Basic Information | |
---|---|
Family ID | F065958 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 42 residues |
Representative Sequence | MPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQ |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.21 % |
% of genes near scaffold ends (potentially truncated) | 93.70 % |
% of genes from short scaffolds (< 2000 bps) | 89.76 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.402 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (40.157 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.283 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.819 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF12840 | HTH_20 | 17.32 |
PF00067 | p450 | 12.60 |
PF08327 | AHSA1 | 5.51 |
PF03928 | HbpS-like | 4.72 |
PF00903 | Glyoxalase | 3.94 |
PF00378 | ECH_1 | 3.15 |
PF01613 | Flavin_Reduct | 3.15 |
PF01738 | DLH | 1.57 |
PF02233 | PNTB | 1.57 |
PF00005 | ABC_tran | 1.57 |
PF01022 | HTH_5 | 1.57 |
PF11716 | MDMPI_N | 1.57 |
PF13191 | AAA_16 | 0.79 |
PF03976 | PPK2 | 0.79 |
PF01557 | FAA_hydrolase | 0.79 |
PF04199 | Cyclase | 0.79 |
PF04993 | TfoX_N | 0.79 |
PF01734 | Patatin | 0.79 |
PF12323 | HTH_OrfB_IS605 | 0.79 |
PF07836 | DmpG_comm | 0.79 |
PF02492 | cobW | 0.79 |
PF02036 | SCP2 | 0.79 |
PF02720 | DUF222 | 0.79 |
PF13279 | 4HBT_2 | 0.79 |
PF00464 | SHMT | 0.79 |
PF13367 | PrsW-protease | 0.79 |
PF13343 | SBP_bac_6 | 0.79 |
PF15420 | Abhydrolase_9_N | 0.79 |
PF03466 | LysR_substrate | 0.79 |
PF03641 | Lysine_decarbox | 0.79 |
PF05685 | Uma2 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 12.60 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 3.15 |
COG1282 | NAD/NADP transhydrogenase beta subunit | Energy production and conversion [C] | 1.57 |
COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.79 |
COG0119 | Isopropylmalate/homocitrate/citramalate synthases | Amino acid transport and metabolism [E] | 0.79 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.79 |
COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 0.79 |
COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.79 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.79 |
COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.79 |
COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.79 |
COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.79 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.79 |
COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.40 % |
Unclassified | root | N/A | 12.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559006|FI_contig10173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1013 | Open in IMG/M |
3300000955|JGI1027J12803_109412763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 876 | Open in IMG/M |
3300004081|Ga0063454_102089309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 502 | Open in IMG/M |
3300004092|Ga0062389_102230039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
3300004092|Ga0062389_104199206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
3300005338|Ga0068868_102190105 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005468|Ga0070707_101708359 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300005610|Ga0070763_10219318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1020 | Open in IMG/M |
3300005610|Ga0070763_10399204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 773 | Open in IMG/M |
3300005843|Ga0068860_100300852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1571 | Open in IMG/M |
3300006028|Ga0070717_10119758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2254 | Open in IMG/M |
3300006176|Ga0070765_101822378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 571 | Open in IMG/M |
3300006574|Ga0074056_11781364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 996 | Open in IMG/M |
3300006954|Ga0079219_10153931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1232 | Open in IMG/M |
3300009700|Ga0116217_10428837 | Not Available | 837 | Open in IMG/M |
3300009824|Ga0116219_10680030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 563 | Open in IMG/M |
3300010322|Ga0134084_10186618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 718 | Open in IMG/M |
3300010343|Ga0074044_10301842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
3300010358|Ga0126370_11705732 | Not Available | 606 | Open in IMG/M |
3300012096|Ga0137389_10549903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 991 | Open in IMG/M |
3300012209|Ga0137379_10033075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 4981 | Open in IMG/M |
3300012210|Ga0137378_11058131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 726 | Open in IMG/M |
3300012351|Ga0137386_10091009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2148 | Open in IMG/M |
3300012351|Ga0137386_10247990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1280 | Open in IMG/M |
3300012356|Ga0137371_10219505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1487 | Open in IMG/M |
3300012356|Ga0137371_11225258 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300012916|Ga0157310_10338809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 604 | Open in IMG/M |
3300016422|Ga0182039_12110479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 519 | Open in IMG/M |
3300016445|Ga0182038_11348925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 638 | Open in IMG/M |
3300017823|Ga0187818_10275742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300017926|Ga0187807_1048527 | Not Available | 1316 | Open in IMG/M |
3300017928|Ga0187806_1002306 | All Organisms → cellular organisms → Bacteria | 5027 | Open in IMG/M |
3300017942|Ga0187808_10170915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 962 | Open in IMG/M |
3300017942|Ga0187808_10281164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 748 | Open in IMG/M |
3300017974|Ga0187777_11381211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 519 | Open in IMG/M |
3300018047|Ga0187859_10726621 | Not Available | 566 | Open in IMG/M |
3300018058|Ga0187766_10694575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 702 | Open in IMG/M |
3300018085|Ga0187772_10452714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 900 | Open in IMG/M |
3300020579|Ga0210407_11430342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300020583|Ga0210401_10791924 | Not Available | 808 | Open in IMG/M |
3300021088|Ga0210404_10059639 | All Organisms → cellular organisms → Bacteria | 1824 | Open in IMG/M |
3300021180|Ga0210396_10967995 | Not Available | 722 | Open in IMG/M |
3300021180|Ga0210396_10984968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 715 | Open in IMG/M |
3300021180|Ga0210396_11189213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 639 | Open in IMG/M |
3300021402|Ga0210385_10089003 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
3300021402|Ga0210385_11455627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 524 | Open in IMG/M |
3300021406|Ga0210386_10616825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
3300021406|Ga0210386_10627373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 928 | Open in IMG/M |
3300021407|Ga0210383_10486445 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300021432|Ga0210384_11276567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 639 | Open in IMG/M |
3300021432|Ga0210384_11885408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
3300021474|Ga0210390_10131350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2104 | Open in IMG/M |
3300021477|Ga0210398_10938252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 692 | Open in IMG/M |
3300021478|Ga0210402_11438823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
3300021560|Ga0126371_10357417 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
3300022557|Ga0212123_10195824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1505 | Open in IMG/M |
3300023056|Ga0233357_1028955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 682 | Open in IMG/M |
3300024245|Ga0247677_1018382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 997 | Open in IMG/M |
3300024331|Ga0247668_1029195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1133 | Open in IMG/M |
3300025910|Ga0207684_10909542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 739 | Open in IMG/M |
3300025915|Ga0207693_10988130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 643 | Open in IMG/M |
3300025926|Ga0207659_10241121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1462 | Open in IMG/M |
3300025928|Ga0207700_11964047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 512 | Open in IMG/M |
3300025981|Ga0207640_10380606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1143 | Open in IMG/M |
3300026527|Ga0209059_1302589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 541 | Open in IMG/M |
3300027073|Ga0208366_1010558 | Not Available | 971 | Open in IMG/M |
3300027497|Ga0208199_1043899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 962 | Open in IMG/M |
3300027775|Ga0209177_10083026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
3300027775|Ga0209177_10279045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 629 | Open in IMG/M |
3300027855|Ga0209693_10277694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 819 | Open in IMG/M |
3300027889|Ga0209380_10095295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1717 | Open in IMG/M |
3300028906|Ga0308309_10109109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2158 | Open in IMG/M |
3300028906|Ga0308309_10597639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 957 | Open in IMG/M |
3300029943|Ga0311340_10709171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 861 | Open in IMG/M |
3300030520|Ga0311372_10111662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4912 | Open in IMG/M |
3300030707|Ga0310038_10016752 | All Organisms → cellular organisms → Bacteria | 4664 | Open in IMG/M |
3300031057|Ga0170834_111558242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 561 | Open in IMG/M |
3300031543|Ga0318516_10464884 | Not Available | 727 | Open in IMG/M |
3300031544|Ga0318534_10009789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4762 | Open in IMG/M |
3300031544|Ga0318534_10225992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. MTM3W5.2 | 1080 | Open in IMG/M |
3300031546|Ga0318538_10335722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 816 | Open in IMG/M |
3300031546|Ga0318538_10471332 | Not Available | 680 | Open in IMG/M |
3300031564|Ga0318573_10247014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 951 | Open in IMG/M |
3300031573|Ga0310915_10705542 | Not Available | 712 | Open in IMG/M |
3300031681|Ga0318572_10165760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1281 | Open in IMG/M |
3300031708|Ga0310686_100780324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
3300031708|Ga0310686_103528773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 609 | Open in IMG/M |
3300031708|Ga0310686_113299142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 930 | Open in IMG/M |
3300031708|Ga0310686_114357388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 991 | Open in IMG/M |
3300031713|Ga0318496_10128780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1373 | Open in IMG/M |
3300031719|Ga0306917_10914843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 686 | Open in IMG/M |
3300031719|Ga0306917_11068235 | Not Available | 629 | Open in IMG/M |
3300031747|Ga0318502_10132598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1409 | Open in IMG/M |
3300031748|Ga0318492_10348703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 774 | Open in IMG/M |
3300031754|Ga0307475_10126434 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
3300031764|Ga0318535_10281737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
3300031770|Ga0318521_10427433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 791 | Open in IMG/M |
3300031770|Ga0318521_10846624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
3300031777|Ga0318543_10345380 | Not Available | 666 | Open in IMG/M |
3300031777|Ga0318543_10461611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
3300031779|Ga0318566_10550662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
3300031782|Ga0318552_10090633 | Not Available | 1500 | Open in IMG/M |
3300031794|Ga0318503_10298590 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300031819|Ga0318568_10727643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 616 | Open in IMG/M |
3300031821|Ga0318567_10397148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 781 | Open in IMG/M |
3300031823|Ga0307478_10301171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1313 | Open in IMG/M |
3300031831|Ga0318564_10043051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1954 | Open in IMG/M |
3300031833|Ga0310917_10172381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1438 | Open in IMG/M |
3300031833|Ga0310917_10418791 | Not Available | 911 | Open in IMG/M |
3300031890|Ga0306925_10065233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3825 | Open in IMG/M |
3300031890|Ga0306925_11695611 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300032001|Ga0306922_10655777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1108 | Open in IMG/M |
3300032009|Ga0318563_10414036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 729 | Open in IMG/M |
3300032010|Ga0318569_10018348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2774 | Open in IMG/M |
3300032042|Ga0318545_10139407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 860 | Open in IMG/M |
3300032067|Ga0318524_10387118 | Not Available | 728 | Open in IMG/M |
3300032068|Ga0318553_10587734 | Not Available | 583 | Open in IMG/M |
3300032076|Ga0306924_11282698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 788 | Open in IMG/M |
3300032089|Ga0318525_10461709 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300032089|Ga0318525_10544100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 593 | Open in IMG/M |
3300032094|Ga0318540_10627128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
3300032261|Ga0306920_103511103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. CNU-125 | 579 | Open in IMG/M |
3300032770|Ga0335085_11960031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 595 | Open in IMG/M |
3300032895|Ga0335074_10305032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1815 | Open in IMG/M |
3300032898|Ga0335072_11267442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 649 | Open in IMG/M |
3300033134|Ga0335073_11748644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 584 | Open in IMG/M |
3300033134|Ga0335073_11770390 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 40.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.09% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.51% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.51% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.15% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.94% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.36% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.36% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.57% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.57% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.57% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.79% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FI_00113380 | 2166559006 | Grass Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPGG |
JGI1027J12803_1094127633 | 3300000955 | Soil | MPVKYLSQDWIDAYNDALAGDVVRGALKGKNATIQMVI |
Ga0063454_1020893092 | 3300004081 | Soil | MPVKYLSQEWIDAYNATVSSSDAVAKAMKGKSAVLQMVIAEAP |
Ga0062389_1022300391 | 3300004092 | Bog Forest Soil | MPLKYLSPEWIDAYNATVAADDSVRAAMKGKNAVIQMLIAEAP |
Ga0062389_1041992062 | 3300004092 | Bog Forest Soil | MSILPVQYLSQEWVDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEV |
Ga0068868_1021901052 | 3300005338 | Miscanthus Rhizosphere | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDA |
Ga0070707_1017083591 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVISDAP |
Ga0070763_102193182 | 3300005610 | Soil | MPVTYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAP |
Ga0070763_103992042 | 3300005610 | Soil | MSAMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSA |
Ga0068860_1003008521 | 3300005843 | Switchgrass Rhizosphere | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAP |
Ga0070717_101197581 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAMPVKYLSREWFEAYNAALSGDDAVRAALKGKSAALQMV |
Ga0070765_1018223781 | 3300006176 | Soil | MPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISG |
Ga0074056_117813643 | 3300006574 | Soil | MPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVI |
Ga0079219_101539312 | 3300006954 | Agricultural Soil | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPRDVGAGQPR* |
Ga0116217_104288371 | 3300009700 | Peatlands Soil | MPVTYLSQEWVEAYNATMAGDDAVRAALKGKSAALQMVIS |
Ga0116219_106800301 | 3300009824 | Peatlands Soil | MPVKYLSQEWIDEYNAALEQDAVRAALKGKSATIQMLIS |
Ga0134084_101866183 | 3300010322 | Grasslands Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISD |
Ga0074044_103018423 | 3300010343 | Bog Forest Soil | MPVKYLSQEWIDAYNATMASDEAVHAALKGKNATIQMVNSDS |
Ga0126370_117057321 | 3300010358 | Tropical Forest Soil | MPVTYLSQEWIDQYNAALAGDEAVRAALKGKSAALQMVISGAPQ |
Ga0137389_105499032 | 3300012096 | Vadose Zone Soil | MPVKYLSQQWIDAYNAAMASDEAVRAARKGKSATVSASVSWAG |
Ga0137379_100330751 | 3300012209 | Vadose Zone Soil | MPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVISDAPRD |
Ga0137378_110581312 | 3300012210 | Vadose Zone Soil | MPVKYLSQEWIDAYNAALASDDAVRAAMKGKSATIQMVISD |
Ga0137386_100910091 | 3300012351 | Vadose Zone Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVIADAPE |
Ga0137386_102479902 | 3300012351 | Vadose Zone Soil | MPVKYLSQQWIDAYNAAMASDEAVRAAMKGKSAAGIDTEY* |
Ga0137371_102195051 | 3300012356 | Vadose Zone Soil | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPERGEIRYW |
Ga0137371_112252581 | 3300012356 | Vadose Zone Soil | MPVKYLSQEWIDAYNNALAGDAVRAAMKGKNATIQMVISDAPEEGEIRYWLR |
Ga0157310_103388091 | 3300012916 | Soil | MPVKYLSQEWIDAYNDALAGAAVRGAMQGKNATIQMVISDAPRD |
Ga0182039_121104791 | 3300016422 | Soil | MPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMLVTDAPEG |
Ga0182038_113489252 | 3300016445 | Soil | MPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQ |
Ga0187818_102757422 | 3300017823 | Freshwater Sediment | MPVKYLSQEWIDEYNAAIEQDAVRAALKGKSAALQMVISDA |
Ga0187807_10485271 | 3300017926 | Freshwater Sediment | MPVRYLSQEWVEAYNAALAGDDAVRAALKGKSAVLQMV |
Ga0187806_10023061 | 3300017928 | Freshwater Sediment | MPVKYLSQEWVEAYNTALAGDDAVRAALKGKNAVLQM |
Ga0187808_101709152 | 3300017942 | Freshwater Sediment | MPVRYLSREWVEAYNAALAGDDAVRAALKGKSAVLQMVISGA |
Ga0187808_102811641 | 3300017942 | Freshwater Sediment | MPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVIA |
Ga0187777_113812111 | 3300017974 | Tropical Peatland | MPVKYLSQEWVDAYNATLAGDDAVRAALKGKSAALQMVISGAPQGE |
Ga0187859_107266212 | 3300018047 | Peatland | MPVKYLSPEWIDAYNAAMAGDDAVAAAMKGKSAVLQMVISDAPGGE |
Ga0187766_106945751 | 3300018058 | Tropical Peatland | MPVKYLSQEWIDAYNAAMADDAIRTAVKGKSPTIQM |
Ga0187772_104527141 | 3300018085 | Tropical Peatland | MPVKYLSQEWIDAYNAALAGDEAARAALKGKSAALQMVNTIDTEY |
Ga0210407_114303421 | 3300020579 | Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPEEAEIRY |
Ga0210401_107919242 | 3300020583 | Soil | MPVTYLSQEWIEAYNAALAGDDAVRAALKGKNAALQMVI |
Ga0210404_100596394 | 3300021088 | Soil | MPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVR |
Ga0210396_109679952 | 3300021180 | Soil | MPVTYLSQEWIEAYNAALAGDDAVRAALKGKSAALQMVISGAPQGDVRY |
Ga0210396_109849683 | 3300021180 | Soil | MPVKYLSQEWIDAYNDALAGDAVRTAMKGKNATIQMVI |
Ga0210396_111892132 | 3300021180 | Soil | MPVKYLSQEWIDEYNAALAADDAVRAALKGKSAALQMVISDSPQ |
Ga0210385_100890031 | 3300021402 | Soil | MPVKYLSQEWIDEYNAALAADDAVHAALAGKSASIQ |
Ga0210385_114556271 | 3300021402 | Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVI |
Ga0210386_106168251 | 3300021406 | Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVIS |
Ga0210386_106273732 | 3300021406 | Soil | MPVRYLSQEWIDAYNAAVAADDAVRKALKGKSAVIQMVVSG |
Ga0210383_104864453 | 3300021407 | Soil | MPVRYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPQGEVRYW |
Ga0210384_112765672 | 3300021432 | Soil | MPVKYLSQEWIDQYNAALAGDDAVRAALKGKSAALQTAVWAAP |
Ga0210384_118854082 | 3300021432 | Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPEEGEIR |
Ga0210390_101313501 | 3300021474 | Soil | MPVKYLSQEWIDAYNAALTDDAVRAALKGKSAAIQM |
Ga0210398_109382522 | 3300021477 | Soil | MPVKYLSQEWIDEYNAALAADDAVHAALAGKSASIQMVISDSPQGEI |
Ga0210402_114388232 | 3300021478 | Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMV |
Ga0126371_103574172 | 3300021560 | Tropical Forest Soil | MPVKYLSQEWIDAYNDALAGDAVRGAMKGKNATIQMVVSDAPEQ |
Ga0212123_101958241 | 3300022557 | Iron-Sulfur Acid Spring | MPVRYLSQEWVEAYNAALAGDDAVRAALKGKSAALQMVISGAPEGEVRYW |
Ga0233357_10289551 | 3300023056 | Soil | MPVKYLSPEWIDAYNATVAADDAVRKALKGKSAVIQMVVA |
Ga0247677_10183823 | 3300024245 | Soil | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPEGEIR |
Ga0247668_10291951 | 3300024331 | Soil | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPQ |
Ga0207684_109095423 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPRDGEI |
Ga0207693_109881301 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVKYLSPEWIDAYNAAVAADDAVHKALKGKSAVIQ |
Ga0207659_102411211 | 3300025926 | Miscanthus Rhizosphere | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPEGE |
Ga0207700_119640471 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVKYLSPEWIDAYNATMAADDAVRKALKGKSAVIQMV |
Ga0207640_103806062 | 3300025981 | Corn Rhizosphere | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQM |
Ga0209059_13025892 | 3300026527 | Soil | MAKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVIS |
Ga0208366_10105581 | 3300027073 | Forest Soil | MSAMPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGA |
Ga0208199_10438991 | 3300027497 | Peatlands Soil | MPVKYLSREWIDEYNAALTADDAVRASLKGKSASIQMV |
Ga0209177_100830261 | 3300027775 | Agricultural Soil | MPVKYLSQEWIDAYNDALAGDAVRGALKGKNATIQMVISDAPRDVGAGQPR |
Ga0209177_102790452 | 3300027775 | Agricultural Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVISDAPRDGEI |
Ga0209693_102776941 | 3300027855 | Soil | MSAMPVKYLSQEWVDQYNAALAGDEVVRAALKGKSATLQMVISGSPQGE |
Ga0209380_100952951 | 3300027889 | Soil | MSAMPVKYLSQEWVDQYNAALAGDEAVRAALKGKSATLQMVISGSPQG |
Ga0308309_101091093 | 3300028906 | Soil | MSAMPVKYLSQEWVDQYNAALAGDEVVRAALKGKSATLQMVISGSP |
Ga0308309_105976392 | 3300028906 | Soil | MPVKYLSQEWIEAYNAALAGDDAVRAALKGKSAAVQMVISG |
Ga0311340_107091712 | 3300029943 | Palsa | MPLKYLSPEWIDAYNATVAADDSVRAAMKGKNAVIQMLIAEAPD |
Ga0311372_101116621 | 3300030520 | Palsa | MPVKYLSPEWIDAYNATVAEDAAVRAALKGKSAVLQ |
Ga0310038_100167524 | 3300030707 | Peatlands Soil | MPVRYLSQEWVEAYNAALAGDAVRAALKGKSAVLQMVISGAPQGEV |
Ga0170834_1115582421 | 3300031057 | Forest Soil | MPVKYLSPEWIDAYNAVVAADDSVHKALKGKSAVIQMVVADAPVGEIR |
Ga0318516_104648841 | 3300031543 | Soil | MSVRYLSPEWIDEYNATLAKDDEVREAMKGKNATIQMVVSDAPQGEVHY |
Ga0318534_100097891 | 3300031544 | Soil | MPVKYLSQEWVDQYNAALAGDEAVHAALKGKSAALQM |
Ga0318534_102259921 | 3300031544 | Soil | MPVKYLSPEWIDAYNAAVASDDSVRKALKGKSAVLQ |
Ga0318538_103357222 | 3300031546 | Soil | MPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMLVTDAPE |
Ga0318538_104713321 | 3300031546 | Soil | MPVKYLSPEWIDAYNSAMAADDSVRQALKGKSAVIQMV |
Ga0318573_102470141 | 3300031564 | Soil | MPVKYLSQQWIDAYNAALAGDGAVRAALAGKSATLQMVISDAPQGEVRYW |
Ga0310915_107055421 | 3300031573 | Soil | MPVKYLSQEWVDQYNAALAGDEAVHAALKGKSAALQMVIS |
Ga0318572_101657601 | 3300031681 | Soil | MPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMVVSDAPSGEV |
Ga0310686_1007803242 | 3300031708 | Soil | MPVKYLSQEWVDQYNAALAGDDAVRAALKGKSATLQMVISGSPQ |
Ga0310686_1035287731 | 3300031708 | Soil | MPVKYLSPEWIDAYNAAMTGADSVRTAMKGKSAVLQMVIS |
Ga0310686_1132991421 | 3300031708 | Soil | MPVRYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAPEG |
Ga0310686_1143573883 | 3300031708 | Soil | MPVKYLSQEWVDQYNAALAGDDAVRAALKGKSAALQMVISGAP |
Ga0318496_101287801 | 3300031713 | Soil | MPVKYLSQEWIDAYNAALAGDGAVRAALAGKSATLQMVISDAPQGEVRYW |
Ga0306917_109148432 | 3300031719 | Soil | MPVKYLSQQWIDAYNAALAGDGAVRAALAGKSATLQMVISDAPQGE |
Ga0306917_110682351 | 3300031719 | Soil | MPVKYLSPEWIDAYNSAMAADDSVRQALKGKSAVIQMVVVDSP |
Ga0318502_101325982 | 3300031747 | Soil | MPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQ |
Ga0318492_103487033 | 3300031748 | Soil | MPVTYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMV |
Ga0307475_101264344 | 3300031754 | Hardwood Forest Soil | MPVKYLSQEWVDQYNAVLAGDDAVGAALKGKSAALQMVIS |
Ga0318535_102817371 | 3300031764 | Soil | MPVKYLSQEWIDAYNAAMADDAVRAAVKGKSATIQMVV |
Ga0318521_104274332 | 3300031770 | Soil | MPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVI |
Ga0318521_108466241 | 3300031770 | Soil | MSVRYLSQEWIDAYNAALARDEAVRAALKGKSAALQMVISGAPQG |
Ga0318543_103453801 | 3300031777 | Soil | MPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQ |
Ga0318543_104616112 | 3300031777 | Soil | MRVRYLSQEWIDAYNDALAGDAVRAAVKGKSATIQ |
Ga0318566_105506621 | 3300031779 | Soil | MPVTYLSQEWIDAYNDALAGDAVRAAMKGKNATIQ |
Ga0318552_100906332 | 3300031782 | Soil | MSVRYLSPEWIDEYNATLAKDDEVREAMKGKNATIQM |
Ga0318503_102985902 | 3300031794 | Soil | MPVKYLSQEWIDAYNDALAGDAVRGAMKGKSATIQMVVSDAPEQGEI |
Ga0318568_107276432 | 3300031819 | Soil | MPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMM |
Ga0318567_103971482 | 3300031821 | Soil | MPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQGEIRYW |
Ga0307478_103011711 | 3300031823 | Hardwood Forest Soil | MPVKYLSQEWVDQYNAALAGDDAVGAALKGKSAALQM |
Ga0318564_100430513 | 3300031831 | Soil | MPVKYLSQEWIDAYNAALAGDDSVHSALRGKSATLQMVISGAPQGEV |
Ga0310917_101723811 | 3300031833 | Soil | MPVKYLSQEWIDAYNAALAGDDAVHAALKGKSATLQMVISGAPQGE |
Ga0310917_104187911 | 3300031833 | Soil | MPVKYLSQEWVDQYNAALAGDEAVHAALKGKSAALQMVISGAPQGDVRY |
Ga0306925_100652335 | 3300031890 | Soil | MPVKYLSQEWVDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGDVRYWL |
Ga0306925_116956111 | 3300031890 | Soil | MPVKYLSQEWIDAYNDALAGDAVRGAMKGKSATIQMVVADAPEQGEIHYW |
Ga0306922_106557771 | 3300032001 | Soil | MPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMLV |
Ga0318563_104140362 | 3300032009 | Soil | MRVRYLSQEWIDAYNDALAGDAVRAAVKGKSATIQMVVSDAPDGEVHY |
Ga0318569_100183481 | 3300032010 | Soil | MPVKYLSQEWVDQYNAALAGDEAVHAALKGKSAALQMVISGA |
Ga0318545_101394073 | 3300032042 | Soil | MPVTYLSQEWIDAYNDALAGDAVRAAMKGKNATIQM |
Ga0318524_103871182 | 3300032067 | Soil | MPVKYLSQEWIDAYNAALAGDDAVHAALRGKSATLQMVIS |
Ga0318553_105877342 | 3300032068 | Soil | MSVRYLSPEWIDEYNATLAKDDEVREAMKGKNATIQMVVSDAPQGEVHYW |
Ga0306924_112826982 | 3300032076 | Soil | MPVTYLSQEWIDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEVRY |
Ga0318525_104617092 | 3300032089 | Soil | MPVTYLSQEWIDQYNAALAGDEAVRAALKGKSAALQMVISGAPQGEVRYWL |
Ga0318525_105441001 | 3300032089 | Soil | MPVTYLSQEWIDAYNDALAGDAVRAAMKGKNATIQMVVSDAPEQG |
Ga0318540_106271282 | 3300032094 | Soil | MPVKYLSQQWIDAYNAALAGDGAVRAALAGKSATLQMVISDAPQG |
Ga0306920_1035111032 | 3300032261 | Soil | MPVKYLSPEWIDAYNATVAADDSVRKALKGKSAVIQMMVSDAP |
Ga0335085_119600311 | 3300032770 | Soil | MPVKYLSQEWIDAYNDALAGDAVRGSMKGKSATIQMVVSDATGAG |
Ga0335074_103050321 | 3300032895 | Soil | MPVKYLSPEWIDAYNATVAADDAVRAAMKGKSAVLQMLIAEAPGGEVHY |
Ga0335072_112674421 | 3300032898 | Soil | MPVKYLSPEWIDAYNATVAADDSVRAAMKGKNAVLQMLIADAPDGE |
Ga0335073_117486441 | 3300033134 | Soil | MPVKYLSPEWIDAYNATMAADEAVHKALKGKSAVIQMVVADAP |
Ga0335073_117703901 | 3300033134 | Soil | MPVKYLSQEWIDAYNDALAGDAVRAAMKGKNATIQ |
⦗Top⦘ |