Basic Information | |
---|---|
Family ID | F066115 |
Family Type | Metagenome |
Number of Sequences | 127 |
Average Sequence Length | 46 residues |
Representative Sequence | MSGNNGKKALHVATFSGWYRFEQDGKELKQTKRDLSYWTLTCMSV |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.21 % |
% of genes near scaffold ends (potentially truncated) | 88.98 % |
% of genes from short scaffolds (< 2000 bps) | 85.83 % |
Associated GOLD sequencing projects | 114 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.488 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.661 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.795 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.220 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.48% β-sheet: 30.14% Coil/Unstructured: 64.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF00857 | Isochorismatase | 62.20 |
PF13646 | HEAT_2 | 6.30 |
PF09084 | NMT1 | 5.51 |
PF13417 | GST_N_3 | 3.15 |
PF12006 | DUF3500 | 2.36 |
PF02798 | GST_N | 1.57 |
PF00248 | Aldo_ket_red | 0.79 |
PF12697 | Abhydrolase_6 | 0.79 |
PF13419 | HAD_2 | 0.79 |
PF14697 | Fer4_21 | 0.79 |
PF04480 | DUF559 | 0.79 |
PF05973 | Gp49 | 0.79 |
PF02371 | Transposase_20 | 0.79 |
PF14706 | Tnp_DNA_bind | 0.79 |
PF11695 | DUF3291 | 0.79 |
PF00355 | Rieske | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 62.20 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 62.20 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 5.51 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 5.51 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.79 |
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.79 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.28 % |
Unclassified | root | N/A | 4.72 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c0654169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101808224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1546 | Open in IMG/M |
3300000574|JGI1357J11328_10156320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
3300000787|JGI11643J11755_11451793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 872 | Open in IMG/M |
3300000890|JGI11643J12802_10647785 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300000956|JGI10216J12902_116440711 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
3300002124|C687J26631_10042267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1601 | Open in IMG/M |
3300002124|C687J26631_10143520 | Not Available | 801 | Open in IMG/M |
3300003987|Ga0055471_10274124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
3300003993|Ga0055468_10208566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
3300004019|Ga0055439_10017462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1679 | Open in IMG/M |
3300004114|Ga0062593_103065909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
3300005178|Ga0066688_10007784 | All Organisms → cellular organisms → Bacteria | 5083 | Open in IMG/M |
3300005338|Ga0068868_100426845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1149 | Open in IMG/M |
3300005366|Ga0070659_100462989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1077 | Open in IMG/M |
3300005434|Ga0070709_11664982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
3300005535|Ga0070684_100799045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 882 | Open in IMG/M |
3300005535|Ga0070684_101497722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
3300005536|Ga0070697_100182168 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1780 | Open in IMG/M |
3300005536|Ga0070697_100343528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1288 | Open in IMG/M |
3300005544|Ga0070686_100506879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 937 | Open in IMG/M |
3300005546|Ga0070696_101068293 | Not Available | 677 | Open in IMG/M |
3300005549|Ga0070704_101970897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
3300005563|Ga0068855_101002555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 877 | Open in IMG/M |
3300005586|Ga0066691_10222512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1104 | Open in IMG/M |
3300005900|Ga0075272_1043154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 832 | Open in IMG/M |
3300006049|Ga0075417_10011764 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3276 | Open in IMG/M |
3300006169|Ga0082029_1589252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
3300006175|Ga0070712_100185848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1623 | Open in IMG/M |
3300006224|Ga0079037_100709118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 983 | Open in IMG/M |
3300006854|Ga0075425_100156019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2617 | Open in IMG/M |
3300006880|Ga0075429_100663466 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300006904|Ga0075424_101731730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 662 | Open in IMG/M |
3300006914|Ga0075436_101442935 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300006954|Ga0079219_10613679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 800 | Open in IMG/M |
3300009093|Ga0105240_11646004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 671 | Open in IMG/M |
3300009094|Ga0111539_10118759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3099 | Open in IMG/M |
3300009137|Ga0066709_103401039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
3300009147|Ga0114129_10452145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1684 | Open in IMG/M |
3300009156|Ga0111538_13025590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 587 | Open in IMG/M |
3300009553|Ga0105249_11880364 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300009609|Ga0105347_1018579 | All Organisms → cellular organisms → Bacteria | 2374 | Open in IMG/M |
3300009609|Ga0105347_1443001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
3300009792|Ga0126374_10186754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1297 | Open in IMG/M |
3300010037|Ga0126304_10577064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp. | 757 | Open in IMG/M |
3300010046|Ga0126384_11405668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
3300010376|Ga0126381_101363976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1025 | Open in IMG/M |
3300010397|Ga0134124_11028430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 837 | Open in IMG/M |
3300010403|Ga0134123_10517299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1127 | Open in IMG/M |
3300011398|Ga0137348_1018178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1089 | Open in IMG/M |
3300011403|Ga0137313_1084022 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300011431|Ga0137438_1049405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfurirhabdus → Sulfurirhabdus autotrophica | 1247 | Open in IMG/M |
3300011441|Ga0137452_1302100 | Not Available | 534 | Open in IMG/M |
3300012160|Ga0137349_1029436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 903 | Open in IMG/M |
3300012171|Ga0137342_1068261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 737 | Open in IMG/M |
3300012206|Ga0137380_10011845 | All Organisms → cellular organisms → Bacteria | 7943 | Open in IMG/M |
3300012350|Ga0137372_11033663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
3300012357|Ga0137384_10764970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 782 | Open in IMG/M |
3300012358|Ga0137368_10440131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 849 | Open in IMG/M |
3300012511|Ga0157332_1029950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 688 | Open in IMG/M |
3300012582|Ga0137358_10552885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
3300012913|Ga0157298_10025410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1166 | Open in IMG/M |
3300012924|Ga0137413_11294973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
3300012961|Ga0164302_10000323 | All Organisms → cellular organisms → Bacteria | 13201 | Open in IMG/M |
3300012971|Ga0126369_10236500 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
3300013102|Ga0157371_10238990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1306 | Open in IMG/M |
3300014311|Ga0075322_1002812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2939 | Open in IMG/M |
3300014884|Ga0180104_1176113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
3300014885|Ga0180063_1112621 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300015201|Ga0173478_10308726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 720 | Open in IMG/M |
3300015254|Ga0180089_1053008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
3300015357|Ga0134072_10017840 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
3300015372|Ga0132256_102233301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 651 | Open in IMG/M |
3300015374|Ga0132255_105728943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 526 | Open in IMG/M |
3300017792|Ga0163161_12114813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300017930|Ga0187825_10009595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3234 | Open in IMG/M |
3300017939|Ga0187775_10532786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
3300018052|Ga0184638_1209812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 683 | Open in IMG/M |
3300018061|Ga0184619_10090349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1369 | Open in IMG/M |
3300018078|Ga0184612_10341257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 761 | Open in IMG/M |
3300018081|Ga0184625_10446913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 662 | Open in IMG/M |
3300018422|Ga0190265_11908560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 701 | Open in IMG/M |
3300018422|Ga0190265_13806999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
3300018468|Ga0066662_10027632 | All Organisms → cellular organisms → Bacteria | 3313 | Open in IMG/M |
3300021073|Ga0210378_10000958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 15220 | Open in IMG/M |
3300021073|Ga0210378_10027579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2273 | Open in IMG/M |
3300024056|Ga0124853_1470643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1692 | Open in IMG/M |
3300025155|Ga0209320_10146190 | Not Available | 1055 | Open in IMG/M |
3300025155|Ga0209320_10311074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20 | 653 | Open in IMG/M |
3300025160|Ga0209109_10569935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
3300025312|Ga0209321_10007406 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7115 | Open in IMG/M |
3300025322|Ga0209641_10176993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1612 | Open in IMG/M |
3300025324|Ga0209640_10531860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 955 | Open in IMG/M |
3300025537|Ga0210061_1072379 | Not Available | 598 | Open in IMG/M |
3300025912|Ga0207707_10731341 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300025913|Ga0207695_11305241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
3300025931|Ga0207644_10308000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1278 | Open in IMG/M |
3300025932|Ga0207690_11241886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 622 | Open in IMG/M |
3300025999|Ga0208417_104658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 654 | Open in IMG/M |
3300026011|Ga0208532_1008611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
3300026142|Ga0207698_11728070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 641 | Open in IMG/M |
3300026297|Ga0209237_1236815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
3300026524|Ga0209690_1092705 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300026535|Ga0256867_10065761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1439 | Open in IMG/M |
3300026555|Ga0179593_1072801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2274 | Open in IMG/M |
3300027252|Ga0209973_1011643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1059 | Open in IMG/M |
3300027252|Ga0209973_1046050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 649 | Open in IMG/M |
3300027526|Ga0209968_1030475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 901 | Open in IMG/M |
3300027665|Ga0209983_1025527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1246 | Open in IMG/M |
3300027818|Ga0209706_10553959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
3300027909|Ga0209382_10200507 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2288 | Open in IMG/M |
3300028809|Ga0247824_10524301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 702 | Open in IMG/M |
3300028828|Ga0307312_11062662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
3300030620|Ga0302046_10657017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 851 | Open in IMG/M |
3300031198|Ga0307500_10164168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 643 | Open in IMG/M |
3300031231|Ga0170824_127085639 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300031824|Ga0307413_11586607 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300031858|Ga0310892_10855296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 634 | Open in IMG/M |
3300031890|Ga0306925_10263796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1856 | Open in IMG/M |
3300031965|Ga0326597_10058041 | All Organisms → cellular organisms → Bacteria | 4823 | Open in IMG/M |
3300032005|Ga0307411_10932741 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300032205|Ga0307472_101656226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
3300033407|Ga0214472_10001413 | All Organisms → cellular organisms → Bacteria | 27094 | Open in IMG/M |
3300033433|Ga0326726_11891353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
3300033551|Ga0247830_10832118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 735 | Open in IMG/M |
3300034178|Ga0364934_0199797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 757 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.66% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.30% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.51% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.72% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.15% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.15% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.15% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.15% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.15% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.94% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.36% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.36% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.36% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.57% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.57% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.57% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.57% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.57% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.79% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.79% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.79% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.79% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300003997 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005900 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
3300011403 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2 | Environmental | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300012160 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2 | Environmental | Open in IMG/M |
3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300014311 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 | Environmental | Open in IMG/M |
3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025999 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
3300026011 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_06541691 | 2228664021 | Soil | MSGNNGKKALHVATFSGWYRFEQDGKELKQTKRDLSYWTLTCMSV |
INPhiseqgaiiFebDRAFT_1018082241 | 3300000364 | Soil | MSXANAKSKGLHVATMSGWYRFEKNGREWKQVKRD |
JGI1357J11328_101563202 | 3300000574 | Groundwater | MSGTNGKQALHVATFSGWYRFEQNGKEFTQTKRDLSYWTLTCMSVDEEDPKTIYA |
JGI11643J11755_114517931 | 3300000787 | Soil | MSENNGKKALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSVDP |
JGI11643J12802_106477852 | 3300000890 | Soil | MSENNGKKALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSVDPD |
JGI10216J12902_1164407111 | 3300000956 | Soil | MSGMNGKKALHVATFSGWYRFEQNGKNFLQTKRDLSYWTLTCMTVDPQNPNTLYAGT |
C687J26631_100422672 | 3300002124 | Soil | MNGGSGKQALHVATFSGWYRFEQNGKEWRQTKRDLSYWTFT* |
C687J26631_101435201 | 3300002124 | Soil | IEERIMNGTNGKQALHAATFSGWYRFEQNGKEWRQTKRDLSY* |
Ga0055471_102741241 | 3300003987 | Natural And Restored Wetlands | MNDTNGKRALHVATFSGWCRFEQQGKNFIQTKRDLSYWTITCMSVDPEDPRTI |
Ga0055468_102085662 | 3300003993 | Natural And Restored Wetlands | MNETTGGKALHVATFSGWYRFEQQGKSFVQSKRDLSYWTITCMSVDPEDPRTI |
Ga0055466_100064161 | 3300003997 | Natural And Restored Wetlands | VATFDFAAKEKIMNATNGKKALHVATFSGWYRFEQNGKDLKQTKR |
Ga0055439_100174621 | 3300004019 | Natural And Restored Wetlands | MSQSKNKKALHVATFSGWYRFEQDGKTWKQVKRDLSYWALTCLSVDP |
Ga0062593_1030659091 | 3300004114 | Soil | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDN |
Ga0066688_100077846 | 3300005178 | Soil | MSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLT |
Ga0068868_1004268453 | 3300005338 | Miscanthus Rhizosphere | MTETNGKKALHVATFSGWYRFEQNGKAFRQTKRDLSYWTLTCMSV |
Ga0070659_1004629893 | 3300005366 | Corn Rhizosphere | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVD |
Ga0070709_116649822 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTL |
Ga0070684_1007990451 | 3300005535 | Corn Rhizosphere | MTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSVDPANPQKI |
Ga0070684_1014977221 | 3300005535 | Corn Rhizosphere | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDNPQKLYAG |
Ga0070697_1001821682 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVSKTKKALHVATFSGWYRFEQDGKAWKQIKRDLSYWALTCLSVDPEQPELIYCGQ* |
Ga0070697_1003435281 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSNGKKALHVATFSGWYRFEQDGKEFKQTKRDLTYWTLTCMSVDPANS* |
Ga0070686_1005068793 | 3300005544 | Switchgrass Rhizosphere | MSSNGKKALHVATFSGWYRFEQDGKAFKQTKRDLSYWSLTCMSVDPRNTQKIYAG |
Ga0070696_1010682932 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGTNGKKALHVATFSGWYRFEQNDKEFTQTKRDLSYWTLT |
Ga0070704_1019708971 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGNNGKKALHVATFSGWYRFEQDGQALKQTKRDLTYWTLTCMSVDPANPQKIYAG |
Ga0068855_1010025551 | 3300005563 | Corn Rhizosphere | MTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDL |
Ga0066691_102225121 | 3300005586 | Soil | MAGTNGKKALHVATFSGWYRFEQDGAVFRQTKRDLTYWTLTCMSVDP |
Ga0075272_10431541 | 3300005900 | Rice Paddy Soil | MAGTIGKKALHVATFSGWYRFEQDGNEFKQNKRDLTY* |
Ga0075417_100117641 | 3300006049 | Populus Rhizosphere | MGGTSGKKALHVATFSGWYRFEQDGKELRQTKRDLTYWTLTCMSVDPDNP |
Ga0082029_15892521 | 3300006169 | Termite Nest | MSADNGNKALHVATFSGWYRFEQEGKQLKQTKRDLSYWTLT |
Ga0070712_1001858483 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDNPQ |
Ga0079037_1007091181 | 3300006224 | Freshwater Wetlands | MSGTNGKKALHVATFSGWYRFEQNGREFTQTKRDLSYWT |
Ga0075425_1001560191 | 3300006854 | Populus Rhizosphere | MAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYWTLTCMSVDPDNPEKI |
Ga0075429_1006634663 | 3300006880 | Populus Rhizosphere | MSATSGQKALHVATFSGWYRFEQNGKQFTQTKRDLSYWTLTCMSVD |
Ga0075424_1017317301 | 3300006904 | Populus Rhizosphere | MSPSLEKKALHVATFSGWYRFEQGGKEWKQVKRDLSYWA |
Ga0075436_1014429351 | 3300006914 | Populus Rhizosphere | MPRTSKKALHVATFSGWYRFEQDGKEFRQTKRDLTYWTLTCMSVDPENPEKIYA |
Ga0079219_106136792 | 3300006954 | Agricultural Soil | MSGTNNKAIHVATFSGWYRFEKDGKEFRQTKRDLTYWTLTCMSVDPDNPEKIYAGS |
Ga0105240_116460042 | 3300009093 | Corn Rhizosphere | MTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSVDP |
Ga0111539_101187594 | 3300009094 | Populus Rhizosphere | MTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSVDPENPQK |
Ga0066709_1034010391 | 3300009137 | Grasslands Soil | MSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLSVDS |
Ga0114129_104521454 | 3300009147 | Populus Rhizosphere | MSGTNGKKALHVATFSGWYRFEQNGKEFSQIKRDLSYWTLTCMSVDQENP |
Ga0111538_130255901 | 3300009156 | Populus Rhizosphere | MSGANAESKGLHVATMSGWYRFEKNGREWKQVKRDLSYWT |
Ga0105249_118803641 | 3300009553 | Switchgrass Rhizosphere | MTESNGAKKGLHVATLSGWYRFEQDGREWKQTKRDLSYWSLTCMSVDPENPQKIY |
Ga0105347_10185791 | 3300009609 | Soil | MSSASGKNGALHVATMSGWYRFEKDGEAWKQMKRDLTY |
Ga0105347_14430012 | 3300009609 | Soil | MSGTNGKNALHLATLSGWYRFEQRGKDFKQTKRDLSYWTLTCLAVDPDDRKTIYA |
Ga0126374_101867541 | 3300009792 | Tropical Forest Soil | MSGVNGKNKALHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCLAVDP |
Ga0126304_105770641 | 3300010037 | Serpentine Soil | MSGTNGTKALHVATFSGWYRFEQNGSEFIQTKRDLSYWTLTER |
Ga0126384_114056682 | 3300010046 | Tropical Forest Soil | MSGLNGKNKALHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCL |
Ga0126381_1013639762 | 3300010376 | Tropical Forest Soil | MTETNGKKAIHLATFSGWYRFEQEGKIFRQTKRDLSYWTLTCMSVDPDNPQKIY |
Ga0134124_110284302 | 3300010397 | Terrestrial Soil | MKNALHVTTLSGWYRFEQDGGEWKQARRDLSYWALTCLSVDPEMPQRIYAGT |
Ga0134123_105172991 | 3300010403 | Terrestrial Soil | MSGSNGKKALHVATFSGWYRFEQDGKKFKQIKRDLTYWTLTC |
Ga0137348_10181783 | 3300011398 | Soil | MSGANTKSKGLHVATMSGWYRFEKDGREWKQVKRDLSYWTLT |
Ga0137313_10840221 | 3300011403 | Soil | MSATSGQKALHVATFSGWYRFEQDGKQFTQTKRDLSYWTLTCMSVDQEDPKT |
Ga0137438_10494054 | 3300011431 | Soil | MSATNGKKALHVATFSGWYRFEQNGKTFTQTKRDLSY |
Ga0137452_13021001 | 3300011441 | Soil | MSGTNGKKALHVATFSGWYRFEQDGKEFRQTMRDLSY |
Ga0137349_10294362 | 3300012160 | Soil | MSGANAKSKGLHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCLAVDPENSELIYA |
Ga0137342_10682611 | 3300012171 | Soil | MNGGSGKQALHVATFSGWYRFEQNGKEWRQTKRDLSYWTLTCMS |
Ga0137380_100118459 | 3300012206 | Vadose Zone Soil | MSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLS |
Ga0137372_110336632 | 3300012350 | Vadose Zone Soil | MSGANAKGKGLHVATMSGWYRFEKDGRAWKQVKRDLSYWTL |
Ga0137384_107649702 | 3300012357 | Vadose Zone Soil | MGGTNGKKALHVATFSGWYRFEQDGKELRQTKRDL |
Ga0137368_104401311 | 3300012358 | Vadose Zone Soil | MSSNGKKALHVATFSGWYRFEQDGKELRQTKRDLTYWTLTCMS |
Ga0157332_10299502 | 3300012511 | Soil | MAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYWSLTCMSVDPD |
Ga0137358_105528851 | 3300012582 | Vadose Zone Soil | MSSTNDKNKALHVATMSGWYRFEKNGREWKQVKRDLSYWTLT |
Ga0157298_100254103 | 3300012913 | Soil | MTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCM |
Ga0137413_112949731 | 3300012924 | Vadose Zone Soil | MAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYWTLTCM |
Ga0164302_100003236 | 3300012961 | Soil | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDNSQKIYVGS* |
Ga0126369_102365003 | 3300012971 | Tropical Forest Soil | MTETNGKKAIHLATFSGWYRFEQEGKNFRQTKRDLSY |
Ga0157371_102389903 | 3300013102 | Corn Rhizosphere | MTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMS |
Ga0075322_10028125 | 3300014311 | Natural And Restored Wetlands | MAGTNGKKALHVATFSGWYRFEQDGKEFKQIKRDLTYWTLTC |
Ga0180104_11761132 | 3300014884 | Soil | MMSNPNGDKAVHVATFSGWYRFEQRGIDFIQTKRDLSYWTLTCMSVDPDD |
Ga0180063_11126213 | 3300014885 | Soil | MSNTNGKKALHVATFSGWYRFEQDGKEFKQTKRDLTYWTLTCMSVDPANPQKIYAG |
Ga0173478_103087262 | 3300015201 | Soil | MTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSVDPEN |
Ga0180089_10530082 | 3300015254 | Soil | MNGGSGKQALHVATFSGWYRFEQNGKEWRQTRRDL |
Ga0134072_100178401 | 3300015357 | Grasslands Soil | MSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLSVE |
Ga0132256_1022333011 | 3300015372 | Arabidopsis Rhizosphere | MTDRNGKQALHVATFSGWYRFEQDGKIFRQTKRDLTYWTLTCMSVDPENPQKIYA |
Ga0132255_1057289432 | 3300015374 | Arabidopsis Rhizosphere | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDL |
Ga0163161_121148132 | 3300017792 | Switchgrass Rhizosphere | MAGTNGRKALHVATFSGWYRFEQDGKEFRQTKRDLTYWTLTCMSVDPDNPEKIYA |
Ga0187825_100095954 | 3300017930 | Freshwater Sediment | MAGTNGKKALHVATFSGWYRFEQDGNEFKQTKRDLTYWTLTCMSVDPKNPEKIYAGSE |
Ga0187775_105327862 | 3300017939 | Tropical Peatland | MSGRNFEHRALHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCLAVDPENPELIYA |
Ga0184638_12098121 | 3300018052 | Groundwater Sediment | MSRNNGKKALHVATFSGWYRFEQDGREFRQTKRDLTYWTLTCMSVDP |
Ga0184619_100903493 | 3300018061 | Groundwater Sediment | MSGSNGKKALHVATFSGWYRFEQDAKEFKQTKRDLTYWTLTCM |
Ga0184612_103412571 | 3300018078 | Groundwater Sediment | MSETNGNKALHVATFSGWYRFEQNGKEFKQTKRDLS |
Ga0184625_104469131 | 3300018081 | Groundwater Sediment | VSGANAKSKGLHVATMSGWYRFEKDGREWKQVKRDLSYWTLTCL |
Ga0190265_119085601 | 3300018422 | Soil | MSSNGKNALHVATFSGWYRFVQDGKDFKQTKRDLTYW |
Ga0190265_138069991 | 3300018422 | Soil | MSNPNADKALHVATFSGWYRFEQRGKDFIQIKRDLSYWTLTCMSVDP |
Ga0066662_100276325 | 3300018468 | Grasslands Soil | MSALNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLSVDPEDPK |
Ga0210378_100009581 | 3300021073 | Groundwater Sediment | MSRNNGKKALHVATFSGWYRFEQDGREFRQTKRDLTYWTLTCMSVDPDNPQ |
Ga0210378_100275791 | 3300021073 | Groundwater Sediment | MSGSNGKKALHVATFSGWYRFEQDGKEFKQTKRDLTYWT |
Ga0124853_14706435 | 3300024056 | Freshwater Wetlands | MSGTNGKKALHVANIFRLYRFEQNGKEFTQTKRDL |
Ga0209320_101461903 | 3300025155 | Soil | MSGPNGNKALHVATFSGWYRFEQNGKEWRQTKRDLSYWTIT |
Ga0209320_103110742 | 3300025155 | Soil | MNGGSGKQALHVATFSGWYRFEQNGKEWRQTKRDLSYWTFT |
Ga0209109_105699351 | 3300025160 | Soil | MSGNNGKKALHVATFSGWYRFEQDGKAFKQTKRDLTYWTLTCMSVDPANPQKIYAG |
Ga0209321_100074062 | 3300025312 | Soil | MNDNRALHVATFSDWYRFEQKGRQWTQTKRDLSYLTFT |
Ga0209641_101769932 | 3300025322 | Soil | MSEANGKKALHVATFSDWYRFKQKGREWTLTKCDLSYLTFT |
Ga0209640_105318601 | 3300025324 | Soil | MNGGSGKQALHVATFSGWYRFEQNGKEWRQTKRDLSYW |
Ga0210061_10723791 | 3300025537 | Natural And Restored Wetlands | MTESNGAKKALHVATLSGWYRFEQDGREWKQTKRDL |
Ga0207707_107313411 | 3300025912 | Corn Rhizosphere | MPETSKKALHVATFSGWYRFEQDGKEFRQTKRDLTYWTLTCMSVDP |
Ga0207695_113052411 | 3300025913 | Corn Rhizosphere | MTETNGKKALHVATFSGWYRFEQNGKTFRQTKRDLSYWTLTCMSV |
Ga0207644_103080001 | 3300025931 | Switchgrass Rhizosphere | MTGTNGKKALHVATFSGWYRFEQQGKALIQTKRDLSYWTLTCMS |
Ga0207690_112418861 | 3300025932 | Corn Rhizosphere | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPDNS |
Ga0208417_1046581 | 3300025999 | Rice Paddy Soil | MSANNGGKSALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSVDPDNPQKIY |
Ga0208532_10086111 | 3300026011 | Rice Paddy Soil | MSANNGGKSALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSV |
Ga0207698_117280701 | 3300026142 | Corn Rhizosphere | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLT |
Ga0209237_12368152 | 3300026297 | Grasslands Soil | MSALNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTLTCLSVDPEDPKT |
Ga0209690_10927053 | 3300026524 | Soil | MSELNNKKALHVATFSGWYRFEQDGKEWKKTKRDLTYWTL |
Ga0256867_100657611 | 3300026535 | Soil | MSEKNGKKALHVATFSGWYRFEQEGKEFRQTKRDLTYWTLTCMSVDPANPQKIYAGS |
Ga0179593_10728011 | 3300026555 | Vadose Zone Soil | MAGTNGKKALHVATFSGWYRFEQDGAVFRQTKRDLTYWTLTCMSVDPD |
Ga0209973_10116432 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MSENNGKKALHVATFSGWYRFEQNGKDLKQTKRDLTYWTLTCMSVD |
Ga0209973_10460501 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MAVNNGKKALHVATFSGWYRFEQNGKDLQQTKRDLTYWTLTCMSVDPDNPQK |
Ga0209968_10304751 | 3300027526 | Arabidopsis Thaliana Rhizosphere | MSENNGKKALHVATFSGWYRFEQNGKDLQQTKRDLTYWTLTCMSVDPD |
Ga0209983_10255271 | 3300027665 | Arabidopsis Thaliana Rhizosphere | MAVNNGKKALHVATFSGWYRFEQNGKDLQQTKRDL |
Ga0209706_105539592 | 3300027818 | Freshwater Sediment | MSENNGKKALHVATFSGWYRFEQNGKDFKQTKRDLTYWTLTCMSVD |
Ga0209382_102005076 | 3300027909 | Populus Rhizosphere | MSGTNGKKALHVATFSGWYRFEQNGKEFTQTKRDLSYWTLTCMSVDEDDPKTIY |
Ga0247824_105243012 | 3300028809 | Soil | MTESIEKALHVATLSGWYRFERDGKEWKQTKRDLSYWS |
Ga0307312_110626622 | 3300028828 | Soil | MAGTNGKKALHVATFSGWYRFEQDGAVFRQTKRDLTYWTL |
Ga0302046_106570172 | 3300030620 | Soil | MTNTNGKKALHVATFSGWYRFEQHGSNLIQTRRDLSYWTLTCM |
Ga0307500_101641682 | 3300031198 | Soil | MAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYGP |
Ga0170824_1270856392 | 3300031231 | Forest Soil | MSASSKKALHVATFSGWYRFEQDGKAWKQIKRDLSYWALTCLSVDPEQPELIYAG |
Ga0307413_115866072 | 3300031824 | Rhizosphere | MSGMNGKKALHVATFSGWYRFEQNGKNFLQTKRDLSYWTLTCMTVDPEDPNT |
Ga0310892_108552961 | 3300031858 | Soil | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLT |
Ga0306925_102637961 | 3300031890 | Soil | MSSANDKNKALHVATMSGWYRFEKDGREWKQVKRDLSYWTLT |
Ga0326597_100580415 | 3300031965 | Soil | MSEANGKKALHVATFSGWYWYEQKGREWTQTKRDLSYLTFT |
Ga0307411_109327412 | 3300032005 | Rhizosphere | MSGMNGKKALHVATFSGWYRFEQNGKNFLQTKRDLSYWTLTCMTVDPEDPNTLYAG |
Ga0307472_1016562262 | 3300032205 | Hardwood Forest Soil | MAGTNGRKALHVATFSGWYRFEQDGKQFRQTKRDLTYWSLTCMSV |
Ga0214472_1000141317 | 3300033407 | Soil | MSEANGKKTLHVATFSGWYRFEQNSKEWKHTKGDLSYLTFT |
Ga0326726_118913532 | 3300033433 | Peat Soil | MSVTNNNPGLHVATLSGWYRFEYDGSQWRQLKRDLTYWTITC |
Ga0247830_108321182 | 3300033551 | Soil | MIEANGKKALHVATFSGWYRFEQEGKNFRQTKRDLTYWTLTCMSVDPD |
Ga0364934_0199797_2_166 | 3300034178 | Sediment | MNKGNYALHVATMSGWYRFERDGGEWRQVRRALTYWSLTCLSVDPEEPRLVYAGT |
⦗Top⦘ |