NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F066115

Metagenome Family F066115

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066115
Family Type Metagenome
Number of Sequences 127
Average Sequence Length 46 residues
Representative Sequence MSGNNGKKALHVATFSGWYRFEQDGKELKQTKRDLSYWTLTCMSV
Number of Associated Samples 119
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.21 %
% of genes near scaffold ends (potentially truncated) 88.98 %
% of genes from short scaffolds (< 2000 bps) 85.83 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.488 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.661 % of family members)
Environment Ontology (ENVO) Unclassified
(37.795 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.220 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 5.48%    β-sheet: 30.14%    Coil/Unstructured: 64.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF00857Isochorismatase 62.20
PF13646HEAT_2 6.30
PF09084NMT1 5.51
PF13417GST_N_3 3.15
PF12006DUF3500 2.36
PF02798GST_N 1.57
PF00248Aldo_ket_red 0.79
PF12697Abhydrolase_6 0.79
PF13419HAD_2 0.79
PF14697Fer4_21 0.79
PF04480DUF559 0.79
PF05973Gp49 0.79
PF02371Transposase_20 0.79
PF14706Tnp_DNA_bind 0.79
PF11695DUF3291 0.79
PF00355Rieske 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 62.20
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 62.20
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.51
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 5.51
COG3547TransposaseMobilome: prophages, transposons [X] 0.79
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.79
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.28 %
UnclassifiedrootN/A4.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0654169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101808224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1546Open in IMG/M
3300000574|JGI1357J11328_10156320All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium642Open in IMG/M
3300000787|JGI11643J11755_11451793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium872Open in IMG/M
3300000890|JGI11643J12802_10647785All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300000956|JGI10216J12902_116440711All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300002124|C687J26631_10042267All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1601Open in IMG/M
3300002124|C687J26631_10143520Not Available801Open in IMG/M
3300003987|Ga0055471_10274124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300003993|Ga0055468_10208566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300004019|Ga0055439_10017462All Organisms → cellular organisms → Bacteria → Proteobacteria1679Open in IMG/M
3300004114|Ga0062593_103065909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300005178|Ga0066688_10007784All Organisms → cellular organisms → Bacteria5083Open in IMG/M
3300005338|Ga0068868_100426845All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1149Open in IMG/M
3300005366|Ga0070659_100462989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1077Open in IMG/M
3300005434|Ga0070709_11664982All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300005535|Ga0070684_100799045All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium882Open in IMG/M
3300005535|Ga0070684_101497722All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300005536|Ga0070697_100182168All Organisms → cellular organisms → Archaea → Euryarchaeota1780Open in IMG/M
3300005536|Ga0070697_100343528All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1288Open in IMG/M
3300005544|Ga0070686_100506879All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium937Open in IMG/M
3300005546|Ga0070696_101068293Not Available677Open in IMG/M
3300005549|Ga0070704_101970897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300005563|Ga0068855_101002555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium877Open in IMG/M
3300005586|Ga0066691_10222512All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1104Open in IMG/M
3300005900|Ga0075272_1043154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium832Open in IMG/M
3300006049|Ga0075417_10011764All Organisms → cellular organisms → Bacteria → Proteobacteria3276Open in IMG/M
3300006169|Ga0082029_1589252All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300006175|Ga0070712_100185848All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1623Open in IMG/M
3300006224|Ga0079037_100709118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium983Open in IMG/M
3300006854|Ga0075425_100156019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2617Open in IMG/M
3300006880|Ga0075429_100663466All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300006904|Ga0075424_101731730All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300006914|Ga0075436_101442935All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300006954|Ga0079219_10613679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium800Open in IMG/M
3300009093|Ga0105240_11646004All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium671Open in IMG/M
3300009094|Ga0111539_10118759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3099Open in IMG/M
3300009137|Ga0066709_103401039All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300009147|Ga0114129_10452145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1684Open in IMG/M
3300009156|Ga0111538_13025590All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium587Open in IMG/M
3300009553|Ga0105249_11880364All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300009609|Ga0105347_1018579All Organisms → cellular organisms → Bacteria2374Open in IMG/M
3300009609|Ga0105347_1443001All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300009792|Ga0126374_10186754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1297Open in IMG/M
3300010037|Ga0126304_10577064All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp.757Open in IMG/M
3300010046|Ga0126384_11405668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300010376|Ga0126381_101363976All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1025Open in IMG/M
3300010397|Ga0134124_11028430All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium837Open in IMG/M
3300010403|Ga0134123_10517299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1127Open in IMG/M
3300011398|Ga0137348_1018178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1089Open in IMG/M
3300011403|Ga0137313_1084022All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300011431|Ga0137438_1049405All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica1247Open in IMG/M
3300011441|Ga0137452_1302100Not Available534Open in IMG/M
3300012160|Ga0137349_1029436All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium903Open in IMG/M
3300012171|Ga0137342_1068261All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium737Open in IMG/M
3300012206|Ga0137380_10011845All Organisms → cellular organisms → Bacteria7943Open in IMG/M
3300012350|Ga0137372_11033663All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300012357|Ga0137384_10764970All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium782Open in IMG/M
3300012358|Ga0137368_10440131All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium849Open in IMG/M
3300012511|Ga0157332_1029950All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium688Open in IMG/M
3300012582|Ga0137358_10552885All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium774Open in IMG/M
3300012913|Ga0157298_10025410All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1166Open in IMG/M
3300012924|Ga0137413_11294973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300012961|Ga0164302_10000323All Organisms → cellular organisms → Bacteria13201Open in IMG/M
3300012971|Ga0126369_10236500All Organisms → cellular organisms → Bacteria1788Open in IMG/M
3300013102|Ga0157371_10238990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1306Open in IMG/M
3300014311|Ga0075322_1002812All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2939Open in IMG/M
3300014884|Ga0180104_1176113All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300014885|Ga0180063_1112621All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300015201|Ga0173478_10308726All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium720Open in IMG/M
3300015254|Ga0180089_1053008All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium803Open in IMG/M
3300015357|Ga0134072_10017840All Organisms → cellular organisms → Bacteria1732Open in IMG/M
3300015372|Ga0132256_102233301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium651Open in IMG/M
3300015374|Ga0132255_105728943All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium526Open in IMG/M
3300017792|Ga0163161_12114813All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300017930|Ga0187825_10009595All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3234Open in IMG/M
3300017939|Ga0187775_10532786All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300018052|Ga0184638_1209812All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium683Open in IMG/M
3300018061|Ga0184619_10090349All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1369Open in IMG/M
3300018078|Ga0184612_10341257All Organisms → cellular organisms → Bacteria → Proteobacteria761Open in IMG/M
3300018081|Ga0184625_10446913All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium662Open in IMG/M
3300018422|Ga0190265_11908560All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium701Open in IMG/M
3300018422|Ga0190265_13806999All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300018468|Ga0066662_10027632All Organisms → cellular organisms → Bacteria3313Open in IMG/M
3300021073|Ga0210378_10000958All Organisms → cellular organisms → Bacteria → Proteobacteria15220Open in IMG/M
3300021073|Ga0210378_10027579All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2273Open in IMG/M
3300024056|Ga0124853_1470643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1692Open in IMG/M
3300025155|Ga0209320_10146190Not Available1055Open in IMG/M
3300025155|Ga0209320_10311074All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20653Open in IMG/M
3300025160|Ga0209109_10569935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300025312|Ga0209321_10007406All Organisms → cellular organisms → Bacteria → Proteobacteria7115Open in IMG/M
3300025322|Ga0209641_10176993All Organisms → cellular organisms → Bacteria → Proteobacteria1612Open in IMG/M
3300025324|Ga0209640_10531860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium955Open in IMG/M
3300025537|Ga0210061_1072379Not Available598Open in IMG/M
3300025912|Ga0207707_10731341All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300025913|Ga0207695_11305241All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300025931|Ga0207644_10308000All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1278Open in IMG/M
3300025932|Ga0207690_11241886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium622Open in IMG/M
3300025999|Ga0208417_104658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium654Open in IMG/M
3300026011|Ga0208532_1008611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300026142|Ga0207698_11728070All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300026297|Ga0209237_1236815All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300026524|Ga0209690_1092705All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300026535|Ga0256867_10065761All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1439Open in IMG/M
3300026555|Ga0179593_1072801All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2274Open in IMG/M
3300027252|Ga0209973_1011643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1059Open in IMG/M
3300027252|Ga0209973_1046050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300027526|Ga0209968_1030475All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium901Open in IMG/M
3300027665|Ga0209983_1025527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1246Open in IMG/M
3300027818|Ga0209706_10553959All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300027909|Ga0209382_10200507All Organisms → cellular organisms → Bacteria → Proteobacteria2288Open in IMG/M
3300028809|Ga0247824_10524301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium702Open in IMG/M
3300028828|Ga0307312_11062662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium536Open in IMG/M
3300030620|Ga0302046_10657017All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium851Open in IMG/M
3300031198|Ga0307500_10164168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium643Open in IMG/M
3300031231|Ga0170824_127085639All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300031824|Ga0307413_11586607All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300031858|Ga0310892_10855296All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium634Open in IMG/M
3300031890|Ga0306925_10263796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1856Open in IMG/M
3300031965|Ga0326597_10058041All Organisms → cellular organisms → Bacteria4823Open in IMG/M
3300032005|Ga0307411_10932741All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300032205|Ga0307472_101656226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium631Open in IMG/M
3300033407|Ga0214472_10001413All Organisms → cellular organisms → Bacteria27094Open in IMG/M
3300033433|Ga0326726_11891353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300033551|Ga0247830_10832118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium735Open in IMG/M
3300034178|Ga0364934_0199797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.66%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.30%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.51%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.72%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.15%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil3.15%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.15%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.94%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.36%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.36%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.36%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.57%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.57%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.57%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.57%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.57%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.57%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.79%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.79%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.79%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.79%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.79%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.79%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.79%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.79%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005900Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011403Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300012160Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025999Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026011Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_065416912228664021SoilMSGNNGKKALHVATFSGWYRFEQDGKELKQTKRDLSYWTLTCMSV
INPhiseqgaiiFebDRAFT_10180822413300000364SoilMSXANAKSKGLHVATMSGWYRFEKNGREWKQVKRD
JGI1357J11328_1015632023300000574GroundwaterMSGTNGKQALHVATFSGWYRFEQNGKEFTQTKRDLSYWTLTCMSVDEEDPKTIYA
JGI11643J11755_1145179313300000787SoilMSENNGKKALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSVDP
JGI11643J12802_1064778523300000890SoilMSENNGKKALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSVDPD
JGI10216J12902_11644071113300000956SoilMSGMNGKKALHVATFSGWYRFEQNGKNFLQTKRDLSYWTLTCMTVDPQNPNTLYAGT
C687J26631_1004226723300002124SoilMNGGSGKQALHVATFSGWYRFEQNGKEWRQTKRDLSYWTFT*
C687J26631_1014352013300002124SoilIEERIMNGTNGKQALHAATFSGWYRFEQNGKEWRQTKRDLSY*
Ga0055471_1027412413300003987Natural And Restored WetlandsMNDTNGKRALHVATFSGWCRFEQQGKNFIQTKRDLSYWTITCMSVDPEDPRTI
Ga0055468_1020856623300003993Natural And Restored WetlandsMNETTGGKALHVATFSGWYRFEQQGKSFVQSKRDLSYWTITCMSVDPEDPRTI
Ga0055466_1000641613300003997Natural And Restored WetlandsVATFDFAAKEKIMNATNGKKALHVATFSGWYRFEQNGKDLKQTKR
Ga0055439_1001746213300004019Natural And Restored WetlandsMSQSKNKKALHVATFSGWYRFEQDGKTWKQVKRDLSYWALTCLSVDP
Ga0062593_10306590913300004114SoilMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDN
Ga0066688_1000778463300005178SoilMSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLT
Ga0068868_10042684533300005338Miscanthus RhizosphereMTETNGKKALHVATFSGWYRFEQNGKAFRQTKRDLSYWTLTCMSV
Ga0070659_10046298933300005366Corn RhizosphereMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVD
Ga0070709_1166498223300005434Corn, Switchgrass And Miscanthus RhizosphereMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTL
Ga0070684_10079904513300005535Corn RhizosphereMTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSVDPANPQKI
Ga0070684_10149772213300005535Corn RhizosphereMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDNPQKLYAG
Ga0070697_10018216823300005536Corn, Switchgrass And Miscanthus RhizosphereMSVSKTKKALHVATFSGWYRFEQDGKAWKQIKRDLSYWALTCLSVDPEQPELIYCGQ*
Ga0070697_10034352813300005536Corn, Switchgrass And Miscanthus RhizosphereMSSNGKKALHVATFSGWYRFEQDGKEFKQTKRDLTYWTLTCMSVDPANS*
Ga0070686_10050687933300005544Switchgrass RhizosphereMSSNGKKALHVATFSGWYRFEQDGKAFKQTKRDLSYWSLTCMSVDPRNTQKIYAG
Ga0070696_10106829323300005546Corn, Switchgrass And Miscanthus RhizosphereMSGTNGKKALHVATFSGWYRFEQNDKEFTQTKRDLSYWTLT
Ga0070704_10197089713300005549Corn, Switchgrass And Miscanthus RhizosphereMSGNNGKKALHVATFSGWYRFEQDGQALKQTKRDLTYWTLTCMSVDPANPQKIYAG
Ga0068855_10100255513300005563Corn RhizosphereMTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDL
Ga0066691_1022251213300005586SoilMAGTNGKKALHVATFSGWYRFEQDGAVFRQTKRDLTYWTLTCMSVDP
Ga0075272_104315413300005900Rice Paddy SoilMAGTIGKKALHVATFSGWYRFEQDGNEFKQNKRDLTY*
Ga0075417_1001176413300006049Populus RhizosphereMGGTSGKKALHVATFSGWYRFEQDGKELRQTKRDLTYWTLTCMSVDPDNP
Ga0082029_158925213300006169Termite NestMSADNGNKALHVATFSGWYRFEQEGKQLKQTKRDLSYWTLT
Ga0070712_10018584833300006175Corn, Switchgrass And Miscanthus RhizosphereMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDNPQ
Ga0079037_10070911813300006224Freshwater WetlandsMSGTNGKKALHVATFSGWYRFEQNGREFTQTKRDLSYWT
Ga0075425_10015601913300006854Populus RhizosphereMAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYWTLTCMSVDPDNPEKI
Ga0075429_10066346633300006880Populus RhizosphereMSATSGQKALHVATFSGWYRFEQNGKQFTQTKRDLSYWTLTCMSVD
Ga0075424_10173173013300006904Populus RhizosphereMSPSLEKKALHVATFSGWYRFEQGGKEWKQVKRDLSYWA
Ga0075436_10144293513300006914Populus RhizosphereMPRTSKKALHVATFSGWYRFEQDGKEFRQTKRDLTYWTLTCMSVDPENPEKIYA
Ga0079219_1061367923300006954Agricultural SoilMSGTNNKAIHVATFSGWYRFEKDGKEFRQTKRDLTYWTLTCMSVDPDNPEKIYAGS
Ga0105240_1164600423300009093Corn RhizosphereMTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSVDP
Ga0111539_1011875943300009094Populus RhizosphereMTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSVDPENPQK
Ga0066709_10340103913300009137Grasslands SoilMSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLSVDS
Ga0114129_1045214543300009147Populus RhizosphereMSGTNGKKALHVATFSGWYRFEQNGKEFSQIKRDLSYWTLTCMSVDQENP
Ga0111538_1302559013300009156Populus RhizosphereMSGANAESKGLHVATMSGWYRFEKNGREWKQVKRDLSYWT
Ga0105249_1188036413300009553Switchgrass RhizosphereMTESNGAKKGLHVATLSGWYRFEQDGREWKQTKRDLSYWSLTCMSVDPENPQKIY
Ga0105347_101857913300009609SoilMSSASGKNGALHVATMSGWYRFEKDGEAWKQMKRDLTY
Ga0105347_144300123300009609SoilMSGTNGKNALHLATLSGWYRFEQRGKDFKQTKRDLSYWTLTCLAVDPDDRKTIYA
Ga0126374_1018675413300009792Tropical Forest SoilMSGVNGKNKALHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCLAVDP
Ga0126304_1057706413300010037Serpentine SoilMSGTNGTKALHVATFSGWYRFEQNGSEFIQTKRDLSYWTLTER
Ga0126384_1140566823300010046Tropical Forest SoilMSGLNGKNKALHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCL
Ga0126381_10136397623300010376Tropical Forest SoilMTETNGKKAIHLATFSGWYRFEQEGKIFRQTKRDLSYWTLTCMSVDPDNPQKIY
Ga0134124_1102843023300010397Terrestrial SoilMKNALHVTTLSGWYRFEQDGGEWKQARRDLSYWALTCLSVDPEMPQRIYAGT
Ga0134123_1051729913300010403Terrestrial SoilMSGSNGKKALHVATFSGWYRFEQDGKKFKQIKRDLTYWTLTC
Ga0137348_101817833300011398SoilMSGANTKSKGLHVATMSGWYRFEKDGREWKQVKRDLSYWTLT
Ga0137313_108402213300011403SoilMSATSGQKALHVATFSGWYRFEQDGKQFTQTKRDLSYWTLTCMSVDQEDPKT
Ga0137438_104940543300011431SoilMSATNGKKALHVATFSGWYRFEQNGKTFTQTKRDLSY
Ga0137452_130210013300011441SoilMSGTNGKKALHVATFSGWYRFEQDGKEFRQTMRDLSY
Ga0137349_102943623300012160SoilMSGANAKSKGLHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCLAVDPENSELIYA
Ga0137342_106826113300012171SoilMNGGSGKQALHVATFSGWYRFEQNGKEWRQTKRDLSYWTLTCMS
Ga0137380_1001184593300012206Vadose Zone SoilMSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLS
Ga0137372_1103366323300012350Vadose Zone SoilMSGANAKGKGLHVATMSGWYRFEKDGRAWKQVKRDLSYWTL
Ga0137384_1076497023300012357Vadose Zone SoilMGGTNGKKALHVATFSGWYRFEQDGKELRQTKRDL
Ga0137368_1044013113300012358Vadose Zone SoilMSSNGKKALHVATFSGWYRFEQDGKELRQTKRDLTYWTLTCMS
Ga0157332_102995023300012511SoilMAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYWSLTCMSVDPD
Ga0137358_1055288513300012582Vadose Zone SoilMSSTNDKNKALHVATMSGWYRFEKNGREWKQVKRDLSYWTLT
Ga0157298_1002541033300012913SoilMTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCM
Ga0137413_1129497313300012924Vadose Zone SoilMAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYWTLTCM
Ga0164302_1000032363300012961SoilMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDNSQKIYVGS*
Ga0126369_1023650033300012971Tropical Forest SoilMTETNGKKAIHLATFSGWYRFEQEGKNFRQTKRDLSY
Ga0157371_1023899033300013102Corn RhizosphereMTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMS
Ga0075322_100281253300014311Natural And Restored WetlandsMAGTNGKKALHVATFSGWYRFEQDGKEFKQIKRDLTYWTLTC
Ga0180104_117611323300014884SoilMMSNPNGDKAVHVATFSGWYRFEQRGIDFIQTKRDLSYWTLTCMSVDPDD
Ga0180063_111262133300014885SoilMSNTNGKKALHVATFSGWYRFEQDGKEFKQTKRDLTYWTLTCMSVDPANPQKIYAG
Ga0173478_1030872623300015201SoilMTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSVDPEN
Ga0180089_105300823300015254SoilMNGGSGKQALHVATFSGWYRFEQNGKEWRQTRRDL
Ga0134072_1001784013300015357Grasslands SoilMSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLSVE
Ga0132256_10223330113300015372Arabidopsis RhizosphereMTDRNGKQALHVATFSGWYRFEQDGKIFRQTKRDLTYWTLTCMSVDPENPQKIYA
Ga0132255_10572894323300015374Arabidopsis RhizosphereMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDL
Ga0163161_1211481323300017792Switchgrass RhizosphereMAGTNGRKALHVATFSGWYRFEQDGKEFRQTKRDLTYWTLTCMSVDPDNPEKIYA
Ga0187825_1000959543300017930Freshwater SedimentMAGTNGKKALHVATFSGWYRFEQDGNEFKQTKRDLTYWTLTCMSVDPKNPEKIYAGSE
Ga0187775_1053278623300017939Tropical PeatlandMSGRNFEHRALHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCLAVDPENPELIYA
Ga0184638_120981213300018052Groundwater SedimentMSRNNGKKALHVATFSGWYRFEQDGREFRQTKRDLTYWTLTCMSVDP
Ga0184619_1009034933300018061Groundwater SedimentMSGSNGKKALHVATFSGWYRFEQDAKEFKQTKRDLTYWTLTCM
Ga0184612_1034125713300018078Groundwater SedimentMSETNGNKALHVATFSGWYRFEQNGKEFKQTKRDLS
Ga0184625_1044691313300018081Groundwater SedimentVSGANAKSKGLHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCL
Ga0190265_1190856013300018422SoilMSSNGKNALHVATFSGWYRFVQDGKDFKQTKRDLTYW
Ga0190265_1380699913300018422SoilMSNPNADKALHVATFSGWYRFEQRGKDFIQIKRDLSYWTLTCMSVDP
Ga0066662_1002763253300018468Grasslands SoilMSALNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLSVDPEDPK
Ga0210378_1000095813300021073Groundwater SedimentMSRNNGKKALHVATFSGWYRFEQDGREFRQTKRDLTYWTLTCMSVDPDNPQ
Ga0210378_1002757913300021073Groundwater SedimentMSGSNGKKALHVATFSGWYRFEQDGKEFKQTKRDLTYWT
Ga0124853_147064353300024056Freshwater WetlandsMSGTNGKKALHVANIFRLYRFEQNGKEFTQTKRDL
Ga0209320_1014619033300025155SoilMSGPNGNKALHVATFSGWYRFEQNGKEWRQTKRDLSYWTIT
Ga0209320_1031107423300025155SoilMNGGSGKQALHVATFSGWYRFEQNGKEWRQTKRDLSYWTFT
Ga0209109_1056993513300025160SoilMSGNNGKKALHVATFSGWYRFEQDGKAFKQTKRDLTYWTLTCMSVDPANPQKIYAG
Ga0209321_1000740623300025312SoilMNDNRALHVATFSDWYRFEQKGRQWTQTKRDLSYLTFT
Ga0209641_1017699323300025322SoilMSEANGKKALHVATFSDWYRFKQKGREWTLTKCDLSYLTFT
Ga0209640_1053186013300025324SoilMNGGSGKQALHVATFSGWYRFEQNGKEWRQTKRDLSYW
Ga0210061_107237913300025537Natural And Restored WetlandsMTESNGAKKALHVATLSGWYRFEQDGREWKQTKRDL
Ga0207707_1073134113300025912Corn RhizosphereMPETSKKALHVATFSGWYRFEQDGKEFRQTKRDLTYWTLTCMSVDP
Ga0207695_1130524113300025913Corn RhizosphereMTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSV
Ga0207644_1030800013300025931Switchgrass RhizosphereMTGTNGKKALHVATFSGWYRFEQQGKALIQTKRDLSYWTLTCMS
Ga0207690_1124188613300025932Corn RhizosphereMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDNS
Ga0208417_10465813300025999Rice Paddy SoilMSANNGGKSALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSVDPDNPQKIY
Ga0208532_100861113300026011Rice Paddy SoilMSANNGGKSALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSV
Ga0207698_1172807013300026142Corn RhizosphereMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLT
Ga0209237_123681523300026297Grasslands SoilMSALNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLSVDPEDPKT
Ga0209690_109270533300026524SoilMSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTL
Ga0256867_1006576113300026535SoilMSEKNGKKALHVATFSGWYRFEQEGKEFRQTKRDLTYWTLTCMSVDPANPQKIYAGS
Ga0179593_107280113300026555Vadose Zone SoilMAGTNGKKALHVATFSGWYRFEQDGAVFRQTKRDLTYWTLTCMSVDPD
Ga0209973_101164323300027252Arabidopsis Thaliana RhizosphereMSENNGKKALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSVD
Ga0209973_104605013300027252Arabidopsis Thaliana RhizosphereMAVNNGKKALHVATFSGWYRFEQNGKDLQQTKRDLTYWTLTCMSVDPDNPQK
Ga0209968_103047513300027526Arabidopsis Thaliana RhizosphereMSENNGKKALHVATFSGWYRFEQNGKDLQQTKRDLTYWTLTCMSVDPD
Ga0209983_102552713300027665Arabidopsis Thaliana RhizosphereMAVNNGKKALHVATFSGWYRFEQNGKDLQQTKRDL
Ga0209706_1055395923300027818Freshwater SedimentMSENNGKKALHVATFSGWYRFEQNGKDFKQTKRDLTYWTLTCMSVD
Ga0209382_1020050763300027909Populus RhizosphereMSGTNGKKALHVATFSGWYRFEQNGKEFTQTKRDLSYWTLTCMSVDEDDPKTIY
Ga0247824_1052430123300028809SoilMTESIEKALHVATLSGWYRFERDGKEWKQTKRDLSYWS
Ga0307312_1106266223300028828SoilMAGTNGKKALHVATFSGWYRFEQDGAVFRQTKRDLTYWTL
Ga0302046_1065701723300030620SoilMTNTNGKKALHVATFSGWYRFEQHGSNLIQTRRDLSYWTLTCM
Ga0307500_1016416823300031198SoilMAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYGP
Ga0170824_12708563923300031231Forest SoilMSASSKKALHVATFSGWYRFEQDGKAWKQIKRDLSYWALTCLSVDPEQPELIYAG
Ga0307413_1158660723300031824RhizosphereMSGMNGKKALHVATFSGWYRFEQNGKNFLQTKRDLSYWTLTCMTVDPEDPNT
Ga0310892_1085529613300031858SoilMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLT
Ga0306925_1026379613300031890SoilMSSANDKNKALHVATMSGWYRFEKDGREWKQVKRDLSYWTLT
Ga0326597_1005804153300031965SoilMSEANGKKALHVATFSGWYWYEQKGREWTQTKRDLSYLTFT
Ga0307411_1093274123300032005RhizosphereMSGMNGKKALHVATFSGWYRFEQNGKNFLQTKRDLSYWTLTCMTVDPEDPNTLYAG
Ga0307472_10165622623300032205Hardwood Forest SoilMAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYWSLTCMSV
Ga0214472_10001413173300033407SoilMSEANGKKTLHVATFSGWYRFEQNSKEWKHTKGDLSYLTFT
Ga0326726_1189135323300033433Peat SoilMSVTNNNPGLHVATLSGWYRFEYDGSQWRQLKRDLTYWTITC
Ga0247830_1083211823300033551SoilMIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPD
Ga0364934_0199797_2_1663300034178SedimentMNKGNYALHVATMSGWYRFERDGGEWRQVRRALTYWSLTCLSVDPEEPRLVYAGT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.