NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066737

Metagenome / Metatranscriptome Family F066737

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066737
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 48 residues
Representative Sequence LHMKWSEAWQAHVDGETYKTPFNVPELPVDFTTYDLEFVRRKHLGF
Number of Associated Samples 100
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.50 %
% of genes near scaffold ends (potentially truncated) 92.06 %
% of genes from short scaffolds (< 2000 bps) 80.16 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.651 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(42.063 % of family members)
Environment Ontology (ENVO) Unclassified
(53.968 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(61.905 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.57%    β-sheet: 8.11%    Coil/Unstructured: 74.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF13443HTH_26 37.30
PF03692CxxCxxCC 12.70
PF01894UPF0047 0.79
PF03237Terminase_6N 0.79
PF00210Ferritin 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.79

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.44 %
UnclassifiedrootN/A5.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352036|2207190714All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300001533|MLSed_10210757All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300002040|GOScombined01_102955613All Organisms → cellular organisms → Bacteria1589Open in IMG/M
3300003986|Ga0063233_10192954All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300005239|Ga0073579_1188925All Organisms → cellular organisms → Bacteria46653Open in IMG/M
3300005582|Ga0049080_10004297All Organisms → cellular organisms → Bacteria4963Open in IMG/M
3300006025|Ga0075474_10093984All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300006025|Ga0075474_10100180All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium936Open in IMG/M
3300006637|Ga0075461_10122864All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300006802|Ga0070749_10306388All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300006802|Ga0070749_10373449All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300006805|Ga0075464_10494613All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300006867|Ga0075476_10077096All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300006874|Ga0075475_10344713All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300006874|Ga0075475_10382155All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300006874|Ga0075475_10410050All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300006916|Ga0070750_10251351All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300006916|Ga0070750_10468457All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300006917|Ga0075472_10652496All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300006919|Ga0070746_10169496All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300006919|Ga0070746_10277104All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300006919|Ga0070746_10457290All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300007538|Ga0099851_1059229All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300007538|Ga0099851_1159663All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300007539|Ga0099849_1355682All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300007540|Ga0099847_1066197All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300007540|Ga0099847_1146979All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300007540|Ga0099847_1228804All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300007541|Ga0099848_1155667All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300007541|Ga0099848_1263658All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300007541|Ga0099848_1329932All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300007542|Ga0099846_1083289All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300007542|Ga0099846_1285682All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300007590|Ga0102917_1004304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4834Open in IMG/M
3300007617|Ga0102897_1065562All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300007640|Ga0070751_1044796All Organisms → cellular organisms → Bacteria1964Open in IMG/M
3300007960|Ga0099850_1040720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2004Open in IMG/M
3300008012|Ga0075480_10183370All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300008120|Ga0114355_1004306All Organisms → cellular organisms → Bacteria12350Open in IMG/M
3300009164|Ga0114975_10421213All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300009353|Ga0103847_1003947All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300009529|Ga0114919_10111645All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300010299|Ga0129342_1315743All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300010354|Ga0129333_10110791All Organisms → cellular organisms → Bacteria2533Open in IMG/M
3300010354|Ga0129333_11508389All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300010368|Ga0129324_10135311All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300010370|Ga0129336_10073673All Organisms → Viruses → Predicted Viral2020Open in IMG/M
3300010370|Ga0129336_10462313All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300010412|Ga0136852_10572394All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300012919|Ga0160422_10582130All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300012936|Ga0163109_11151443All Organisms → cellular organisms → Bacteria566Open in IMG/M
(restricted) 3300013133|Ga0172362_10066220All Organisms → cellular organisms → Bacteria2773Open in IMG/M
3300017700|Ga0181339_1029275All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300017736|Ga0181365_1148880All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300017755|Ga0181411_1122779All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300017778|Ga0181349_1048199All Organisms → cellular organisms → Bacteria1677Open in IMG/M
3300017956|Ga0181580_10227336All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300017960|Ga0180429_10059174All Organisms → cellular organisms → Bacteria2623Open in IMG/M
3300017963|Ga0180437_10109399All Organisms → cellular organisms → Bacteria2317Open in IMG/M
3300017967|Ga0181590_10960190All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300017992|Ga0180435_10421612All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300018065|Ga0180430_11151176All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300018424|Ga0181591_10844402All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300019781|Ga0181360_121795All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300019784|Ga0181359_1172022All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300020179|Ga0194134_10114791All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300020431|Ga0211554_10301410All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300020603|Ga0194126_10090694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2532Open in IMG/M
3300021963|Ga0222712_10779501All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300022057|Ga0212025_1084792All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300022065|Ga0212024_1034354All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300022198|Ga0196905_1034322All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300022200|Ga0196901_1200350All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300022935|Ga0255780_10146381All Organisms → cellular organisms → Bacteria1298Open in IMG/M
3300023116|Ga0255751_10121313All Organisms → cellular organisms → Bacteria1585Open in IMG/M
3300024262|Ga0210003_1349073All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300025093|Ga0208794_1025787All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300025630|Ga0208004_1080399All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300025647|Ga0208160_1024075All Organisms → cellular organisms → Bacteria1896Open in IMG/M
3300025647|Ga0208160_1154833All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300025655|Ga0208795_1171827All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300025674|Ga0208162_1028847All Organisms → cellular organisms → Bacteria2052Open in IMG/M
3300025674|Ga0208162_1129459All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300025769|Ga0208767_1110825All Organisms → cellular organisms → Bacteria1075Open in IMG/M
3300025815|Ga0208785_1068956All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium936Open in IMG/M
3300025815|Ga0208785_1103053All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300025840|Ga0208917_1227555All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300025853|Ga0208645_1026782All Organisms → cellular organisms → Bacteria3058Open in IMG/M
3300025889|Ga0208644_1148846All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300025889|Ga0208644_1261489All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300027387|Ga0208311_1005488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3273Open in IMG/M
3300027608|Ga0208974_1177584All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300027732|Ga0209442_1340452All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300027782|Ga0209500_10405715All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300027793|Ga0209972_10251679All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300027851|Ga0209066_10149435All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300027974|Ga0209299_1023707All Organisms → cellular organisms → Bacteria2733Open in IMG/M
(restricted) 3300029286|Ga0247841_10846554All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300029308|Ga0135226_1010720All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300029753|Ga0135224_1025629All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300031539|Ga0307380_10201618All Organisms → cellular organisms → Bacteria1921Open in IMG/M
3300031539|Ga0307380_10472804All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300031565|Ga0307379_10520734All Organisms → cellular organisms → Bacteria1107Open in IMG/M
3300031566|Ga0307378_10373059All Organisms → cellular organisms → Bacteria1320Open in IMG/M
3300031566|Ga0307378_11447179All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300031669|Ga0307375_10143334All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300031669|Ga0307375_10197734All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300031673|Ga0307377_10079682All Organisms → cellular organisms → Bacteria2694Open in IMG/M
3300031758|Ga0315907_11085899All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300031772|Ga0315288_11292785All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031857|Ga0315909_10009223All Organisms → cellular organisms → Bacteria10691Open in IMG/M
3300031999|Ga0315274_11872806All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300032342|Ga0315286_10920235All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300034062|Ga0334995_0175764All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1517Open in IMG/M
3300034072|Ga0310127_018543All Organisms → cellular organisms → Bacteria4381Open in IMG/M
3300034073|Ga0310130_0115248All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300034106|Ga0335036_0362496All Organisms → cellular organisms → Bacteria943Open in IMG/M
3300034116|Ga0335068_0496924All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300034418|Ga0348337_127097All Organisms → cellular organisms → Bacteria768Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous42.06%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake7.14%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil6.35%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient5.56%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.97%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.17%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.17%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment3.17%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.38%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.38%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.59%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.59%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.59%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.59%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water1.59%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.79%
WatershedsEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds0.79%
BenthicEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic0.79%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.79%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.79%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.79%
MarineEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine0.79%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.79%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.79%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.79%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.79%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352036Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Oil_sample_6EnvironmentalOpen in IMG/M
3300001533Benthic freshwater microbial communities from British Columbia, CanadaEnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300003986Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007590Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02EnvironmentalOpen in IMG/M
3300007617Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009353Microbial communities of water from the North Atlantic ocean - ACM49EnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017960Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaGEnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017992Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaGEnvironmentalOpen in IMG/M
3300018065Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaGEnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019781Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.DEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022935Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaGEnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025093Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027387Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027851Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes)EnvironmentalOpen in IMG/M
3300027974Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300029308Marine harbor viral communities from the Indian Ocean - SRB2EnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034116Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOREnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22090675472199352036MarineMKWGEGWQAHIDEPTHKVPFDVSEFPVSFTTYDLDFVRRKHLGF
MLSed_1021075723300001533BenthicGEAWQAHVEGETHKTPFGVSELPVDFTTYDLSFVRRKNLGF*
GOScombined01_10295561353300002040MarineIAQGIHVAHELNKKYVTMKWGEGWQAHIDKPTYDHPFNQPEFPKSFTTYDLDFVRKKHLGF*
Ga0063233_1019295413300003986Freshwater LakeHYLHAKWSPAWQAHVEGEVYKSPFDTDDLPLDFTTYDLNFVRRKNLGF*
Ga0073579_118892563300005239MarineMPIHICHELNKKYLHLKWGEAWQAHVDGETHKSPFNISELPVSFTTYDLEFVRKKHLGF*
Ga0049080_10004297113300005582Freshwater LenticEAWQAHVEGETYKTPFNIPELPIDFVTYDLEFVRRKYLGF*
Ga0075474_1009398423300006025AqueousKRYLHSKWGEGWQHHIDEPTHKSPFNIKEFPVSFTTWDLEFNRKKHLGF*
Ga0075474_1010018033300006025AqueousLNKTYMHAKWSEAWQGHVEGKPYKNPFNNPAFPSCLTTYNLDFVRAKNLGF*
Ga0075461_1012286413300006637AqueousVHIAHEMNKRYLHAKWSEAWQAHIEGDTYKTPFNIPELPTSFTTWDLEFCRRKHLGF*
Ga0070749_1030638813300006802AqueousEAWQAHIDGETHKTPFNVPDFPVGFTTYDLQFVRRKHLGF*
Ga0070749_1037344923300006802AqueousWGEGWQAHIDEPTHKTPFNVPEFPISFTTYDLEFVRRKHLGF*
Ga0070749_1039644033300006802AqueousAHIEGEVYPHPFNNEALPVSLTTYNLDFVRRKNLGF*
Ga0075464_1049461323300006805AqueousEMNKGYMHAKWSPAWQGHVEGEVHETPFNIPSLPIDFTTYDLEFVRSKTLGF*
Ga0075476_1007709643300006867AqueousHMKWGEGWQAHVDEPTHKAPFNVPEFPISFTTYDLEFVRRKHLGF*
Ga0075475_1034471333300006874AqueousAHELNKTYMHAKWSEAWQGHVEGKPYKNPFNNPAFPSCLTTYNLDFVRAKNLGF*
Ga0075475_1038215513300006874AqueousHYLHAKWSPAWQAHIEGEVYPHPFNNEALPVSLTTYNLDFVRRKNLGF*
Ga0075475_1041005013300006874AqueousAHELNKRYLHMKWGEAWQAHVEGETHKTPFNIPELPIDFTTYDLSFVRRKHLGF*
Ga0070750_1024553633300006916AqueousSPAWQAHIEGEVYPHPFNNEALPVSLTTYNLDFVRRKNLGF*
Ga0070750_1025135133300006916AqueousYEVGEGWQAHIDEPTHEHPFNNPEFPASFTTFDLGFCRRKHLGF*
Ga0070750_1046845723300006916AqueousNKRYMHMKWGEGWQAHIDEPTHKTPFNVPEFPISFTTYDLEFVRRKHLGF*
Ga0075472_1065249623300006917AqueousWSEAWQAHVDGETYKTPFNVPDLPIDFTTYDLEFVRRKHLGF*
Ga0070746_1016949613300006919AqueousNIHLAHELNKRYLHSKWGEGWQHHVDEPTHKSPFNIKEFPVSFTTWDLEFNRKKHLGF*
Ga0070746_1027710423300006919AqueousQQQTAVHIELELNKRYLHMKWGEAWQARVEGETHKTPFNIPELPIDFTTYDLSFVRRKHLGF*
Ga0070746_1045729013300006919AqueousEAWQAHVDGETYRTPFNIPELPTSFTTWDLEFCRHKNLGF*
Ga0099851_105922913300007538AqueousLNKRYLHMKWGEAWQAHVEGETHKTPFGVSELPVDFTTYDLGFVRRKNLGF*
Ga0099851_115966323300007538AqueousMHMKWGEGWQAHIDEPTHKTPFNVPEFPISFTTYDLEFVRRKHLGF*
Ga0099849_135568213300007539AqueousYLHAKWSEAWQAHVDGETYRTPFNIPELPNSFTTWDLEFCRHKNLGF*
Ga0099847_106619733300007540AqueousGIHVAHELNKQYLHLKWNEAWQGHVEGETYKTPFNLQEMPLSFTTFDLSFVRRKHLGF*
Ga0099847_114697913300007540AqueousHELNKKYLHLKWNEAWQSHVEGETYKTPFNLPGMPVSFTTYDLNFVRRKNLGF*
Ga0099847_122880413300007540AqueousAHVDEPTHKAPFNMPEFPISFTTYDLEFVRRKHLGF*
Ga0099848_115566713300007541AqueousHIAHEMNKTYLHAKWSPAWQAHVEGEIYTAPFNNPAIPLDFTTYDLEFVRRKNLGF*
Ga0099848_126365813300007541AqueousVHIAHELNKRYLHMKWGEAWQAHVDGETHKTPFNVPEFPVDFTTYDLEFVRRKHLGFCDVNSSRC*
Ga0099848_132993213300007541AqueousQAHVEGETHKTPFNISEFPVDFTTYDLEFVRRKNLGF*
Ga0099846_108328913300007542AqueousVEGETHKTPFGVSELPVDFTTYDLGFVRRKNLGF*
Ga0099846_128568223300007542AqueousNEAWQGHVEGETYKTPFNLQEMPLSFTTFDLSFVRRKHLGF*
Ga0102917_100430493300007590EstuarineLHAKWSPAWQHHIEGDVYKTPFNNPSIPLDFTTYDLHFVRQKNLGF*
Ga0102897_106556233300007617EstuarineAHELNKQYLHAKWSPAWQHHIEGDVYKTPFNNPSIPLDFTTYDLHFVRQKNLGF*
Ga0070751_104479613300007640AqueousKWGEGWQHHIDEPTHKSPFNIKEFPVSFTTWDLEFNRKKHLGF*
Ga0099850_104072013300007960AqueousNKIHMAHELNKTYMHAKWSPAWQGHVEGKPYKHPFNNPAFPTCLTTYNLEFVRAKNLGF*
Ga0075480_1018337033300008012AqueousHMKWGEAWQAHVEGETHKTPFNIPELPIDFTTYDLSFVRRKHLGF*
Ga0114355_100430613300008120Freshwater, PlanktonHELNKRYLHMKWSEAWQAHVDGETYKTPFNVPELPVDFTTYDLEFVRRKHLGF*
Ga0114975_1042121313300009164Freshwater LakeHVAHELNKRYLHTKWGEAWQAHVDGETYKNPFNIPEFPVDFVTYDLDFVRRKYLGF*
Ga0103847_100394713300009353River WaterIAQGIHIAHELNKQYLHLKWNEAWQGHVEGETYKTPFNLQEMPLSFTTYDLSFVRRKHLGF*
Ga0114919_1011164513300009529Deep SubsurfaceHRAHEMNKRYLHLKWNEAWQAHVDGLTNKTPFNLPDMPVSFTTYDLGFVRSKHLGF*
Ga0129342_131574313300010299Freshwater To Marine Saline GradientAKWSPAWQFHVEGEVYPNPFNNPSIPLDFTTYDLHFVRSKNLGF*
Ga0129333_1011079113300010354Freshwater To Marine Saline GradientELNKRYLHKKWSEAWQSHVDGETYQTPFNVPELPIDFTTYDLEFVRRKHLGF*
Ga0129333_1150838913300010354Freshwater To Marine Saline GradientELNKQYLHAKWSPAWQHHIEGDVYKTPFNNPSIPLDFTTYDLHFVRQKNLGF*
Ga0129324_1013531113300010368Freshwater To Marine Saline GradientAHEFNKRYLHMKWGEGWQAHIDEPTHKHPFNNPEFPISFTTFDLGFCRRKHLGF*
Ga0129336_1007367313300010370Freshwater To Marine Saline GradientLHAKWNPAWQAHVEGEVYKTPFNNPSIPIDYTQYDLHFVRSKNLGF*
Ga0129336_1029524213300010370Freshwater To Marine Saline GradientGHVEGKPYKNPFNNPAFPSCLTTYNLDFVRAKNLGF*
Ga0129336_1046231323300010370Freshwater To Marine Saline GradientHVDGETHKTPFNVSEFPVDFTTYDLEFVRRKHLGF*
Ga0136852_1057239413300010412Mangrove SedimentETYKTPFDIPERPTSFTTWDLEFCRRKHLGFEKFKLA*
Ga0160422_1058213013300012919SeawaterHLKWSEAWQGHVDGETYKTPFNIPDMPLCFTTYDLSFVRRKHLGF*
Ga0163109_1115144323300012936Surface SeawaterSWQSHVEGETYKTPFNLQEMPLSFTTFDLGFVRRKHLGF*
(restricted) Ga0172362_1006622073300013133SedimentAHELNKTYLHAKWSPAWQAHVEGEVYEYPFNNAEIPLDFTTYNLQFVRQKNLGF*
Ga0181339_102927513300017700Freshwater LakeHIAHELNKTYLHAKWSPAWQAHVEGEVYEYPFNNAEIPLDFTTYNLQFVRQKNLGF
Ga0181365_114888013300017736Freshwater LakeQGIHVAHELNKQYLHAKWSPAWQAHIEGEVYESPFNTPTLPLDFTTYDLSFVRRKNLGF
Ga0181411_112277923300017755SeawaterHVEGETYKTPFDLEDMPVSFTTYDLDFVRRKNLGF
Ga0181343_101354473300017766Freshwater LakeSPAWQAHIEGDVYPHPFNNEALPVSLTTYNLEFVRAKNLGF
Ga0181349_104819913300017778Freshwater LakeRLQHAVHVAHELNKRYLHAKWGEAWQAHVEGETYKTPFNIPELPIDFVTYDLEFVRRKYLGF
Ga0181580_1022733633300017956Salt MarshLHMKWGEAWQAHVEGETHKTPFNIPELPIDFTTYDLSFVRRKHLGF
Ga0180429_1005917473300017960Hypersaline Lake SedimentSIANGIHLAHELNKRYLHMKWGEAWQAHVEGETHKTPFGVSELPVDFTTYDLSFVRRKNLGF
Ga0180437_1010939913300017963Hypersaline Lake SedimentAHELNKRYLHMKWGEAWQAHVEGETHKTPFGVSELPVDFTTYDLSFVRRKNLGF
Ga0181590_1096019023300017967Salt MarshSDPSIANNIHLAHELNKRYLHSKWGEGWQHHIDEPTHKSPFNIKEFPVSFTTWDLEFNRKKHLGF
Ga0180435_1042161233300017992Hypersaline Lake SedimentMKWGEAWQAHVEGETYKTPFGVSELPVDFTTYDLGFVRRKNLGF
Ga0180430_1115117623300018065Hypersaline Lake SedimentWGEAWQAHVEGETHKTPFGVSELPVDFTTYDLGFVRRKNLGF
Ga0181591_1084440223300018424Salt MarshELNKRYLHSKWGEGWQHHIDEPTHKSPFNIKEFPVSFTTWDLEFNRKKHLGF
Ga0181360_12179513300019781Freshwater LakeAIHGAHELNKLYLHMKWGEAWQSHVEGETHKTPFAIPELPIDFVTYDLDFVRSKYLGF
Ga0181359_117202213300019784Freshwater LakeAHVEGEVYKSPFDTDDLPLDFTTYDLNFVRRKNLGF
Ga0194134_1011479153300020179Freshwater LakeQAHVEGEVYKTPFNNPSIPLDFTTYDLHFVRSKNLGF
Ga0211554_1030141013300020431MarineLHLKWGEAWQAHVDGETHKSPFNISELPVSFTTYDLEFVRKKHLGF
Ga0194126_1009069463300020603Freshwater LakeHEMNKQYLHAKWNPAWQAHIEGEVYKTPFNNPSIPIDYTQYDLHFVRSKNLGF
Ga0222712_1077950123300021963Estuarine WaterAHVEGEVYKTPFNNPSIPLDFTTYDLHFVRSKNLGF
Ga0212025_108479213300022057AqueousVHTAHELNKRYLHMKWGEAWQAHVEGETHKTPFNIPELPIDFTTYDLSFVRRKHLGF
Ga0212024_103435413300022065AqueousIAHEMNKHYLHAKWSPAWQAHIEGEVYPHPFNNEALPVSLTTYNLDFVRRKNLGF
Ga0196899_103398813300022187AqueousKWSPAWQAHIEGEVYPHPFNNEALPVSLTTYNLDFVRRKNLGF
Ga0196905_103432213300022198AqueousLHLKWGEGWQAHIDEPTHKHPFNNPEFPISFTTFDLGFCRRKHLGF
Ga0196901_120035013300022200AqueousYLHMKWGEAWQAHIDGETHKTPFNVPDFPVGFTTYDLQFVRRKHLGF
Ga0196901_124619313300022200AqueousSEAWQGHVDGKPYKNPFNNPALPSCLTTYNLEFVRAKNLGF
Ga0255780_1014638113300022935Salt MarshMNKRYLHMKWGEAWQAHVEGETHKTPFNIPELPIDFTTYDLSFVRRKHLGF
Ga0255751_1012131313300023116Salt MarshYLHMKWGEAWQAHVEGETHKTPFNIPELPIDFTTYDLSFVRRKHLGF
Ga0210003_134907333300024262Deep SubsurfaceAKWSPAWQAHVEGEVYESPFDTPDLPLDFTTYDLNFVRRKNLGF
Ga0208794_102578713300025093MarineRGVHVAHEMNKAYVTMKWNEAWQGHVDGETHKTPFNLEQMPVSFTTYDLDFVRRKHLGF
Ga0208004_108039913300025630AqueousVHIAHEMNKRYLHAKWSEAWQAHIEGDTYKTPFNIPELPTSFTTWDLEFCRRKHLGF
Ga0208160_102407553300025647AqueousHIEGDTYKTPFNIPEFPNSFTTWDLEFCRRKNLGF
Ga0208160_115483323300025647AqueousGWQAHIDEPTHKTPFNVPEFPISFTTYDLEFVRRKHLGF
Ga0208795_117182733300025655AqueousHVEGETHKTPFNIPELPIDFTTYDLSFVRRKHLGF
Ga0208162_102884713300025674AqueousYLHAKWSEAWQAHIEGDTYRTPFNIPEFPNSFTTWDLEFCRRKNLGF
Ga0208162_112945933300025674AqueousAHELNKSYMHAKWSEAWQGHVDGKPYKNPFNNSALPSCLTTYNLEFVRAKNLGF
Ga0208767_111082543300025769AqueousHAKWSPAWQAHIEGEVYPHPFDNEALPVSLTTYNLDFVRRKNLGF
Ga0208785_106895613300025815AqueousLNKTYMHAKWSEAWQGHVEGKPYKNPFNNPAFPSCLTTYNLDFVRAKNLGF
Ga0208785_110305313300025815AqueousRYLHMKWGEAWQAHVEGETHKTPFNIPELPIDFTTYDLSFVRRKHLGF
Ga0208917_122755513300025840AqueousAHELNKTYMHAKWSEAWQGHVEGKPYKNPFNNPAFPSCLTTYNLDFVRAKNLGF
Ga0208645_102678213300025853AqueousNKHYLHAKWSPAWQAHIEGEVYPHPFNNEALPVSLTTYNLDFVRRKNLGF
Ga0208644_114884643300025889AqueousWQHHIEGDVYKTPFNNPSIPLDFTTYDLHFVRQKNLGF
Ga0208644_126148913300025889AqueousKWGEGWQAHIDEPTHKTPFNVPEFPISFTTYDLEFVRRKHLGF
Ga0208311_100548813300027387EstuarineHAKWSPAWQHHIEGDVYKTPFNNPSIPLDFTTYDLHFVRQKNLGF
Ga0208974_117758413300027608Freshwater LenticEAWQAHVEGETYKTPFNIPELPIDFVTYDLEFVRRKYLGF
Ga0209442_134045213300027732Freshwater LakeHAKWSPAWQAHVEGEVYKTPFDMKELPLDFTTYDLEFVRKKYLGF
Ga0209500_1040571513300027782Freshwater LakeSPAWQGHVEGEVHETPFNIPSLPIDFTTYDLEFVRSKTLGF
Ga0209972_1025167923300027793Freshwater LakeLHMKWSEAWQAHVDGETYKTPFNVPELPVDFTTYDLEFVRRKHLGF
Ga0209066_1014943553300027851WatershedsWSPAWQAHIEGEVYKAPFNNPSLPLDFTTYDLHFVRQKNLGF
Ga0209299_102370713300027974Freshwater LakeKGYMHAKWSPAWQGHVEGEVHETPFNIPSLPIDFTTYDLEFVRSKTLGF
(restricted) Ga0247841_1084655413300029286FreshwaterNKQYLHAKWSPAWQAHIEGEVYESPFNTPTLPLDFTTYDLSFVRRKNLGF
Ga0135226_101072023300029308Marine HarborFPVTIKGETYKTPFNLEEMPLSFTTFDLSFVRRKHLGF
Ga0135224_102562923300029753Marine HarborMHMKWSEAWQGHVEGETYKTPFNLEDMPLSFTTYDLDFVRRKHLGF
Ga0307380_1020161813300031539SoilLHLKWGEPWQAHVEGETYKTPFGVTELPVDFTTYDLSFVRRKNLGF
Ga0307380_1047280413300031539SoilIHMAHELNKMYLHHKWSPAWQAHVDGEVYRAPFNNPELPIDFTMYNLEFVRQKHLGF
Ga0307379_1052073413300031565SoilSEAWQAHVEGETYKTPFNVPELPIDFTTYDLDFVRRKHLGF
Ga0307378_1037305913300031566SoilWSEAWQAHVEGETYKTPFNLPELPIDFTTYDLEFVRRKHLGF
Ga0307378_1144717913300031566SoilHVAHELNKQYLHAKWSPAWQAHVEGEVYESPFDTPDLPLDFTTYDLNFVRRKNLGF
Ga0307375_1014333413300031669SoilLHAKWSPAWQAHIEGEVYPHPFNNEALPVSLTTYNLDFVRRKNLGF
Ga0307375_1019773413300031669SoilWGEPWQAHVEGETYKTPFGVTELPVDFTTYDLSFVRRKNLGF
Ga0307377_1007968213300031673SoilHELNKCYLHLKWGEPWQAHVEGETYKTPFGVTELPVDFTTYDLSFVRRKNLGF
Ga0315907_1108589923300031758FreshwaterHELNKRYLHMKWSEAWQAHVDGETYKTPFNVPELPVDFTTYDLEFVRRKHLGF
Ga0315288_1129278513300031772SedimentMGIHKAHEMNKHYLHAKWSPAWQGHIEGEVYPYPFNNSALPLDFTSYDLNFVRSKNLGF
Ga0315909_10009223183300031857FreshwaterVHVAHELNKRYLHMKWSEAWQAHVDGETYKTPFNVPELPVDFTTYDLEFVRRKHLGF
Ga0315274_1187280613300031999SedimentNKKYLHMKWSEAWQAHVEGETYKTPFNVSELPIDFTTYDLEFVRRKHLGF
Ga0315286_1092023513300032342SedimentQSHVEGEVYRTPFNNPNIPLDFTTYDLHFVRSKNLGF
Ga0334995_0175764_3_1763300034062FreshwaterIHIAHELNKTYLHAKWSPAWQAHVEGEVYEYPFNNAEIPLDFTTYNLQFVRQKNLGF
Ga0310127_018543_4206_43793300034072Fracking WaterIHYAHEMNKHYLHAKWSPAWQFHVDGEVYPSPFNNPSIPLDFTTYDLHFVRSKNLGF
Ga0310130_0115248_1_1383300034073Fracking WaterHAKWSPAWQAHVEGEVYEYPFNNAEIPLDFTTYNLQFVRQKNLGF
Ga0335036_0362496_812_9433300034106FreshwaterKWSPAWQAHVEGEVYEYPFNNAEIPLDFTTYNLQFVRQKNLGF
Ga0335068_0496924_3_1283300034116FreshwaterSPAWQAHVEGEVYEYPFNNAEIPLDFTTYNLQFVRQKNLGF
Ga0348336_140150_629_7363300034375AqueousHIEGEVYPHPFNNEALPVSLTTYNLDFVRRKNLGF
Ga0348337_127097_2_1663300034418AqueousAHELNKRYMHMKWGEGWQAHIDEPTHKTPFNVPEFPISFTTYDLEFVRRKHLGF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.