NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F065958

Metagenome / Metatranscriptome Family F065958

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F065958
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 42 residues
Representative Sequence MPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQ
Number of Associated Samples 103
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.21 %
% of genes near scaffold ends (potentially truncated) 93.70 %
% of genes from short scaffolds (< 2000 bps) 89.76 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (87.402 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(40.157 % of family members)
Environment Ontology (ENVO) Unclassified
(32.283 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.819 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.83%    β-sheet: 0.00%    Coil/Unstructured: 54.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF12840HTH_20 17.32
PF00067p450 12.60
PF08327AHSA1 5.51
PF03928HbpS-like 4.72
PF00903Glyoxalase 3.94
PF00378ECH_1 3.15
PF01613Flavin_Reduct 3.15
PF01738DLH 1.57
PF02233PNTB 1.57
PF00005ABC_tran 1.57
PF01022HTH_5 1.57
PF11716MDMPI_N 1.57
PF13191AAA_16 0.79
PF03976PPK2 0.79
PF01557FAA_hydrolase 0.79
PF04199Cyclase 0.79
PF04993TfoX_N 0.79
PF01734Patatin 0.79
PF12323HTH_OrfB_IS605 0.79
PF07836DmpG_comm 0.79
PF02492cobW 0.79
PF02036SCP2 0.79
PF02720DUF222 0.79
PF132794HBT_2 0.79
PF00464SHMT 0.79
PF13367PrsW-protease 0.79
PF13343SBP_bac_6 0.79
PF15420Abhydrolase_9_N 0.79
PF03466LysR_substrate 0.79
PF03641Lysine_decarbox 0.79
PF05685Uma2 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG2124Cytochrome P450Defense mechanisms [V] 12.60
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 3.15
COG1282NAD/NADP transhydrogenase beta subunitEnergy production and conversion [C] 1.57
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.79
COG0119Isopropylmalate/homocitrate/citramalate synthasesAmino acid transport and metabolism [E] 0.79
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.79
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 0.79
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.79
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.79
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.79
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 0.79
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.79
COG4636Endonuclease, Uma2 family (restriction endonuclease fold)General function prediction only [R] 0.79
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.40 %
UnclassifiedrootN/A12.60 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559006|FI_contig10173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1013Open in IMG/M
3300000955|JGI1027J12803_109412763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis876Open in IMG/M
3300004081|Ga0063454_102089309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii502Open in IMG/M
3300004092|Ga0062389_102230039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia721Open in IMG/M
3300004092|Ga0062389_104199206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300005338|Ga0068868_102190105All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005468|Ga0070707_101708359All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300005610|Ga0070763_10219318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1020Open in IMG/M
3300005610|Ga0070763_10399204All Organisms → cellular organisms → Bacteria → Terrabacteria group773Open in IMG/M
3300005843|Ga0068860_100300852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1571Open in IMG/M
3300006028|Ga0070717_10119758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2254Open in IMG/M
3300006176|Ga0070765_101822378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium571Open in IMG/M
3300006574|Ga0074056_11781364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales996Open in IMG/M
3300006954|Ga0079219_10153931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1232Open in IMG/M
3300009700|Ga0116217_10428837Not Available837Open in IMG/M
3300009824|Ga0116219_10680030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii563Open in IMG/M
3300010322|Ga0134084_10186618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis718Open in IMG/M
3300010343|Ga0074044_10301842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1053Open in IMG/M
3300010358|Ga0126370_11705732Not Available606Open in IMG/M
3300012096|Ga0137389_10549903All Organisms → cellular organisms → Bacteria → Terrabacteria group991Open in IMG/M
3300012209|Ga0137379_10033075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales4981Open in IMG/M
3300012210|Ga0137378_11058131All Organisms → cellular organisms → Bacteria → Terrabacteria group726Open in IMG/M
3300012351|Ga0137386_10091009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2148Open in IMG/M
3300012351|Ga0137386_10247990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1280Open in IMG/M
3300012356|Ga0137371_10219505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1487Open in IMG/M
3300012356|Ga0137371_11225258All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300012916|Ga0157310_10338809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii604Open in IMG/M
3300016422|Ga0182039_12110479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii519Open in IMG/M
3300016445|Ga0182038_11348925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium638Open in IMG/M
3300017823|Ga0187818_10275742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300017926|Ga0187807_1048527Not Available1316Open in IMG/M
3300017928|Ga0187806_1002306All Organisms → cellular organisms → Bacteria5027Open in IMG/M
3300017942|Ga0187808_10170915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium962Open in IMG/M
3300017942|Ga0187808_10281164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium748Open in IMG/M
3300017974|Ga0187777_11381211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii519Open in IMG/M
3300018047|Ga0187859_10726621Not Available566Open in IMG/M
3300018058|Ga0187766_10694575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii702Open in IMG/M
3300018085|Ga0187772_10452714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia900Open in IMG/M
3300020579|Ga0210407_11430342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300020583|Ga0210401_10791924Not Available808Open in IMG/M
3300021088|Ga0210404_10059639All Organisms → cellular organisms → Bacteria1824Open in IMG/M
3300021180|Ga0210396_10967995Not Available722Open in IMG/M
3300021180|Ga0210396_10984968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis715Open in IMG/M
3300021180|Ga0210396_11189213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter639Open in IMG/M
3300021402|Ga0210385_10089003All Organisms → cellular organisms → Bacteria2133Open in IMG/M
3300021402|Ga0210385_11455627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii524Open in IMG/M
3300021406|Ga0210386_10616825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria937Open in IMG/M
3300021406|Ga0210386_10627373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii928Open in IMG/M
3300021407|Ga0210383_10486445All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300021432|Ga0210384_11276567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium639Open in IMG/M
3300021432|Ga0210384_11885408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia503Open in IMG/M
3300021474|Ga0210390_10131350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2104Open in IMG/M
3300021477|Ga0210398_10938252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii692Open in IMG/M
3300021478|Ga0210402_11438823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300021560|Ga0126371_10357417All Organisms → cellular organisms → Bacteria1597Open in IMG/M
3300022557|Ga0212123_10195824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1505Open in IMG/M
3300023056|Ga0233357_1028955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii682Open in IMG/M
3300024245|Ga0247677_1018382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales997Open in IMG/M
3300024331|Ga0247668_1029195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1133Open in IMG/M
3300025910|Ga0207684_10909542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis739Open in IMG/M
3300025915|Ga0207693_10988130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii643Open in IMG/M
3300025926|Ga0207659_10241121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1462Open in IMG/M
3300025928|Ga0207700_11964047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300025981|Ga0207640_10380606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1143Open in IMG/M
3300026527|Ga0209059_1302589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300027073|Ga0208366_1010558Not Available971Open in IMG/M
3300027497|Ga0208199_1043899All Organisms → cellular organisms → Bacteria → Terrabacteria group962Open in IMG/M
3300027775|Ga0209177_10083026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria983Open in IMG/M
3300027775|Ga0209177_10279045All Organisms → cellular organisms → Bacteria → Terrabacteria group629Open in IMG/M
3300027855|Ga0209693_10277694All Organisms → cellular organisms → Bacteria → Terrabacteria group819Open in IMG/M
3300027889|Ga0209380_10095295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1717Open in IMG/M
3300028906|Ga0308309_10109109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2158Open in IMG/M
3300028906|Ga0308309_10597639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii957Open in IMG/M
3300029943|Ga0311340_10709171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia861Open in IMG/M
3300030520|Ga0311372_10111662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4912Open in IMG/M
3300030707|Ga0310038_10016752All Organisms → cellular organisms → Bacteria4664Open in IMG/M
3300031057|Ga0170834_111558242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii561Open in IMG/M
3300031543|Ga0318516_10464884Not Available727Open in IMG/M
3300031544|Ga0318534_10009789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4762Open in IMG/M
3300031544|Ga0318534_10225992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. MTM3W5.21080Open in IMG/M
3300031546|Ga0318538_10335722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia816Open in IMG/M
3300031546|Ga0318538_10471332Not Available680Open in IMG/M
3300031564|Ga0318573_10247014All Organisms → cellular organisms → Bacteria → Terrabacteria group951Open in IMG/M
3300031573|Ga0310915_10705542Not Available712Open in IMG/M
3300031681|Ga0318572_10165760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1281Open in IMG/M
3300031708|Ga0310686_100780324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium511Open in IMG/M
3300031708|Ga0310686_103528773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii609Open in IMG/M
3300031708|Ga0310686_113299142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium930Open in IMG/M
3300031708|Ga0310686_114357388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii991Open in IMG/M
3300031713|Ga0318496_10128780All Organisms → cellular organisms → Bacteria → Terrabacteria group1373Open in IMG/M
3300031719|Ga0306917_10914843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium686Open in IMG/M
3300031719|Ga0306917_11068235Not Available629Open in IMG/M
3300031747|Ga0318502_10132598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1409Open in IMG/M
3300031748|Ga0318492_10348703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales774Open in IMG/M
3300031754|Ga0307475_10126434All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300031764|Ga0318535_10281737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300031770|Ga0318521_10427433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia791Open in IMG/M
3300031770|Ga0318521_10846624All Organisms → cellular organisms → Bacteria → Terrabacteria group558Open in IMG/M
3300031777|Ga0318543_10345380Not Available666Open in IMG/M
3300031777|Ga0318543_10461611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300031779|Ga0318566_10550662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300031782|Ga0318552_10090633Not Available1500Open in IMG/M
3300031794|Ga0318503_10298590All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300031819|Ga0318568_10727643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125616Open in IMG/M
3300031821|Ga0318567_10397148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii781Open in IMG/M
3300031823|Ga0307478_10301171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1313Open in IMG/M
3300031831|Ga0318564_10043051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1954Open in IMG/M
3300031833|Ga0310917_10172381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1438Open in IMG/M
3300031833|Ga0310917_10418791Not Available911Open in IMG/M
3300031890|Ga0306925_10065233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3825Open in IMG/M
3300031890|Ga0306925_11695611All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300032001|Ga0306922_10655777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1108Open in IMG/M
3300032009|Ga0318563_10414036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia729Open in IMG/M
3300032010|Ga0318569_10018348All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2774Open in IMG/M
3300032042|Ga0318545_10139407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales860Open in IMG/M
3300032067|Ga0318524_10387118Not Available728Open in IMG/M
3300032068|Ga0318553_10587734Not Available583Open in IMG/M
3300032076|Ga0306924_11282698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii788Open in IMG/M
3300032089|Ga0318525_10461709All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300032089|Ga0318525_10544100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia593Open in IMG/M
3300032094|Ga0318540_10627128All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300032261|Ga0306920_103511103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125579Open in IMG/M
3300032770|Ga0335085_11960031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii595Open in IMG/M
3300032895|Ga0335074_10305032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1815Open in IMG/M
3300032898|Ga0335072_11267442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii649Open in IMG/M
3300033134|Ga0335073_11748644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii584Open in IMG/M
3300033134|Ga0335073_11770390All Organisms → cellular organisms → Bacteria579Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil40.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.09%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.51%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.51%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.15%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.94%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.36%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.36%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.57%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.57%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.57%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.79%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.79%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.79%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.79%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FI_001133802166559006Grass SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPGG
JGI1027J12803_10941276333300000955SoilMPVKYLSQDWIDAYNDALAGDVVRGALKGKNATIQMVI
Ga0063454_10208930923300004081SoilMPVKYLSQEWIDAYNATVSSSDAVAKAMKGKSAVLQMVIAEAP
Ga0062389_10223003913300004092Bog Forest SoilMPLKYLSPEWIDAYNATVAADDSVRAAMKGKNAVIQMLIAEAP
Ga0062389_10419920623300004092Bog Forest SoilMSILPVQYLSQEWVDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEV
Ga0068868_10219010523300005338Miscanthus RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDA
Ga0070707_10170835913300005468Corn, Switchgrass And Miscanthus RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVISDAP
Ga0070763_1021931823300005610SoilMPVTYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAP
Ga0070763_1039920423300005610SoilMSAMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSA
Ga0068860_10030085213300005843Switchgrass RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAP
Ga0070717_1011975813300006028Corn, Switchgrass And Miscanthus RhizosphereMSAMPVKYLSREWFEAYNAALSGDDAVRAALKGKSAALQMV
Ga0070765_10182237813300006176SoilMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISG
Ga0074056_1178136433300006574SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVI
Ga0079219_1015393123300006954Agricultural SoilMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPRDVGAGQPR*
Ga0116217_1042883713300009700Peatlands SoilMPVTYLSQEWVEAYNATMAGDDAVRAALKGKSAALQMVIS
Ga0116219_1068003013300009824Peatlands SoilMPVKYLSQEWIDEYNAALEQDAVRAALKGKSATIQMLIS
Ga0134084_1018661833300010322Grasslands SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISD
Ga0074044_1030184233300010343Bog Forest SoilMPVKYLSQEWIDAYNATMASDEAVHAALKGKNATIQMVNSDS
Ga0126370_1170573213300010358Tropical Forest SoilMPVTYLSQEWIDQYNAALAGDEAVRAALKGKSAALQMVISGAPQ
Ga0137389_1054990323300012096Vadose Zone SoilMPVKYLSQQWIDAYNAAMASDEAVRAARKGKSATVSASVSWAG
Ga0137379_1003307513300012209Vadose Zone SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVISDAPRD
Ga0137378_1105813123300012210Vadose Zone SoilMPVKYLSQEWIDAYNAALASDDAVRAAMKGKSATIQMVISD
Ga0137386_1009100913300012351Vadose Zone SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVIADAPE
Ga0137386_1024799023300012351Vadose Zone SoilMPVKYLSQQWIDAYNAAMASDEAVRAAMKGKSAAGIDTEY*
Ga0137371_1021950513300012356Vadose Zone SoilMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPERGEIRYW
Ga0137371_1122525813300012356Vadose Zone SoilMPVKYLSQEWIDAYNNALAGDAVRAAMKGKNATIQMVISDAPEEGEIRYWLR
Ga0157310_1033880913300012916SoilMPVKYLSQEWIDAYNDALAGAAVRGAMQGKNATIQMVISDAPRD
Ga0182039_1211047913300016422SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMLVTDAPEG
Ga0182038_1134892523300016445SoilMPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQ
Ga0187818_1027574223300017823Freshwater SedimentMPVKYLSQEWIDEYNAAIEQDAVRAALKGKSAALQMVISDA
Ga0187807_104852713300017926Freshwater SedimentMPVRYLSQEWVEAYNAALAGDDAVRAALKGKSAVLQMV
Ga0187806_100230613300017928Freshwater SedimentMPVKYLSQEWVEAYNTALAGDDAVRAALKGKNAVLQM
Ga0187808_1017091523300017942Freshwater SedimentMPVRYLSREWVEAYNAALAGDDAVRAALKGKSAVLQMVISGA
Ga0187808_1028116413300017942Freshwater SedimentMPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVIA
Ga0187777_1138121113300017974Tropical PeatlandMPVKYLSQEWVDAYNATLAGDDAVRAALKGKSAALQMVISGAPQGE
Ga0187859_1072662123300018047PeatlandMPVKYLSPEWIDAYNAAMAGDDAVAAAMKGKSAVLQMVISDAPGGE
Ga0187766_1069457513300018058Tropical PeatlandMPVKYLSQEWIDAYNAAMADDAIRTAVKGKSPTIQM
Ga0187772_1045271413300018085Tropical PeatlandMPVKYLSQEWIDAYNAALAGDEAARAALKGKSAALQMVNTIDTEY
Ga0210407_1143034213300020579SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPEEAEIRY
Ga0210401_1079192423300020583SoilMPVTYLSQEWIEAYNAALAGDDAVRAALKGKNAALQMVI
Ga0210404_1005963943300021088SoilMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVR
Ga0210396_1096799523300021180SoilMPVTYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGDVRY
Ga0210396_1098496833300021180SoilMPVKYLSQEWIDAYNDALAGDAVRTAMKGKNATIQMVI
Ga0210396_1118921323300021180SoilMPVKYLSQEWIDEYNAALAADDAVRAALKGKSAALQMVISDSPQ
Ga0210385_1008900313300021402SoilMPVKYLSQEWIDEYNAALAADDAVHAALAGKSASIQ
Ga0210385_1145562713300021402SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVI
Ga0210386_1061682513300021406SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVIS
Ga0210386_1062737323300021406SoilMPVRYLSQEWIDAYNAAVAADDAVRKALKGKSAVIQMVVSG
Ga0210383_1048644533300021407SoilMPVRYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYW
Ga0210384_1127656723300021432SoilMPVKYLSQEWIDQYNAALAGDDAVRAALKGKSAALQTAVWAAP
Ga0210384_1188540823300021432SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPEEGEIR
Ga0210390_1013135013300021474SoilMPVKYLSQEWIDAYNAALTDDAVRAALKGKSAAIQM
Ga0210398_1093825223300021477SoilMPVKYLSQEWIDEYNAALAADDAVHAALAGKSASIQMVISDSPQGEI
Ga0210402_1143882323300021478SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMV
Ga0126371_1035741723300021560Tropical Forest SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVVSDAPEQ
Ga0212123_1019582413300022557Iron-Sulfur Acid SpringMPVRYLSQEWVEAYNAALAGDDAVRAALKGKSAALQMVISGAPEGEVRYW
Ga0233357_102895513300023056SoilMPVKYLSPEWIDAYNATVAADDAVRKALKGKSAVIQMVVA
Ga0247677_101838233300024245SoilMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPEGEIR
Ga0247668_102919513300024331SoilMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPQ
Ga0207684_1090954233300025910Corn, Switchgrass And Miscanthus RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPRDGEI
Ga0207693_1098813013300025915Corn, Switchgrass And Miscanthus RhizosphereMPVKYLSPEWIDAYNAAVAADDAVHKALKGKSAVIQ
Ga0207659_1024112113300025926Miscanthus RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPEGE
Ga0207700_1196404713300025928Corn, Switchgrass And Miscanthus RhizosphereMAVKYLSPEWIDAYNATMAADDAVRKALKGKSAVIQMV
Ga0207640_1038060623300025981Corn RhizosphereMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQM
Ga0209059_130258923300026527SoilMAKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVIS
Ga0208366_101055813300027073Forest SoilMSAMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGA
Ga0208199_104389913300027497Peatlands SoilMPVKYLSREWIDEYNAALTADDAVRASLKGKSASIQMV
Ga0209177_1008302613300027775Agricultural SoilMPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPRDVGAGQPR
Ga0209177_1027904523300027775Agricultural SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPRDGEI
Ga0209693_1027769413300027855SoilMSAMPVKYLSQEWVDQYNAALAGDEVVRAALKGKSATLQMVISGSPQGE
Ga0209380_1009529513300027889SoilMSAMPVKYLSQEWVDQYNAALAGDEAVRAALKGKSATLQMVISGSPQG
Ga0308309_1010910933300028906SoilMSAMPVKYLSQEWVDQYNAALAGDEVVRAALKGKSATLQMVISGSP
Ga0308309_1059763923300028906SoilMPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAAVQMVISG
Ga0311340_1070917123300029943PalsaMPLKYLSPEWIDAYNATVAADDSVRAAMKGKNAVIQMLIAEAPD
Ga0311372_1011166213300030520PalsaMPVKYLSPEWIDAYNATVAEDAAVRAALKGKSAVLQ
Ga0310038_1001675243300030707Peatlands SoilMPVRYLSQEWVEAYNAALAGDAVRAALKGKSAVLQMVISGAPQGEV
Ga0170834_11155824213300031057Forest SoilMPVKYLSPEWIDAYNAVVAADDSVHKALKGKSAVIQMVVADAPVGEIR
Ga0318516_1046488413300031543SoilMSVRYLSPEWIDEYNATLAKDDEVREAMKGKNATIQMVVSDAPQGEVHY
Ga0318534_1000978913300031544SoilMPVKYLSQEWVDQYNAALAGDEAVHAALKGKSAALQM
Ga0318534_1022599213300031544SoilMPVKYLSPEWIDAYNAAVASDDSVRKALKGKSAVLQ
Ga0318538_1033572223300031546SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMLVTDAPE
Ga0318538_1047133213300031546SoilMPVKYLSPEWIDAYNSAMAADDSVRQALKGKSAVIQMV
Ga0318573_1024701413300031564SoilMPVKYLSQQWIDAYNAALAGDGAVRAALAGKSATLQMVISDAPQGEVRYW
Ga0310915_1070554213300031573SoilMPVKYLSQEWVDQYNAALAGDEAVHAALKGKSAALQMVIS
Ga0318572_1016576013300031681SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMVVSDAPSGEV
Ga0310686_10078032423300031708SoilMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSATLQMVISGSPQ
Ga0310686_10352877313300031708SoilMPVKYLSPEWIDAYNAAMTGADSVRTAMKGKSAVLQMVIS
Ga0310686_11329914213300031708SoilMPVRYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPEG
Ga0310686_11435738833300031708SoilMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAP
Ga0318496_1012878013300031713SoilMPVKYLSQEWIDAYNAALAGDGAVRAALAGKSATLQMVISDAPQGEVRYW
Ga0306917_1091484323300031719SoilMPVKYLSQQWIDAYNAALAGDGAVRAALAGKSATLQMVISDAPQGE
Ga0306917_1106823513300031719SoilMPVKYLSPEWIDAYNSAMAADDSVRQALKGKSAVIQMVVVDSP
Ga0318502_1013259823300031747SoilMPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQ
Ga0318492_1034870333300031748SoilMPVTYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMV
Ga0307475_1012643443300031754Hardwood Forest SoilMPVKYLSQEWVDQYNAVLAGDDAVGAALKGKSAALQMVIS
Ga0318535_1028173713300031764SoilMPVKYLSQEWIDAYNAAMADDAVRAAVKGKSATIQMVV
Ga0318521_1042743323300031770SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVI
Ga0318521_1084662413300031770SoilMSVRYLSQEWIDAYNAALARDEAVRAALKGKSAALQMVISGAPQG
Ga0318543_1034538013300031777SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQ
Ga0318543_1046161123300031777SoilMRVRYLSQEWIDAYNDALAGDAVRAAVKGKSATIQ
Ga0318566_1055066213300031779SoilMPVTYLSQEWIDAYNDALAGDAVRAAMKGKNATIQ
Ga0318552_1009063323300031782SoilMSVRYLSPEWIDEYNATLAKDDEVREAMKGKNATIQM
Ga0318503_1029859023300031794SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKSATIQMVVSDAPEQGEI
Ga0318568_1072764323300031819SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMM
Ga0318567_1039714823300031821SoilMPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQGEIRYW
Ga0307478_1030117113300031823Hardwood Forest SoilMPVKYLSQEWVDQYNAALAGDDAVGAALKGKSAALQM
Ga0318564_1004305133300031831SoilMPVKYLSQEWIDAYNAALAGDDSVHSALRGKSATLQMVISGAPQGEV
Ga0310917_1017238113300031833SoilMPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQGE
Ga0310917_1041879113300031833SoilMPVKYLSQEWVDQYNAALAGDEAVHAALKGKSAALQMVISGAPQGDVRY
Ga0306925_1006523353300031890SoilMPVKYLSQEWVDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGDVRYWL
Ga0306925_1169561113300031890SoilMPVKYLSQEWIDAYNDALAGDAVRGAMKGKSATIQMVVADAPEQGEIHYW
Ga0306922_1065577713300032001SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMLV
Ga0318563_1041403623300032009SoilMRVRYLSQEWIDAYNDALAGDAVRAAVKGKSATIQMVVSDAPDGEVHY
Ga0318569_1001834813300032010SoilMPVKYLSQEWVDQYNAALAGDEAVHAALKGKSAALQMVISGA
Ga0318545_1013940733300032042SoilMPVTYLSQEWIDAYNDALAGDAVRAAMKGKNATIQM
Ga0318524_1038711823300032067SoilMPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQMVIS
Ga0318553_1058773423300032068SoilMSVRYLSPEWIDEYNATLAKDDEVREAMKGKNATIQMVVSDAPQGEVHYW
Ga0306924_1128269823300032076SoilMPVTYLSQEWIDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEVRY
Ga0318525_1046170923300032089SoilMPVTYLSQEWIDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEVRYWL
Ga0318525_1054410013300032089SoilMPVTYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVVSDAPEQG
Ga0318540_1062712823300032094SoilMPVKYLSQQWIDAYNAALAGDGAVRAALAGKSATLQMVISDAPQG
Ga0306920_10351110323300032261SoilMPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMMVSDAP
Ga0335085_1196003113300032770SoilMPVKYLSQEWIDAYNDALAGDAVRGSMKGKSATIQMVVSDATGAG
Ga0335074_1030503213300032895SoilMPVKYLSPEWIDAYNATVAADDAVRAAMKGKSAVLQMLIAEAPGGEVHY
Ga0335072_1126744213300032898SoilMPVKYLSPEWIDAYNATVAADDSVRAAMKGKNAVLQMLIADAPDGE
Ga0335073_1174864413300033134SoilMPVKYLSPEWIDAYNATMAADEAVHKALKGKSAVIQMVVADAP
Ga0335073_1177039013300033134SoilMPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.