Metagenome Family F066309

Basic Information
Family ID	F066309
Family Type	Metagenome
Number of Sequences	126
Average Sequence Length	39 residues
Representative Sequence	DRIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
Number of Associated Samples	55
Number of Associated Scaffolds	125

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	30.70 %
% of genes near scaffold ends (potentially truncated)	76.98 %
% of genes from short scaffolds (< 2000 bps)	85.71 %
Associated GOLD sequencing projects	55
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.32

Most Common Taxonomy
Group	Unclassified (83.333 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (93.651 % of family members)
Environment Ontology (ENVO)	Unclassified (99.206 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (93.651 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 125 Family Scaffolds
PF04827	Plant_tran	0.80
PF05970	PIF1	0.80
PF00067	p450	0.80
PF16486	ArgoN	0.80

COG ID	Name	Functional Category	% Frequency in 125 Family Scaffolds
COG0507	ATPase/5Ã¢â‚¬â„¢-3Ã¢â‚¬â„¢ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V)	Replication, recombination and repair [L]	0.80
COG2124	Cytochrome P450	Defense mechanisms [V]	0.80

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
All Organisms	root	All Organisms	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
cellular organisms	root	All Organisms → cellular organisms	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	13.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	13.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	13.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	13.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	13.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	13.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	13.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	13.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	12.70 %
Zingiberales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	12.70 %
Musaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	7.14 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.59 %
Ensete	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	7.14 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.79 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	5.56 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	1.59 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.79 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	5.56 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1.59 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.79 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	3.97 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	1.59 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.79 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.79 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	3.97 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	1.59 %
Aegilops	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops	0.79 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.79 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	3.97 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1.59 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.79 %
Aegilops tauschii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii	0.79 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	3.97 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1.59 %
Aegilops tauschii subsp. strangulata	subspecies	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata	0.79 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.79 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300014486\|Ga0182004_10006967	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	9217	Open in IMG/M
3300014486\|Ga0182004_10007685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata	8771	Open in IMG/M
3300014486\|Ga0182004_10021826	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4768	Open in IMG/M
3300014486\|Ga0182004_10025409	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	4268	Open in IMG/M
3300015265\|Ga0182005_1226973	Not Available	570	Open in IMG/M
3300015267\|Ga0182122_1016049	Not Available	757	Open in IMG/M
3300015268\|Ga0182154_1030270	Not Available	645	Open in IMG/M
3300015268\|Ga0182154_1040977	Not Available	595	Open in IMG/M
3300015268\|Ga0182154_1052552	Not Available	554	Open in IMG/M
3300015269\|Ga0182113_1001469	Not Available	1676	Open in IMG/M
3300015275\|Ga0182172_1033660	Not Available	638	Open in IMG/M
3300015277\|Ga0182128_1051498	Not Available	572	Open in IMG/M
3300015277\|Ga0182128_1069240	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	524	Open in IMG/M
3300015281\|Ga0182160_1041292	Not Available	618	Open in IMG/M
3300015283\|Ga0182156_1040687	Not Available	631	Open in IMG/M
3300015285\|Ga0182186_1008197	Not Available	972	Open in IMG/M
3300015285\|Ga0182186_1028378	Not Available	686	Open in IMG/M
3300015285\|Ga0182186_1074687	Not Available	520	Open in IMG/M
3300015287\|Ga0182171_1066685	Not Available	548	Open in IMG/M
3300015287\|Ga0182171_1076382	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	526	Open in IMG/M
3300015287\|Ga0182171_1080661	Not Available	517	Open in IMG/M
3300015288\|Ga0182173_1013004	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	850	Open in IMG/M
3300015291\|Ga0182125_1063234	Not Available	568	Open in IMG/M
3300015291\|Ga0182125_1080273	Not Available	529	Open in IMG/M
3300015294\|Ga0182126_1036326	Not Available	670	Open in IMG/M
3300015294\|Ga0182126_1044467	Not Available	632	Open in IMG/M
3300015294\|Ga0182126_1087351	Not Available	518	Open in IMG/M
3300015295\|Ga0182175_1009770	Not Available	973	Open in IMG/M
3300015299\|Ga0182107_1042358	Not Available	661	Open in IMG/M
3300015302\|Ga0182143_1037300	Not Available	684	Open in IMG/M
3300015303\|Ga0182123_1005538	Not Available	1110	Open in IMG/M
3300015303\|Ga0182123_1045923	Not Available	628	Open in IMG/M
3300015303\|Ga0182123_1056484	Not Available	593	Open in IMG/M
3300015303\|Ga0182123_1064536	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	571	Open in IMG/M
3300015304\|Ga0182112_1021069	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	805	Open in IMG/M
3300015304\|Ga0182112_1055332	Not Available	612	Open in IMG/M
3300015305\|Ga0182158_1014130	Not Available	893	Open in IMG/M
3300015307\|Ga0182144_1012617	Not Available	939	Open in IMG/M
3300015307\|Ga0182144_1110020	Not Available	500	Open in IMG/M
3300015323\|Ga0182129_1001827	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1617	Open in IMG/M
3300015323\|Ga0182129_1094819	Not Available	535	Open in IMG/M
3300015323\|Ga0182129_1106007	Not Available	517	Open in IMG/M
3300015341\|Ga0182187_1149969	Not Available	559	Open in IMG/M
3300015342\|Ga0182109_1047695	Not Available	884	Open in IMG/M
3300015343\|Ga0182155_1018934	Not Available	1165	Open in IMG/M
3300015343\|Ga0182155_1019907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1148	Open in IMG/M
3300015343\|Ga0182155_1116741	Not Available	641	Open in IMG/M
3300015343\|Ga0182155_1130677	Not Available	615	Open in IMG/M
3300015344\|Ga0182189_1027422	Not Available	1065	Open in IMG/M
3300015344\|Ga0182189_1146406	Not Available	597	Open in IMG/M
3300015345\|Ga0182111_1058026	Not Available	862	Open in IMG/M
3300015345\|Ga0182111_1128629	Not Available	645	Open in IMG/M
3300015346\|Ga0182139_1028629	Not Available	1099	Open in IMG/M
3300015346\|Ga0182139_1047797	Not Available	924	Open in IMG/M
3300015346\|Ga0182139_1049929	Not Available	911	Open in IMG/M
3300015347\|Ga0182177_1118892	Not Available	667	Open in IMG/M
3300015347\|Ga0182177_1232238	Not Available	516	Open in IMG/M
3300015351\|Ga0182161_1000290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	3943	Open in IMG/M
3300015351\|Ga0182161_1028464	Not Available	1168	Open in IMG/M
3300015351\|Ga0182161_1056741	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	917	Open in IMG/M
3300015351\|Ga0182161_1069285	Not Available	851	Open in IMG/M
3300015351\|Ga0182161_1081691	Not Available	800	Open in IMG/M
3300015351\|Ga0182161_1085747	Not Available	785	Open in IMG/M
3300015351\|Ga0182161_1175373	Not Available	596	Open in IMG/M
3300015351\|Ga0182161_1230061	Not Available	534	Open in IMG/M
3300015351\|Ga0182161_1255820	Not Available	511	Open in IMG/M
3300015355\|Ga0182159_1003055	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	2706	Open in IMG/M
3300015355\|Ga0182159_1147551	Not Available	731	Open in IMG/M
3300015355\|Ga0182159_1187995	Not Available	660	Open in IMG/M
3300015355\|Ga0182159_1347225	Not Available	505	Open in IMG/M
3300015361\|Ga0182145_1038400	Not Available	857	Open in IMG/M
3300015361\|Ga0182145_1140732	Not Available	561	Open in IMG/M
3300015361\|Ga0182145_1182121	Not Available	514	Open in IMG/M
3300017404\|Ga0182203_1005017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1420	Open in IMG/M
3300017404\|Ga0182203_1043884	Not Available	766	Open in IMG/M
3300017404\|Ga0182203_1069117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	666	Open in IMG/M
3300017407\|Ga0182220_1005242	Not Available	1134	Open in IMG/M
3300017407\|Ga0182220_1077561	Not Available	554	Open in IMG/M
3300017410\|Ga0182207_1003944	Not Available	1592	Open in IMG/M
3300017410\|Ga0182207_1070524	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	684	Open in IMG/M
3300017410\|Ga0182207_1070919	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	682	Open in IMG/M
3300017410\|Ga0182207_1121289	Not Available	572	Open in IMG/M
3300017410\|Ga0182207_1140168	Not Available	544	Open in IMG/M
3300017410\|Ga0182207_1150462	Not Available	531	Open in IMG/M
3300017411\|Ga0182208_1013636	Not Available	984	Open in IMG/M
3300017411\|Ga0182208_1065751	Not Available	622	Open in IMG/M
3300017413\|Ga0182222_1029359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	705	Open in IMG/M
3300017420\|Ga0182228_1104734	Not Available	543	Open in IMG/M
3300017424\|Ga0182219_1099493	Not Available	561	Open in IMG/M
3300017425\|Ga0182224_1058327	Not Available	700	Open in IMG/M
3300017427\|Ga0182190_1003050	Not Available	1798	Open in IMG/M
3300017427\|Ga0182190_1091373	Not Available	617	Open in IMG/M
3300017427\|Ga0182190_1105225	Not Available	587	Open in IMG/M
3300017427\|Ga0182190_1134474	Not Available	540	Open in IMG/M
3300017430\|Ga0182192_1070246	Not Available	687	Open in IMG/M
3300017436\|Ga0182209_1048037	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	757	Open in IMG/M
3300017436\|Ga0182209_1119388	Not Available	569	Open in IMG/M
3300017436\|Ga0182209_1119388	Not Available	569	Open in IMG/M
3300017438\|Ga0182191_1038394	Not Available	841	Open in IMG/M
3300017442\|Ga0182221_1010219	Not Available	1172	Open in IMG/M
3300017442\|Ga0182221_1060421	Not Available	693	Open in IMG/M
3300017442\|Ga0182221_1168083	Not Available	504	Open in IMG/M
3300017443\|Ga0182193_1081307	Not Available	681	Open in IMG/M
3300017443\|Ga0182193_1140022	Not Available	567	Open in IMG/M
3300017443\|Ga0182193_1165814	Not Available	534	Open in IMG/M
3300017683\|Ga0182218_1018396	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	946	Open in IMG/M
3300017683\|Ga0182218_1110034	Not Available	558	Open in IMG/M
3300017684\|Ga0182225_1044652	Not Available	723	Open in IMG/M
3300017684\|Ga0182225_1126368	Not Available	524	Open in IMG/M
3300017685\|Ga0182227_1048411	Not Available	753	Open in IMG/M
3300017685\|Ga0182227_1055654	Not Available	710	Open in IMG/M
3300017686\|Ga0182205_1108718	Not Available	587	Open in IMG/M
3300017690\|Ga0182223_1013115	Not Available	924	Open in IMG/M
3300026118\|Ga0207675_100887343	Not Available	908	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	93.65%
Roots	Host-Associated → Plants → Roots	4.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	93.65%
Unclassified	Host-Associated → Plants → Roots → Unclassified	4.76%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.79%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	93.65%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	4.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.79%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	93.65%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	4.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.79%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0182004_100069673	3300014486	Root	MLDNIRLDVDIINIQFKYSDVNTVSDVGYSDSDTDRSKPL*
Ga0182004_100076856	3300014486	Root	MPNRTRLDIDIINMLFEYSNMDTVSDVVYLNLDMDGSKPL*
Ga0182004_100187011	3300014486	Root	MSTILDMIQLDIDIINIRFEYINTNTTSDVEYPDSDMIGFEHF*
Ga0182004_100218262	3300014486	Root	MSDKIELNINIINIRFKYSDTDTVSYVEYSDSDTDIYKSL*
Ga0182004_100254096	3300014486	Root	RLDVDIINIRFKYSDTDTVSDVGYSDSDTDRFEPL*
Ga0182004_100534891	3300014486	Root	MAINIRDENGSHRIRLDVDIIYIRFKNLDMDTVSDVGYSDLDTDRSEPL*
Ga0182005_12269731	3300015265	Rhizosphere	LDVDITNIFKYSNMNTVSDVEYSDSDTDRSKPF*
Ga0182122_10160491	3300015267	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINM*FEYSDTDTVSDVEYPDSDTD
Ga0182154_10302701	3300015268	Miscanthus Phyllosphere	DRVRLNIDIINIRLKYLDMDTVSDIEYLDSDTDRSEPF*
Ga0182154_10409771	3300015268	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQLL*
Ga0182154_10525521	3300015268	Miscanthus Phyllosphere	MTDRIGLDIDIINMRFDYSDTDTVSDVEYPDSDTDRFELL*
Ga0182113_10014691	3300015269	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINMRFEYLDTDTVSDVEYPDS
Ga0182172_10336601	3300015275	Miscanthus Phyllosphere	DMIRLDIDIINMRFEFSNTDMVPDVEYPDSDMDRSQPL*
Ga0182128_10514981	3300015277	Miscanthus Phyllosphere	IRLDIDVINMRFEYSDTDTVSDVGYPDSDTDRSQPL*
Ga0182128_10692401	3300015277	Miscanthus Phyllosphere	RLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPF*
Ga0182160_10412921	3300015281	Miscanthus Phyllosphere	MSDRIRLDIDIINMRFEYSHMDTVSDVGYPDSDTDRSQP
Ga0182156_10406871	3300015283	Miscanthus Phyllosphere	MLDRI*LDIDIINMQFEYSDMDTVSDVGYPDSDTDRSQPL
Ga0182186_10081971	3300015285	Miscanthus Phyllosphere	MPDMIRLDIDIINMRFEYSDTDSISDVGYPDSDTDRSQP
Ga0182186_10283782	3300015285	Miscanthus Phyllosphere	LDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL*
Ga0182186_10746871	3300015285	Miscanthus Phyllosphere	VSAMSDRIRLDIDIINMRFEDSDMNTVLDVEYVNSDADGSEPL*
Ga0182171_10666851	3300015287	Miscanthus Phyllosphere	RLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL*
Ga0182171_10763821	3300015287	Miscanthus Phyllosphere	TMSDMIRLDIDIINMRFEYLDTDTVSDVGYPNLNMDRSQPF*
Ga0182171_10806611	3300015287	Miscanthus Phyllosphere	MPDRIRLDIDIINMRFEYTDMDIVSDVEYPDSDMSR
Ga0182173_10130041	3300015288	Miscanthus Phyllosphere	MSDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQP
Ga0182125_10632341	3300015291	Miscanthus Phyllosphere	DRIRLDVDIINVIIGYGFEYSDMDTVSDVGYLDSDTDRSQPL*
Ga0182125_10802731	3300015291	Miscanthus Phyllosphere	MSAIPDRIRFDVDIINMRFEFLDTDTVSNVEYPDSDTVRSQPQ*
Ga0182126_10363262	3300015294	Miscanthus Phyllosphere	MSDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDISQPL*
Ga0182126_10444672	3300015294	Miscanthus Phyllosphere	VSTMPYMIRLDIDIVNIRFDYSDTDTVSDVEYLDSGTDKSELL*
Ga0182126_10873511	3300015294	Miscanthus Phyllosphere	MSDRIRLYIDIINIRFEYSDTDTVSDVGYPDSDTDRSQ
Ga0182175_10097702	3300015295	Miscanthus Phyllosphere	LDVDIINMRFEYSDTDTVSDVEYADSDTDRSEPL*
Ga0182157_10255712	3300015296	Miscanthus Phyllosphere	ILDIDIINMRFDYSDTVSDVEYPDSDTDIFELL
Ga0182106_11013641	3300015298	Miscanthus Phyllosphere	MLDRIRLDIDIINMLFEYSDTDKVSDVEYPDSDTDISKPL*
Ga0182107_10423581	3300015299	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINMRFDYLDTDTVSDVEYLDSDTDRSEHL*
Ga0182143_10373001	3300015302	Miscanthus Phyllosphere	THRIQLDINIINMRFEYSDTDTVSDVEYPDSNMNRSEPL*
Ga0182123_10055383	3300015303	Miscanthus Phyllosphere	VSTMSDRIRFGIDIINMRFEYSDTDTVLDIEYLDSDMDIS*
Ga0182123_10459231	3300015303	Miscanthus Phyllosphere	AMPDRIRLGIDIINMRFEYSDTDTVSDVEYPDSDTDRFEPL*
Ga0182123_10564841	3300015303	Miscanthus Phyllosphere	TMPDRIRLDIDIINMLFEYSDTDKVSDVEYPDSDMDRSEPL*
Ga0182123_10645362	3300015303	Miscanthus Phyllosphere	RIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQLL*
Ga0182112_10210691	3300015304	Miscanthus Phyllosphere	MSDRIRLDIDIINMRFEYSDTDTDTVSDVGYPDSD
Ga0182112_10553321	3300015304	Miscanthus Phyllosphere	MPDRIRLDIDIINM*FKYLDTDTMSDVEYPDSDMDRSEPL
Ga0182158_10141301	3300015305	Miscanthus Phyllosphere	SDRIRLDINIINMRFEYSDTDTVLDVGYPDSDTDISQPL*
Ga0182144_10126171	3300015307	Miscanthus Phyllosphere	MSDMIRLDINIINIRFEYSDTDTVSDVGYPDSDTN
Ga0182144_11100201	3300015307	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINMRFDYLDTDTVSDVEYLDSDTD
Ga0182140_11115761	3300015314	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDIEYPDSDTDGSKHL*
Ga0182129_10018273	3300015323	Miscanthus Phyllosphere	MPDRIRLDFNIINMRFEYSDMDTVLDVEYPDSDTDRSEPL
Ga0182129_10948191	3300015323	Miscanthus Phyllosphere	DRIRLGIDIINIRFEYLDTDTVSDVEYLDSDTDRFEPL*
Ga0182129_11060071	3300015323	Miscanthus Phyllosphere	MSDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDR
Ga0182187_11499691	3300015341	Miscanthus Phyllosphere	MSDRIRLDIDIINMRFEYSDMDTVLDIGYPDSNTNRSQLL*
Ga0182109_10476951	3300015342	Miscanthus Phyllosphere	MPDRIRLDVDIINMRFEYLDTDTVSDVEYPDSDTDRSEPL*
Ga0182155_10189342	3300015343	Miscanthus Phyllosphere	RIVSTMSDRIRLNIDIINMRFEYLDTDTVSDVRYSDSDTDRSQLL*
Ga0182155_10199071	3300015343	Miscanthus Phyllosphere	MSAMSDRIRLGIDIISIQFEYSDMDTVSDVEYSDSDTDIF
Ga0182155_11167413	3300015343	Miscanthus Phyllosphere	VDIVNMRFEYSDTDTDTDIVSNVEYPNSDTNRSKPL*
Ga0182155_11306771	3300015343	Miscanthus Phyllosphere	MPDRIRLDIDIINM*FEYSDTDTVLDVEYLDSDTD
Ga0182189_10274221	3300015344	Miscanthus Phyllosphere	DRIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDIFQPL*
Ga0182189_11464061	3300015344	Miscanthus Phyllosphere	MWLVSTMPDMIRFDIDIINMRLEYSDTDTDTVSDIEYPDSDMDRYQPL*
Ga0182111_10580262	3300015345	Miscanthus Phyllosphere	RIRFDVDIINMRFEFSDTDTVSNVEYPDSDTDRSKPL*
Ga0182111_11286292	3300015345	Miscanthus Phyllosphere	LDVDIINMRFKYSDTDTVSAIEYPDSDMDRSELL*
Ga0182111_11493151	3300015345	Miscanthus Phyllosphere	ILLGIDITNMRFEYSNTDTISDVKYPDSDTNRSEPL*
Ga0182139_10286292	3300015346	Miscanthus Phyllosphere	SDRIRLDIDIINMRFEYSDTDTVSDVGYPDLDTDRSQPL*
Ga0182139_10477971	3300015346	Miscanthus Phyllosphere	DRIRLDIDIINIQFEYSDTDTVSDIGYPDSDTDRSQPL*
Ga0182139_10499292	3300015346	Miscanthus Phyllosphere	MPDRIRLGIDIINIRFEYSDMDTVLDVEYLDSDTDRFEPL
Ga0182177_10796521	3300015347	Miscanthus Phyllosphere	LNIDIINIQFKYSNTNMVSDIEYPDSDTDISKPL*
Ga0182177_11188922	3300015347	Miscanthus Phyllosphere	LDIDIINMRFEYSDTDTVSDVRYPDSDMDRSQPL*
Ga0182177_12322381	3300015347	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVGYLDSNTNRSQPL*
Ga0182161_10002901	3300015351	Miscanthus Phyllosphere	IRVDINIINTRFKYSDMDTISDVEYPDSNTNRFESL*
Ga0182161_10284642	3300015351	Miscanthus Phyllosphere	DMIRLDIGIINIRFEYLDTDTVSDVGYPDSDTDRSQSL*
Ga0182161_10567412	3300015351	Miscanthus Phyllosphere	DRIQLDIDIINMRFEYSDMDTVSDVEYPDSNTDGSKPL*
Ga0182161_10692851	3300015351	Miscanthus Phyllosphere	LDIDIINMRFEYSDTDTVSDVGYLDLDTDRSQLL*
Ga0182161_10816911	3300015351	Miscanthus Phyllosphere	TMSDRIRLDIDIINMRLEYSDTDMVSNIGYPDSDMDRSQPL*
Ga0182161_10857471	3300015351	Miscanthus Phyllosphere	MSDMIRLDIDIINMRFEYSDTDTDTVSDVEYPDSDTDIFKPL*
Ga0182161_11753731	3300015351	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSKPL*
Ga0182161_12300611	3300015351	Miscanthus Phyllosphere	AIPDMIRLDIDIINMQFEYSDTDMILDVGYPDSDTGRS*
Ga0182161_12558201	3300015351	Miscanthus Phyllosphere	STMSDMIRLDIDIISMQFEYSDTDTVSDVGYPDLDTDRSQPL*
Ga0182159_10030551	3300015355	Miscanthus Phyllosphere	MTDTIRLDIDIVNMRFDYSDTDTVSDVEYPDSDTDIFELL*
Ga0182159_10305371	3300015355	Miscanthus Phyllosphere	MSNRIRLDIYISIMRFKYSDTDTVSDIKYLDSDTDKSE
Ga0182159_10573911	3300015355	Miscanthus Phyllosphere	RLDIDIINMRFEYSDTDTVSDVEYPDSDTDISELL*
Ga0182159_11475511	3300015355	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDMDTVSDVEYPDSDTDRSQPL*
Ga0182159_11879951	3300015355	Miscanthus Phyllosphere	MSDRIRLDIDIINMRFEYSDTDTVSDVGYPDLDTDR
Ga0182159_13472251	3300015355	Miscanthus Phyllosphere	GIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL*
Ga0182145_10384001	3300015361	Miscanthus Phyllosphere	DRIRLDINIINMFEYSDTDTVSDIEYSDSDTDRSEPL
Ga0182145_11407323	3300015361	Miscanthus Phyllosphere	SDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSKPL*
Ga0182145_11505201	3300015361	Miscanthus Phyllosphere	ILDIDILNMQFEYSDTDMASDVEYPDSDTDIFGPF
Ga0182145_11821211	3300015361	Miscanthus Phyllosphere	LDIDIINIFEYSNTDTVSDVEYPDLDTDRSEPL
Ga0182203_10050172	3300017404	Miscanthus Phyllosphere	MSDRIRLDINVMNMRFEYSDMDTVSDVEYPDSDTD
Ga0182203_10438841	3300017404	Miscanthus Phyllosphere	STMSDRIRLDIDIINMRFEYSDMDTVSNVGYPDSDTDRSQSL
Ga0182203_10691172	3300017404	Miscanthus Phyllosphere	IRLDIDIINMRFEYLDTDTVSDVGYPDSDTDRSQLL
Ga0182220_10052421	3300017407	Miscanthus Phyllosphere	MLTVLDRILLDINIINMRFEYSDTDTVSDVEYPDSDTDKFKPL
Ga0182220_10775611	3300017407	Miscanthus Phyllosphere	RIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
Ga0182207_10039441	3300017410	Miscanthus Phyllosphere	RLNIDIMNMRFEYSDTDMVSNVEYPDSDTDRSKPLRIRSQIRS
Ga0182207_10705241	3300017410	Miscanthus Phyllosphere	MSDRIRLDIDIMNMRFEYSDMDTVSDVEYPDSDTDRS
Ga0182207_10709192	3300017410	Miscanthus Phyllosphere	VSTMSDMIRLDIDIINMRFEYLDTDTVSDVGYPDSD
Ga0182207_11212891	3300017410	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINMRFEYLDTDTVSDVEYPDSDMNRSEHL
Ga0182207_11401681	3300017410	Miscanthus Phyllosphere	IRLDIDIINMRFEYSNTDTVSDVGYPDSDTDRSQPL
Ga0182207_11504621	3300017410	Miscanthus Phyllosphere	DRIRFDVDIINMRFQYSDTDTVLYVEYPDSDTDRSEPL
Ga0182208_10136362	3300017411	Miscanthus Phyllosphere	MSDRIRLDIDIISMRFEYSDMDMVSDVGYLDLDIDRSQPL
Ga0182208_10657511	3300017411	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
Ga0182222_10293592	3300017413	Miscanthus Phyllosphere	MGLAMPDRIRLDVDFINMXFEYLDTDTVSDVEYPDSDTDRSEHL
Ga0182228_11047342	3300017420	Miscanthus Phyllosphere	SDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
Ga0182219_10994931	3300017424	Miscanthus Phyllosphere	TMSNMIRLDIDIINMRFEYSDTDTVSDVRYPELDMDRSQQL
Ga0182224_10583271	3300017425	Miscanthus Phyllosphere	SDRIRLDIDIINMRFEYSDTDTVSDVGYLDSDTDRSQPL
Ga0182190_10030501	3300017427	Miscanthus Phyllosphere	RIRLDIDIINMRFEYSDTDTVSDVGYSDSDTDRSQLL
Ga0182190_10913731	3300017427	Miscanthus Phyllosphere	IVSTMSDRIRLDIDIINMRFEYSDMDTVSNVGYPDSDTDRSQSL
Ga0182190_11052251	3300017427	Miscanthus Phyllosphere	MPDRIRLDVDIINMRFDYLDTDTVSDVEYLDSDTDRSEHL
Ga0182190_11344741	3300017427	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVRYPDSDTDRSQPL
Ga0182192_10702461	3300017430	Miscanthus Phyllosphere	TDRIRLDIDIINMRFDYSHTDTVSDVEYPDSDMDISEL
Ga0182209_10480371	3300017436	Miscanthus Phyllosphere	MSDMIRLDIDIINMQFEYSDTDTVSDVGYPDSDTDRSRPL
Ga0182209_11193881	3300017436	Miscanthus Phyllosphere	RMGLAMPDRIRLDVDIINMRFKYLDTDTVSDVEYPDSDMNRSEHL
Ga0182209_11193882	3300017436	Miscanthus Phyllosphere	MPDRIRLDVDIINMRFEYLDTDTVSDVEYPDSDMN
Ga0182191_10383942	3300017438	Miscanthus Phyllosphere	MSDRICVNINIINMRFEYSVIDTVSDVEYPDSDMDRSEPL
Ga0182191_10859141	3300017438	Miscanthus Phyllosphere	IRLDIDIINMRFDYSDTDTVSDIEYPDSDTDISELH
Ga0182221_10102191	3300017442	Miscanthus Phyllosphere	LDRIXLGIDIINMQFEYSDTVTVSDVEYPDSNTDGFEPL
Ga0182221_10604211	3300017442	Miscanthus Phyllosphere	STMPDMIRLDIDIINMRFEYSDTDAVLDVGYPDSDTDRSQPL
Ga0182221_11680831	3300017442	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVEYPDSDTNRSKPL
Ga0182193_10813072	3300017443	Miscanthus Phyllosphere	STMPDRIRLDISIINMRFEYSDTVSDVEYPDSDTGRSKPL
Ga0182193_11075551	3300017443	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTDTVSDVGYPDSDTDISQPL
Ga0182193_11400222	3300017443	Miscanthus Phyllosphere	DRIRLDIDIINMRFEYLDTDTVSDVGYPDSDTDRSQPL
Ga0182193_11658142	3300017443	Miscanthus Phyllosphere	MIRLDIDIINMRFEYSDTDTVPDVGYPDSDMDRSLPL
Ga0182218_10183961	3300017683	Miscanthus Phyllosphere	VSTMSDRIRLDIDSINMRFEYSDMDTISDVGYPNSDTDRSQPL
Ga0182218_11100341	3300017683	Miscanthus Phyllosphere	TMSDRIRLDIDIINMRFEYSDMDTVSDVGYPDSDTDRSQPL
Ga0182225_10446521	3300017684	Miscanthus Phyllosphere	MPDMIRLDIDIINMRFEYSDTDTVSDVEYLDSDKDESKPL
Ga0182225_11263681	3300017684	Miscanthus Phyllosphere	STMSERLRFDINILNIRLEYSDTDTVSDVEYPDSDTDRFEPL
Ga0182227_10484111	3300017685	Miscanthus Phyllosphere	DRIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
Ga0182227_10556542	3300017685	Miscanthus Phyllosphere	DRIRLDVDIINMRFEYSDTDTVSDVEYPDSDTDRSEPL
Ga0182205_11087181	3300017686	Miscanthus Phyllosphere	RLDIDIINIRFEYLDMDTVSNVEYPDSDTNRSKPI
Ga0182223_10131151	3300017690	Miscanthus Phyllosphere	MIRLDVDIINIRFNYLDMDTISDVENPDSDTNRSE
Ga0207675_1008873431	3300026118	Switchgrass Rhizosphere	AMPDRIRLDVDIINMRFEYVDTDTVSDVEYPDSDTDRSEHL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.32
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.32
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F066309

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated	Open in IMG/M
3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign