGTAAGAGVG |
Ga0075417_103782661 | 3300006049 | Populus Rhizosphere | MKRNKELALVALGLFMTGCTGMTKTQAAIVGASFC |
Ga0068871_1013058371 | 3300006358 | Miscanthus Rhizosphere | MKRNKQMAFVALGMFLTGCTGVMTKTQAALVGATLCGTAAGAG |
Ga0068871_1014256702 | 3300006358 | Miscanthus Rhizosphere | MMQKSNYIALTALGFFLTGCVGLTKNQAALIGATLC |
Ga0066659_105286371 | 3300006797 | Soil | MKIRKQLALAALGFFVTGCTGMTKNQAAIVGASTCGAMTAAGVAGSRTHDRWV |
Ga0075428_1024652271 | 3300006844 | Populus Rhizosphere | MNKNKHLALAALGFFLAGCTGMTKNQAALVGASVCGAMGAMG |
Ga0075421_1021794721 | 3300006845 | Populus Rhizosphere | MTKNNKYLALTALGFFMAGCTGLTKNQAALVGASVCGVMG |
Ga0075421_1022346931 | 3300006845 | Populus Rhizosphere | MQNNKYLALTALGFFLAGCTGMTRNQAAMVGALTCGAAGA |
Ga0075430_1004962081 | 3300006846 | Populus Rhizosphere | MEKNKYLAISALGFFLTGCAGMSKNQAALVGAATCG |
Ga0075433_102601743 | 3300006852 | Populus Rhizosphere | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGGAGVGAAVAH |
Ga0075434_1005527973 | 3300006871 | Populus Rhizosphere | MKQHKQLALATLGLFLTGCTGMTKTQAAIVGASFCGVATGA |
Ga0075429_1018859272 | 3300006880 | Populus Rhizosphere | MEKNKYLAISALGFFLTGCAGMSKNQAALVGAATCGAGGAAGG |
Ga0079215_106659241 | 3300006894 | Agricultural Soil | MQNNKYLALTALGFFLAGCTGMTRNQAAMVGALTCGAAGAGGGAYA |
Ga0075426_114608861 | 3300006903 | Populus Rhizosphere | MQTNKYLAMSALGFFLTGCAGMSKNQAALVGAATCGAGGAA |
Ga0075424_1000879484 | 3300006904 | Populus Rhizosphere | MQTNKYLALSALGFFLSGCTGVMSKETAAIVGAATCGIMGGAGGAYIGRQHGSTG |
Ga0075436_1003984163 | 3300006914 | Populus Rhizosphere | MKRQKQLALATLGLFLTGCTGMTKTQAAIVGASFCG |
Ga0079218_136420231 | 3300007004 | Agricultural Soil | MKKNKQLALAALGFFLTGCTGMTKNQAALVGAGVCGAMGAM |
Ga0075435_1012052502 | 3300007076 | Populus Rhizosphere | MKISKQLALAALGVFVTGCTGMTKNQAAIVGASTCGAMTAA |
Ga0066710_1003589883 | 3300009012 | Grasslands Soil | MEKNQYIALAALGFFLSGCTGVTKTQSALIGAATCAVAGGAGGG |
Ga0111539_101136965 | 3300009094 | Populus Rhizosphere | MKHNRQLALGVLGFFLTGCAGMSKNQAALVGAAACGAGGAGVGAAVAHHG |
Ga0111538_141209082 | 3300009156 | Populus Rhizosphere | MKHDRQLALAVLGFFLTGCAGMSKNQAALVGAAACGA |
Ga0105242_101148481 | 3300009176 | Miscanthus Rhizosphere | MTKSQYAALLAGGFLLTGCTGMTKTQAAIVGASFCG |
Ga0126382_104246332 | 3300010047 | Tropical Forest Soil | MKKNKQLALVAVGFFLSGCTGMTKTQAALTGAGVCGLMG |
Ga0126382_112526222 | 3300010047 | Tropical Forest Soil | MNRNKPLALAALGFFLSGCSGMTKNQAAIVGASVCGAMGAGGGWAVA |
Ga0134086_100224264 | 3300010323 | Grasslands Soil | MGKNKYIALSALGFFLSGCTGTGLTKNQAALLGAVGC |
Ga0134063_101553821 | 3300010335 | Grasslands Soil | MGKNKYIALSALGFFLSGCTGTGLTKNQAALLGAVGCGAVGAGV |
Ga0126377_101159943 | 3300010362 | Tropical Forest Soil | MKKNKQLALVAVGFFLSGCTGMTKTQAALTGAGVC |
Ga0105239_129714931 | 3300010375 | Corn Rhizosphere | MTKSQYAALLAGGFLLTGCTGMTKTQAAIVGASFC |
Ga0134126_117454572 | 3300010396 | Terrestrial Soil | MKIGKHLALAALGFFVTGCTGVMTKNQAALVGATFCGTATGAGVGTA |
Ga0134122_103180704 | 3300010400 | Terrestrial Soil | MNRNKHLALAALGFFLTGCTGLTKNQAALVGASVCGVMGGA |
Ga0134122_116181612 | 3300010400 | Terrestrial Soil | MMTKNNKYLALTALGFFMSGCTGLTKNQAALVGAGVCGAFGAGGGAGVARN |
Ga0137451_10985102 | 3300011438 | Soil | MTNSNKYLALTALGFFMTGCTGLTKNQAALVGATVCGLGGAGAGA |
Ga0137463_11536351 | 3300011444 | Soil | MRNKRYLALTALGFFLTGCTGMTKNQAALVGASVCGALGGTGGAVLAHQ |
Ga0137369_108327152 | 3300012355 | Vadose Zone Soil | MKKNKRLALAALGFFLTGCTGMTKNQAALVGAAFCGTAAGVG |
Ga0157351_10142922 | 3300012501 | Unplanted Soil | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGGAGVGAAVAHHGING |
Ga0157297_103210281 | 3300012914 | Soil | MQKNKYLALTAAGFFLAGCTGMTRNQAATVGALTCGVAGAGAGV |
Ga0137416_121248131 | 3300012927 | Vadose Zone Soil | MKRSKRLALTALGFFLTGCAGMTKTQSALVAAAACGA |
Ga0164299_100242501 | 3300012958 | Soil | MKRNKELALVALGLFMTGCTGMTKTQAAIVGASFCGI |
Ga0134077_100299641 | 3300012972 | Grasslands Soil | MGKNKYLALSALGFFLSGCTGTGLTKNQAALLGAVG |
Ga0164308_120628861 | 3300012985 | Soil | MKRNKELALVALGLFMTGCTGMTKTQAAIVGASFCG |
Ga0157375_132516771 | 3300013308 | Miscanthus Rhizosphere | MKTSKHLALTALGFFLTGCAGMTKTQSALVAAAACGAGGAGVGA |
Ga0163163_107644841 | 3300014325 | Switchgrass Rhizosphere | MKRNKELALVALGLFMTGCTGMTKTQAAIVGASFCGISTGA |
Ga0137403_101100024 | 3300015264 | Vadose Zone Soil | MQTNKYLAMSALGFFLTGCAGMSKNQAALVGAATC |
Ga0134089_102761512 | 3300015358 | Grasslands Soil | MKKNKLLALAALGFFLTGCTGMTKNQAALVGAAVCGTMAGAGVGASRAHENN |
Ga0132257_1039159101 | 3300015373 | Arabidopsis Rhizosphere | MKHNRQLALGVLGFFLTGCAGMSKNQAALVGAAACGAGGAG |
Ga0182039_101343261 | 3300016422 | Soil | MQKNKYLAMSALGFFLTGCAGMSKNQAAIVGATVCGLGGAAGGGLAANNG |
Ga0187776_109971721 | 3300017966 | Tropical Peatland | MGKNKYLALTAVGFFLAGCSGMTKTQGALLGAAICGAGGAGAG |
Ga0184610_12794792 | 3300017997 | Groundwater Sediment | MKRNKQLALAALGFFLTGCTGMTKNQAALVGGAVCGTMAGAGVGASR |
Ga0184623_100977263 | 3300018056 | Groundwater Sediment | MLKNKSLVLAAAGFFLSGCAGMTKQQAALSGAAVC |
Ga0184623_104715992 | 3300018056 | Groundwater Sediment | MTKNNKYLALTALGFFMAGCTGLTKNQAALVGAGVCGAMGAMGGAAAAHQGI |
Ga0184635_100078961 | 3300018072 | Groundwater Sediment | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGGA |
Ga0184640_100353541 | 3300018074 | Groundwater Sediment | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGGAGVGAAVAHHGINGSH |
Ga0190272_129241232 | 3300018429 | Soil | MNKNKYLALTAVGFFLSGCGTMTKNQAALVGASVCGAMGAGVG |
Ga0190270_128799622 | 3300018469 | Soil | MTKNNKYLALTALGFFMAGCTGLTKNQAALVGASVCGVMGGAGGAAVA |
Ga0190271_117278661 | 3300018481 | Soil | MQNNKYLALTALGFFLAGCTGMTRNQAAMVGALTCGAAGAGG |
Ga0173481_100643901 | 3300019356 | Soil | MKRNKQMAFVALGMFLTGCTGVMTKNQAALVGATLCGTAAGAGV |
Ga0173481_103353301 | 3300019356 | Soil | MQKNKYLALTAAGFFLTGCAGMTRNQAALVGALTCGAAGAGGG |
Ga0187892_104067052 | 3300019458 | Bio-Ooze | MVKQKYLALTVMGFFLSAGCTMSKNQAALIGAATCGAAGAGIGAAA |
Ga0193725_11399672 | 3300019883 | Soil | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGGAGVGAAVAHHGINGSHVN |
Ga0193727_11514782 | 3300019886 | Soil | MQTNKYLAMSALGFFLTGCAGMSKNQAALVGAATCGAGG |
Ga0224505_101420502 | 3300022214 | Sediment | MTNRNKYLALTALGFFMTGCTGLTKNQAALVGAAVCGAGGAAAG |
Ga0212128_102644131 | 3300022563 | Thermal Springs | MEKNKYLAMTAVGFFLTGCAGMTKNQAALVGALTCGAAGAAAGGIITHNTGHRLSE |
Ga0209109_103819261 | 3300025160 | Soil | MEKNKYLALAVVGFFFSGCTGVMTKNQAAVVGALTCGT |
Ga0209108_103978722 | 3300025165 | Soil | MEKNKYLALTVVGFFLTGCTGVMTKNQAALVGALT |
Ga0209172_104731852 | 3300025310 | Hot Spring Sediment | MLKRKFVALGVLGFFLSGCTGLTRNQAMTVGAVTCGLGGAGIGAAVAHQGIRG |
Ga0210094_11014811 | 3300025549 | Natural And Restored Wetlands | MQTNKYLALSALGFFLSSCTGIMTKEQAAIVGAATCGIMGGAGGAYIGNQHGS |
Ga0210115_10961012 | 3300025791 | Natural And Restored Wetlands | MRKNKFLTIVAAGFLLSGCAGMTKRQAALVGATVCGAMGAGGGAAIAH |
Ga0207684_111717621 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKNKLLALAALGFFLTGCTGMTKNQAALVGAAVCGTMAGAGVGASRAHENNTWVAAP |
Ga0207701_100719661 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MQKNKYLALTAAGFFLTGCAGMTRNQAALVGALTCGAAGAG |
Ga0208415_10280481 | 3300025993 | Rice Paddy Soil | MNRNKHLALAALGFFLTGCTGMTKNQAALVGAATCGAMGAAGGAMAAH |
Ga0208416_10136131 | 3300026004 | Rice Paddy Soil | MNRNKHLALAALGFFLTGCTGMTKNQAALVGAATCGA |
Ga0207639_122687112 | 3300026041 | Corn Rhizosphere | MKRNKQMAFVALGMFLTGCTGVMTKNQAALVGATLCGTAAGAGVG |
Ga0207708_111071591 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKNNKYLALTALGFFMSGCTGLTKNQAALVGAGVCGAFGAGGGAGVARNKDKNVYAGAA |
Ga0207641_113524311 | 3300026088 | Switchgrass Rhizosphere | MKRNKQMAFVALGMFLAGCTGVMSKNQAALVGATLCGTAAGAGVGASRD |
Ga0209131_12722211 | 3300026320 | Grasslands Soil | MKSNKYVALSALGFFLTGCAGMTKNQAALVGAGLCGAGGAGIGAASAHQGV |
Ga0209472_10312663 | 3300026323 | Soil | MGKNKYLALSALGFFLTGCTGMTKTQGALLGAVTCGAAGAGIGA |
Ga0209375_10153104 | 3300026329 | Soil | MGKNKYLALSALGFFLTGCTGMTKTQGALLGAVTCGA |
Ga0209803_10265661 | 3300026332 | Soil | MGKNKYLALSALGFFLSGCTGTGLTKNQAALLGAVGC |
Ga0256821_10267181 | 3300026452 | Sediment | MTNKNRYLALSALGFFMTGCTGTMTKNEAALSAAAFCGASAGL |
Ga0209690_10145824 | 3300026524 | Soil | MGKNKYIALSALGFFLSGCAGTGLTKNQAALLGAVGCGAVGAGVGVGI |
Ga0210000_10596812 | 3300027462 | Arabidopsis Thaliana Rhizosphere | MNRNKHLALAALGFFLTGCTGMTKNQAALVGAATCGAMGAA |
Ga0209799_10274412 | 3300027654 | Tropical Forest Soil | MQTNKYLALSALGLFLSSCTGVMSKETAAIVGAATCGAMGAGGGAYIGHQHGNF |
Ga0209819_100412763 | 3300027722 | Freshwater Sediment | MEKNKYLAISALGFFLTGCAGMTKNQAALVGAATCGAAGAG |
Ga0209703_12064792 | 3300027723 | Freshwater Sediment | MKTNKYLALSALGFFLTGCTGVMTKNQAALVGALTCGAAGGAAGGI |
Ga0209514_103834711 | 3300027819 | Groundwater | MEKNKYIVMAVVGFFLSGCTGVLTKNQAGVVGALACGVMGGAIGGGTAAADGKG |
Ga0209683_105528231 | 3300027840 | Wetland Sediment | MTNSNKYLALTALGFFMTGCTGMTKNQAALVSAAVCG |
Ga0209814_101340851 | 3300027873 | Populus Rhizosphere | MKKSRQLALVALGFFLSGCTGMTKNQAAIVGASVCGAMGAAG |
Ga0209486_106048441 | 3300027886 | Agricultural Soil | MNTNKHLALAALGFFLTGCTGMTKNQAALVGASVCGA |
Ga0209382_115309622 | 3300027909 | Populus Rhizosphere | MKRNKELALVALGLFMTGCTGMTKTQAAIVGASFCGVS |
Ga0307282_102251292 | 3300028784 | Soil | MKISKQLALAALGFFMSGCTGMTKNQAAIVGASTCGAMTAAGVAGTRTHDR |
Ga0307498_100185412 | 3300031170 | Soil | MKTSKHLALTALGFFLTGCAGMSKTQSALVGAAACGAGGAGVGAAVAHH |
Ga0307500_102217312 | 3300031198 | Soil | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGGAG |
Ga0307497_100954892 | 3300031226 | Soil | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGGAGVGAAVAHH |
Ga0310886_103449811 | 3300031562 | Soil | MQTNKYLAMSALGFFLTGCAGMTRNQAALVGAATCGVGGAAGGAMAAHNGVQ |
Ga0307468_1017389482 | 3300031740 | Hardwood Forest Soil | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGGAGVGAAVAHHGIN |
Ga0307470_101380141 | 3300032174 | Hardwood Forest Soil | MKHDRQLALAVLGFFLTGCAGMSKTQSALVGAAACGAGGAGVGAAVAHHGINGSHV |
Ga0335085_100937611 | 3300032770 | Soil | MQTNKYLALTALGFFMSGCTGVMTKETAAIVGAATCG |
Ga0364929_0260787_3_140 | 3300034149 | Sediment | MTKNNKYLALTALGFFLAGCTGLTKNQAALVGASVCGVMGAAGGAA |
Ga0364923_0146953_484_612 | 3300034690 | Sediment | MDQNKYLTLAVLAFFLTGCTGVMTKNQAAMVGAATCGTIGGLG |
⦗Top⦘ |