Basic Information | |
---|---|
Family ID | F066369 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 126 |
Average Sequence Length | 41 residues |
Representative Sequence | GQVQQRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPKM |
Number of Associated Samples | 81 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.60 % |
% of genes near scaffold ends (potentially truncated) | 90.48 % |
% of genes from short scaffolds (< 2000 bps) | 99.21 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (96.032 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (51.587 % of family members) |
Environment Ontology (ENVO) | Unclassified (89.683 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (87.302 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 96.03 % |
All Organisms | root | All Organisms | 3.97 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 51.59% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 36.51% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.97% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.17% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.59% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 0.79% |
Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010276 | Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 15_59_3.3_214_A2 metaG | Engineered | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020023 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028051 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028054 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028057 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028147 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028151 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028256 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028468 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028470 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070670_1016122841 | 3300005331 | Switchgrass Rhizosphere | MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKIP |
Ga0070666_106972241 | 3300005335 | Switchgrass Rhizosphere | MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKIPKI* |
Ga0070686_1003733701 | 3300005544 | Switchgrass Rhizosphere | MGQVRQRNGVKPPETQVLDVKYVVRNQTDIVEHRNGVKIPKI* |
Ga0105249_110351221 | 3300009553 | Switchgrass Rhizosphere | MGQVRQRNGVKPPETRVLDVKYVVRNHTDILEHQNGVQIAKM*V |
Ga0105139_10031191 | 3300009995 | Switchgrass Associated | MGQVRQQNGVKPPETGVLDVKYVVRNQTDVLEQQNGVQITKM* |
Ga0134104_10504551 | 3300010276 | Switchgrass Degrading | MGQVRQ*NGMKPPETRVLDVKYVVRNHTDVLEHRNGV |
Ga0134125_116919501 | 3300010371 | Terrestrial Soil | GQVRQRNGVKPPETRVLDIKYVVRNQPDVLEHRNCVQIPKI* |
Ga0134122_129965751 | 3300010400 | Terrestrial Soil | GQVRQRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPSMSRVLQF* |
Ga0134121_112171761 | 3300010401 | Terrestrial Soil | MVQVRQRNGVKLPETRVLYVKYVVRNQTDILEHRNGV |
Ga0134121_122906911 | 3300010401 | Terrestrial Soil | QVRQRNGVKPPKTRNFEVNFVVRNQTDIVEHRNGVKILKI* |
Ga0182105_10300141 | 3300015290 | Switchgrass Phyllosphere | QRNGMKLPETRVLDVKYVVRNQTDVLEHRNGVKIHKM* |
Ga0182104_10844651 | 3300015297 | Switchgrass Phyllosphere | MGQVWQRNGVKPPETQVLDAKYVVQNQTDIVEHRNGVKSFK* |
Ga0182104_11057011 | 3300015297 | Switchgrass Phyllosphere | NGMKPPETRVLDVKYVVRNQTDILEHRNDVQIPKM* |
Ga0182184_10649722 | 3300015301 | Switchgrass Phyllosphere | FTMGQVQQRNGVKPPETRVLDVKYVVRNQTDILEH* |
Ga0182180_10736651 | 3300015306 | Switchgrass Phyllosphere | MGQVQQQNGVKPPETRVLDVKYVVQNQMDVLEHQNGVQIPKM* |
Ga0182182_11021351 | 3300015311 | Switchgrass Phyllosphere | MGQVRQRNGVKQPETRILDVKYVVRNQADVVEHRNG |
Ga0182168_10315961 | 3300015312 | Switchgrass Phyllosphere | MGQVGQ*NGVRPPETRVLDVKYVVRNQTDILEHRNDV |
Ga0182168_10802201 | 3300015312 | Switchgrass Phyllosphere | MGQVWQRNGVKQPETRILDVKYVVRNQTDVVEHRNGVKIPKI*VLD |
Ga0182168_10857901 | 3300015312 | Switchgrass Phyllosphere | QQNGVKPPETRVLDVKYVVRNQTDVVEHRNGVKIPKI* |
Ga0182164_10990101 | 3300015313 | Switchgrass Phyllosphere | TMGQVWQRNGVKPPETRVLDVKYVVRNQTDVLEH* |
Ga0182136_10394561 | 3300015317 | Switchgrass Phyllosphere | TIGQVRIRNAVKPQETRVLDIKYVVRYQADVLEHRNGVKIPKI* |
Ga0182136_10734541 | 3300015317 | Switchgrass Phyllosphere | NGVKPHKTRVLNVKYVVRNQTDILEHRSDVQIPKM* |
Ga0182165_10380941 | 3300015320 | Switchgrass Phyllosphere | MGQVWQRNGVKPPETRDLDVKYVVRNQTDIVEHQNGVKIPKM* |
Ga0182165_10499551 | 3300015320 | Switchgrass Phyllosphere | MGQVRQRNGVKPPETQVLDVKYVVRNQTDILEHRNDVQI |
Ga0182148_11359321 | 3300015325 | Switchgrass Phyllosphere | MGQVQQRNGVKPPKTRVLDAKYLVQNQMDVLEHQNGVQIPKM* |
Ga0182166_10546931 | 3300015326 | Switchgrass Phyllosphere | MGQVRQRNGVKPPETRVLDVKYVVRNQTDILEHQNGV |
Ga0182166_10723701 | 3300015326 | Switchgrass Phyllosphere | MSQARQRNGVKPPET*VLDVKYVVRNKTDFLEHRNGVKIPKM*VLD |
Ga0182114_11499071 | 3300015327 | Switchgrass Phyllosphere | MGQVQQRNGVKPPETRVLDAKYVVQNQMDVLEHQNGVQIPKM* |
Ga0182135_11348571 | 3300015329 | Switchgrass Phyllosphere | QRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIHKM* |
Ga0182152_10369812 | 3300015330 | Switchgrass Phyllosphere | MGQVQKRNGVKPPETQVLEIKYVVRNQPDVLEHRNGVQIPKM* |
Ga0182152_10894401 | 3300015330 | Switchgrass Phyllosphere | MGQVRQRNDVKPPKTQNLDVKYVVRNQTDVVEHRNGVKMPKI*V |
Ga0182152_11153382 | 3300015330 | Switchgrass Phyllosphere | MGQVRQ*NGVKPPETQVLDVKYVVRNQMNVVEHRNGVK |
Ga0182147_10083031 | 3300015333 | Switchgrass Phyllosphere | RNGMKLPETRVLDVKYVVRNQTDVLEHRNGVKIHKM* |
Ga0182132_11156382 | 3300015334 | Switchgrass Phyllosphere | MGQVRQRNGVKPPETKILDANYVVRNQTDVLEHQNGVKIP |
Ga0182116_10652511 | 3300015335 | Switchgrass Phyllosphere | QVRQRNGVKPPETRVLDVKYVVRNQTDVVEHQNGVKIQRI* |
Ga0182150_11009431 | 3300015336 | Switchgrass Phyllosphere | MGQVRQRNGMKPPETRVLDVKYVVRNQTDILEHRNDVQIPKM*VLDLKEC |
Ga0182150_11428251 | 3300015336 | Switchgrass Phyllosphere | MGQVRQRNDVKPPKTRNLDVKYVVRNQTDIVEHRNGVKILKI*VLDLKEC |
Ga0182150_11646171 | 3300015336 | Switchgrass Phyllosphere | MGQVQQRNGVKPPET*VLDVKYVVRNQTDFLEHRNSVK |
Ga0182151_10179551 | 3300015337 | Switchgrass Phyllosphere | MGQVRQ*NDMKPPKTRILDVKYVVRNQTDVVEHRNGVKMPKI*VL |
Ga0182151_10948802 | 3300015337 | Switchgrass Phyllosphere | MGQVRQRNGVKPPETQVLEVNYVVRNQRDVVERRNGVKIPKL*VLDLKE |
Ga0182149_10256951 | 3300015339 | Switchgrass Phyllosphere | MCQVRQRNGMKPPKT*VLDVKYVVRNQKDVLEHRNGVKIPKM*V |
Ga0182149_10728491 | 3300015339 | Switchgrass Phyllosphere | *NGVKPPETRVLDVKYVV*NQTDVLEHRNGVKIPKI*VLDLK* |
Ga0182149_11316401 | 3300015339 | Switchgrass Phyllosphere | GQVQQRNGVKPPETRVLDVKYVMRIQADILEYRNDVQIPKM* |
Ga0182133_10352131 | 3300015340 | Switchgrass Phyllosphere | MGQVWQRNGMKPPETRVLDVKYVVRNQTDILEHRNGVQIPK |
Ga0182133_11285611 | 3300015340 | Switchgrass Phyllosphere | MGQVQQRNGVKQPETRILDVKYVVQNQTDVVEHRNGVKIPKM* |
Ga0182115_11589602 | 3300015348 | Switchgrass Phyllosphere | MGQVRQRNDVKPPKTRILDVKYVVRNQTDVVEHRNGVKMPKI*VLDLKEC |
Ga0182115_12770551 | 3300015348 | Switchgrass Phyllosphere | MGQVQQRKGVKSPET*VLDVKYVVRNQTDVLEHRNGVKIPKI* |
Ga0182185_10608791 | 3300015349 | Switchgrass Phyllosphere | MGQVRQ*NDMKPPKTRILDVKYVVRNQTDVVEHRNGVKMPKI*VLDLKEC |
Ga0182185_11466871 | 3300015349 | Switchgrass Phyllosphere | MGQVQQQNGVKPPETRVLEIKYVVRNQTDIVEHQNGVKLPQI* |
Ga0182185_11955161 | 3300015349 | Switchgrass Phyllosphere | MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKIPKI*VLDLKECI |
Ga0182185_12641341 | 3300015349 | Switchgrass Phyllosphere | RQRNGMKPPETRVLDVKYVVRNQTDVLEHRNCVKIPIM* |
Ga0182163_10634721 | 3300015350 | Switchgrass Phyllosphere | GVKPPETRVLDVKYVVRNQTDILEHQNGVKIPKI* |
Ga0182163_10634722 | 3300015350 | Switchgrass Phyllosphere | MGQGRQRNGVKPPETQVLDVKYVVRNQADVLEHRNGVKIPKI* |
Ga0182163_12400181 | 3300015350 | Switchgrass Phyllosphere | RQRNGMKPPETRVLDIKYVVRNQTDILEHRNDVQIPKM* |
Ga0182163_12790371 | 3300015350 | Switchgrass Phyllosphere | MGPVRQ*NGMKPPETRVLDIKYVVRNQTDILEHRNDVQIPKM*V |
Ga0182169_12532401 | 3300015352 | Switchgrass Phyllosphere | GRQRNGVKPPETQVLDVKYVVRNQTDVVEHRNGVKIPKI* |
Ga0182179_12036121 | 3300015353 | Switchgrass Phyllosphere | MGQVRQRNDVKPPETRVLDVKYVVRNQTDFLEHRNGVKI |
Ga0182179_12402961 | 3300015353 | Switchgrass Phyllosphere | GVKPPETRVLDVKYVVRNQTGVLEHRNGVQIAKI* |
Ga0182167_11569431 | 3300015354 | Switchgrass Phyllosphere | QRNGVKPPETRVLNVKFVVRNQTDILEHRNDVQIPKM* |
Ga0182167_13520641 | 3300015354 | Switchgrass Phyllosphere | QRNGMKPPETQVLDVKYVVRNQTDILEHRNGVKIPKM* |
Ga0182199_10319361 | 3300017412 | Switchgrass Phyllosphere | AQVRQQNGMKLPETRVLDVKYVVRNQTDVLEHRNGVKIHKM |
Ga0182199_11392782 | 3300017412 | Switchgrass Phyllosphere | MGQVQQXNGVKPPETRVLDVKYVVRNQTDVLEHRN |
Ga0182195_11049081 | 3300017414 | Switchgrass Phyllosphere | NGMKLPETRVLDVKYVVRNQTDVLEHRNGLKIHKM |
Ga0182201_10457981 | 3300017422 | Switchgrass Phyllosphere | MGQVRQXNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPKMXVLDLKECI |
Ga0182194_11105771 | 3300017435 | Switchgrass Phyllosphere | QVRQRNGVKPPETQVLDVKYVVRNQTDIVEHRNGVKIPKI |
Ga0182214_11055531 | 3300017440 | Switchgrass Phyllosphere | MAQVRQRNGMKLPETRVLDVKYVVXNQMDVLEHRNGVKIHKMXVLD |
Ga0182198_11010631 | 3300017445 | Switchgrass Phyllosphere | GHVRQRNGVKPPETRVLDIKYVVRNQPDVLEHQNCVQIPKI |
Ga0182215_10919761 | 3300017447 | Switchgrass Phyllosphere | NGVKPPETRVLDIKYVVRNQTDVVEHRSGVKLPQI |
Ga0182216_11092031 | 3300017693 | Switchgrass Phyllosphere | MHPILIFTMGKVRQRNGVKPPETRVLHIKYVERNQTDIVEHRN |
Ga0182216_11349961 | 3300017693 | Switchgrass Phyllosphere | MGQVRQXNAVKPHETRDLDVKYVVRNQTDVVEHRNGVKIPKIXVLDL |
Ga0182178_10096351 | 3300020023 | Switchgrass Phyllosphere | RQRNGMKPPKTRIFDLKYVVRNQTDIVEHRNGVKIPKM |
Ga0182178_10133451 | 3300020023 | Switchgrass Phyllosphere | MGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEHQNGVQIAKMXVLDQKE |
Ga0182178_10173471 | 3300020023 | Switchgrass Phyllosphere | MGQVRQQNGVKPPETRVLDIKYVVRNQPDILEHRNCVQIPKM |
Ga0207680_109517992 | 3300025903 | Switchgrass Rhizosphere | QVQKRNGVKPPETQVLEIKYVVRNQPDVLEHRNGVQIPKM |
Ga0207650_113291581 | 3300025925 | Switchgrass Rhizosphere | MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKIPKIXVL |
Ga0207644_108954402 | 3300025931 | Switchgrass Rhizosphere | QRNGLKPPETQVLDVKYVVRNQTDVLEHQNGVKIPKM |
Ga0207703_106252042 | 3300026035 | Switchgrass Rhizosphere | MGQVRQRNGVKPPETQVLDVKYVVRNQMNIVEHRNGVKIP |
Ga0207703_110220531 | 3300026035 | Switchgrass Rhizosphere | RNGVRPPETRVLVVKYVVRNQTDILEHRNDVQIPKM |
Ga0268328_10455221 | 3300028050 | Phyllosphere | IFTMGQVRQRNGVKPPETRVLDIKYMVRNQTDFLEQRNGVKIPKM |
Ga0268344_10015252 | 3300028051 | Phyllosphere | MAQVRQRNGMKLPETRVLDVKYVVRNQTDILEHRNGLKIHKM |
Ga0268346_10348271 | 3300028053 | Phyllosphere | MGQVRQRNGVKPPETQVLDVKYVVRNQTDIVEHRNGVKIPKI |
Ga0268306_10168751 | 3300028054 | Phyllosphere | FTMGQVRQRNGVKPPKTLVLDIKYVVRNQTDVVELRNGVKLPQI |
Ga0268330_10210101 | 3300028056 | Phyllosphere | GQVRQRNGVKPPETRVLDIKYMVRNQTDFLEQRNGVKITKM |
Ga0268330_10211951 | 3300028056 | Phyllosphere | MGQVQQRNGVKRPKTRVLDVKYVVRNQTDILEHRNGVKIPKMXVLDL |
Ga0268330_10494361 | 3300028056 | Phyllosphere | MGQVRQRNGMKPPETRVLDIKYVVRNQPDILDHRNCVQIPKM |
Ga0268330_10547531 | 3300028056 | Phyllosphere | MGQVRQRNGVKPPETLVLDIKYVVRNQPDILEHRNGVQIPKMXALDL |
Ga0268330_10573111 | 3300028056 | Phyllosphere | MGQVRQRKGMKLPKTRVLDIKYVVRNQTDILEHRNGVKIPK |
Ga0268352_10294261 | 3300028057 | Phyllosphere | MGQVRQRNGVKPPETXVLDKKYVVRNQTDVVEHRNG |
Ga0268332_10374191 | 3300028058 | Phyllosphere | MKPPETRVLDVKYVVRNQTDVLEHRNCVKIPIMCVLDLTECIEIF |
Ga0268332_10792281 | 3300028058 | Phyllosphere | MGQVRQRNGVKPPETXVLDKKYVVRNQTDVVEHRNGVKLPQIXVL |
Ga0268314_10032262 | 3300028061 | Phyllosphere | GQVRQRSDVKPPKTQVLDVKYVVRNQTDVLEQQNGVQITKM |
Ga0268342_10041911 | 3300028062 | Phyllosphere | MGQVQQQNGVKPPKTRVLDLNFVVQNQTDVLEHRNLVK |
Ga0268342_10041913 | 3300028062 | Phyllosphere | LIFTMGQVQQQNGVKPPKTRVLDLNFVVQNQTDVLEHRNLVKIPKI |
Ga0268355_10038692 | 3300028139 | Phyllosphere | MGQVRQRNGVKPPETRVLDVKYGVRNQMDVLEHRNGVQIPKMXVLDLK |
Ga0268347_10021202 | 3300028142 | Phyllosphere | GQVRQRNGMKPPETRVLDVKYVVRNQTDVLEHXNGVQIPKMXVLDLK |
Ga0268348_10031731 | 3300028143 | Phyllosphere | MGQVRQRNGLKQPEIXILDIKYVVRNQTDVVEHRNG |
Ga0268348_10160981 | 3300028143 | Phyllosphere | MGQVRQRNGMKPPKTRIFDLKYVVRNQTDVVEHRNGVK |
Ga0268348_10204361 | 3300028143 | Phyllosphere | TMGQVRQRNGVKPPETRVLDVKYVVRNQTDILEHRNGV |
Ga0268345_10031071 | 3300028144 | Phyllosphere | MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKI |
Ga0268345_10092401 | 3300028144 | Phyllosphere | MGQVRQRNGVKPPKTRVLDIKYVVRNQPDILAHXNGVQIPKMXVLNLKEC |
Ga0268303_1049461 | 3300028147 | Phyllosphere | MGQVRQRNGVKPPETRVLDIKYVVRNQTNIVEHRNGVKLPQI |
Ga0268308_10127411 | 3300028151 | Phyllosphere | MGQVRQRNGLKPPETQVLGVKYVVRNQIDVLEHRNGVKIPKMXVL |
Ga0268308_10174501 | 3300028151 | Phyllosphere | GQVQQRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPKM |
Ga0268308_10275101 | 3300028151 | Phyllosphere | MGQVRQRNGVKPPETRVLDVKYVVRNQTDILEHXNG |
Ga0268308_10314321 | 3300028151 | Phyllosphere | MGQVRQRNDVKPPETRVLDVKYVVRNQTDFLEHRNG |
Ga0268336_10315271 | 3300028152 | Phyllosphere | IFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDILEHRNDVQIPKM |
Ga0268320_10035882 | 3300028153 | Phyllosphere | MVQVRQRNGVKPPKTRVLDVKYVVXNQTDIVDNRNGVK |
Ga0268320_10062921 | 3300028153 | Phyllosphere | MGQVQQQNGVKPPKTRVLDLNFVVQNQTDVLEHQNL |
Ga0268320_10289131 | 3300028153 | Phyllosphere | MGLVWQXNGMKPPETRVLDVKYMVRNQTDVVEHRNGVK |
Ga0268312_10235821 | 3300028248 | Phyllosphere | QRNGVKPPETQILDVKYVVRNQTDVVEHRNCVKIPKI |
Ga0268316_10020871 | 3300028253 | Phyllosphere | MGQVRQXNGVKPPETRVLEVKYVVQNQRDVVEHRN |
Ga0268304_10069411 | 3300028256 | Phyllosphere | NGVKPTKTRVLDVKYMVRNQTDVLEHRNGVQIPKM |
Ga0268310_10010401 | 3300028262 | Phyllosphere | MGQVQQRKGVKSPETXVLDVKYVVRNQTDVLEHRNGVKIPKIXVLDLK |
Ga0268310_10111001 | 3300028262 | Phyllosphere | MGQVRQXNGMKPHKTRILDVKYVVRNQTNVVEHRNGVK |
Ga0268317_10069231 | 3300028468 | Phyllosphere | NGVKPPKTRTLDVKYVVRNQTDIVKHRNGVKILKI |
Ga0268307_10006432 | 3300028470 | Phyllosphere | MGQVWQRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPKMXVLD |
Ga0268315_10069641 | 3300028472 | Phyllosphere | MGQVWQRNGVKQPETRILDVKYVVRNQTDVVEHRNGVKIPKIXV |
Ga0268319_10172611 | 3300028473 | Phyllosphere | QRNGVKPPETQVLDVKYVVRNQMDVVEHRNGVKIPKI |
Ga0268331_10115491 | 3300028474 | Phyllosphere | MGQVRQXNGVKPPETXVLEVKYVVRNQTDILEHRNDVQI |
Ga0268329_10152971 | 3300028476 | Phyllosphere | MGQVRQRNGVKPPETRVLDIKYVVRNQPDVLEHRNCVQIPKI |
Ga0268329_10212771 | 3300028476 | Phyllosphere | MCQVRQRNGMKPPKTXVLDIKYVVRNQKDVLEHRNGVK |
Ga0268309_10052221 | 3300028477 | Phyllosphere | MVQVWQQNGVKPPETRVLDVKYVVRNQTDVVEHRNGVKIPKI |
Ga0268313_10005183 | 3300028523 | Phyllosphere | QVRQRNGVKPPKTRVLDIKYVVRNQPDVLEHRNGVQIPKM |
Ga0268311_10074451 | 3300028529 | Phyllosphere | MGQVRQXNGVKQPETRILDVKYVVRNQTDVVEHRN |
Ga0214489_10658231 | 3300032590 | Switchgrass Phyllosphere | MGQVRQRIGVKPPKTRVLDVKYVVRNQMDVVEHQNGVKFPKIXV |
Ga0314757_11286991 | 3300033534 | Switchgrass Phyllosphere | MGQVQQRNGVKPPEIRVLDVKYVVXNQTDILEHRNGVQI |
⦗Top⦘ |