Metagenome Family F066873

Basic Information
Family ID	F066873
Family Type	Metagenome
Number of Sequences	126
Average Sequence Length	40 residues
Representative Sequence	MIFLGLNNYPKIMKIVLPLSYHVMNLYKNFELNWNKLIYFII
Number of Associated Samples	61
Number of Associated Scaffolds	126

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	61.90 %
% of genes near scaffold ends (potentially truncated)	81.75 %
% of genes from short scaffolds (< 2000 bps)	98.41 %
Associated GOLD sequencing projects	58
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Most Common Taxonomy
Group	Unclassified (99.206 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (80.952 % of family members)
Environment Ontology (ENVO)	Unclassified (81.746 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (81.746 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 126 Family Scaffolds
PF07883	Cupin_2	0.79
PF00385	Chromo	0.79

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.21 %
All Organisms	root	All Organisms	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.21 %
cellular organisms	root	All Organisms → cellular organisms	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.21 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.21 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.21 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.79 %

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_100248602	Not Available	1419	Open in IMG/M
3300005334\|Ga0068869_100447224	Not Available	1070	Open in IMG/M
3300005334\|Ga0068869_100511949	Not Available	1003	Open in IMG/M
3300005338\|Ga0068868_100313315	Not Available	1335	Open in IMG/M
3300005338\|Ga0068868_100455428	Not Available	1113	Open in IMG/M
3300005338\|Ga0068868_101043944	Not Available	749	Open in IMG/M
3300005459\|Ga0068867_100865818	Not Available	811	Open in IMG/M
3300005459\|Ga0068867_102224466	Not Available	520	Open in IMG/M
3300005543\|Ga0070672_100269705	Not Available	1437	Open in IMG/M
3300005543\|Ga0070672_100784832	Not Available	837	Open in IMG/M
3300005616\|Ga0068852_101565015	Not Available	682	Open in IMG/M
3300005718\|Ga0068866_10652604	Not Available	716	Open in IMG/M
3300006237\|Ga0097621_100890410	Not Available	828	Open in IMG/M
3300006237\|Ga0097621_101496207	Not Available	640	Open in IMG/M
3300006237\|Ga0097621_102081328	Not Available	542	Open in IMG/M
3300006881\|Ga0068865_100725455	Not Available	851	Open in IMG/M
3300006881\|Ga0068865_101131946	Not Available	690	Open in IMG/M
3300006881\|Ga0068865_101352526	Not Available	635	Open in IMG/M
3300009098\|Ga0105245_12356521	Not Available	586	Open in IMG/M
3300014745\|Ga0157377_11535916	Not Available	531	Open in IMG/M
3300015267\|Ga0182122_1030504	Not Available	640	Open in IMG/M
3300015269\|Ga0182113_1010060	Not Available	966	Open in IMG/M
3300015269\|Ga0182113_1012464	Not Available	911	Open in IMG/M
3300015269\|Ga0182113_1024620	Not Available	755	Open in IMG/M
3300015275\|Ga0182172_1014764	Not Available	793	Open in IMG/M
3300015275\|Ga0182172_1054632	Not Available	557	Open in IMG/M
3300015276\|Ga0182170_1005736	Not Available	1026	Open in IMG/M
3300015276\|Ga0182170_1035623	Not Available	630	Open in IMG/M
3300015276\|Ga0182170_1056310	Not Available	553	Open in IMG/M
3300015279\|Ga0182174_1022035	Not Available	742	Open in IMG/M
3300015279\|Ga0182174_1070175	Not Available	535	Open in IMG/M
3300015279\|Ga0182174_1078615	Not Available	517	Open in IMG/M
3300015279\|Ga0182174_1080520	Not Available	513	Open in IMG/M
3300015281\|Ga0182160_1024134	Not Available	715	Open in IMG/M
3300015283\|Ga0182156_1019253	Not Available	777	Open in IMG/M
3300015285\|Ga0182186_1045155	Not Available	603	Open in IMG/M
3300015287\|Ga0182171_1022424	Not Available	743	Open in IMG/M
3300015288\|Ga0182173_1020602	Not Available	754	Open in IMG/M
3300015288\|Ga0182173_1081368	Not Available	511	Open in IMG/M
3300015292\|Ga0182141_1022925	Not Available	755	Open in IMG/M
3300015292\|Ga0182141_1067150	Not Available	557	Open in IMG/M
3300015295\|Ga0182175_1054628	Not Available	602	Open in IMG/M
3300015296\|Ga0182157_1072531	Not Available	561	Open in IMG/M
3300015298\|Ga0182106_1047368	Not Available	637	Open in IMG/M
3300015299\|Ga0182107_1013160	Not Available	918	Open in IMG/M
3300015299\|Ga0182107_1040269	Not Available	670	Open in IMG/M
3300015299\|Ga0182107_1095946	Not Available	516	Open in IMG/M
3300015302\|Ga0182143_1084084	Not Available	538	Open in IMG/M
3300015303\|Ga0182123_1005810	Not Available	1096	Open in IMG/M
3300015303\|Ga0182123_1012117	Not Available	900	Open in IMG/M
3300015303\|Ga0182123_1018125	Not Available	809	Open in IMG/M
3300015303\|Ga0182123_1041504	Not Available	646	Open in IMG/M
3300015303\|Ga0182123_1087796	Not Available	521	Open in IMG/M
3300015304\|Ga0182112_1028087	Not Available	743	Open in IMG/M
3300015304\|Ga0182112_1046233	Not Available	645	Open in IMG/M
3300015304\|Ga0182112_1057235	Not Available	606	Open in IMG/M
3300015304\|Ga0182112_1102317	Not Available	508	Open in IMG/M
3300015305\|Ga0182158_1048056	Not Available	635	Open in IMG/M
3300015314\|Ga0182140_1011472	Not Available	984	Open in IMG/M
3300015314\|Ga0182140_1028577	Not Available	764	Open in IMG/M
3300015314\|Ga0182140_1057418	Not Available	625	Open in IMG/M
3300015321\|Ga0182127_1036976	Not Available	731	Open in IMG/M
3300015321\|Ga0182127_1069816	Not Available	605	Open in IMG/M
3300015322\|Ga0182110_1119936	Not Available	508	Open in IMG/M
3300015341\|Ga0182187_1011881	Not Available	1284	Open in IMG/M
3300015341\|Ga0182187_1116927	Not Available	611	Open in IMG/M
3300015341\|Ga0182187_1157682	Not Available	549	Open in IMG/M
3300015341\|Ga0182187_1161996	Not Available	544	Open in IMG/M
3300015341\|Ga0182187_1172850	Not Available	531	Open in IMG/M
3300015342\|Ga0182109_1085280	Not Available	720	Open in IMG/M
3300015342\|Ga0182109_1220473	Not Available	505	Open in IMG/M
3300015343\|Ga0182155_1098304	Not Available	680	Open in IMG/M
3300015343\|Ga0182155_1148195	Not Available	588	Open in IMG/M
3300015344\|Ga0182189_1060712	Not Available	818	Open in IMG/M
3300015345\|Ga0182111_1048378	Not Available	920	Open in IMG/M
3300015345\|Ga0182111_1068278	Not Available	814	Open in IMG/M
3300015345\|Ga0182111_1091840	Not Available	731	Open in IMG/M
3300015345\|Ga0182111_1107571	Not Available	689	Open in IMG/M
3300015345\|Ga0182111_1119694	Not Available	663	Open in IMG/M
3300015345\|Ga0182111_1216239	Not Available	528	Open in IMG/M
3300015345\|Ga0182111_1227113	Not Available	518	Open in IMG/M
3300015346\|Ga0182139_1183841	Not Available	563	Open in IMG/M
3300015346\|Ga0182139_1201516	Not Available	543	Open in IMG/M
3300015346\|Ga0182139_1215952	Not Available	528	Open in IMG/M
3300015346\|Ga0182139_1235687	Not Available	510	Open in IMG/M
3300015347\|Ga0182177_1131275	Not Available	643	Open in IMG/M
3300015347\|Ga0182177_1190749	Not Available	558	Open in IMG/M
3300015351\|Ga0182161_1047691	Not Available	976	Open in IMG/M
3300015351\|Ga0182161_1100379	Not Available	740	Open in IMG/M
3300015351\|Ga0182161_1203902	Not Available	561	Open in IMG/M
3300015355\|Ga0182159_1082705	Not Available	926	Open in IMG/M
3300015355\|Ga0182159_1171797	Not Available	686	Open in IMG/M
3300015355\|Ga0182159_1185200	Not Available	664	Open in IMG/M
3300015355\|Ga0182159_1242787	Not Available	591	Open in IMG/M
3300015355\|Ga0182159_1345387	Not Available	506	Open in IMG/M
3300015361\|Ga0182145_1110042	Not Available	609	Open in IMG/M
3300017404\|Ga0182203_1046152	Not Available	755	Open in IMG/M
3300017404\|Ga0182203_1108562	Not Available	576	Open in IMG/M
3300017404\|Ga0182203_1161493	Not Available	504	Open in IMG/M
3300017407\|Ga0182220_1015380	Not Available	854	Open in IMG/M
3300017410\|Ga0182207_1048100	Not Available	772	Open in IMG/M
3300017411\|Ga0182208_1019384	Not Available	889	Open in IMG/M
3300017411\|Ga0182208_1107306	Not Available	534	Open in IMG/M
3300017413\|Ga0182222_1014825	Not Available	837	Open in IMG/M
3300017415\|Ga0182202_1084399	Not Available	591	Open in IMG/M
3300017424\|Ga0182219_1062305	Not Available	647	Open in IMG/M
3300017430\|Ga0182192_1015004	Not Available	1142	Open in IMG/M
3300017430\|Ga0182192_1099452	Not Available	610	Open in IMG/M
3300017430\|Ga0182192_1152287	Not Available	526	Open in IMG/M
3300017433\|Ga0182206_1100881	Not Available	582	Open in IMG/M
3300017433\|Ga0182206_1132678	Not Available	533	Open in IMG/M
3300017438\|Ga0182191_1066298	Not Available	706	Open in IMG/M
3300017438\|Ga0182191_1081979	Not Available	659	Open in IMG/M
3300017443\|Ga0182193_1002655	Not Available	1814	Open in IMG/M
3300017443\|Ga0182193_1026812	Not Available	968	Open in IMG/M
3300017443\|Ga0182193_1141659	Not Available	565	Open in IMG/M
3300017683\|Ga0182218_1058985	Not Available	675	Open in IMG/M
3300017685\|Ga0182227_1068912	Not Available	651	Open in IMG/M
3300017685\|Ga0182227_1070960	Not Available	643	Open in IMG/M
3300017685\|Ga0182227_1084992	Not Available	600	Open in IMG/M
3300017686\|Ga0182205_1086283	Not Available	634	Open in IMG/M
3300017690\|Ga0182223_1087355	Not Available	555	Open in IMG/M
3300021060\|Ga0182232_1002802	Not Available	3304	Open in IMG/M
3300025942\|Ga0207689_10035678	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	4130	Open in IMG/M
3300026023\|Ga0207677_11370146	Not Available	651	Open in IMG/M
3300026089\|Ga0207648_10535948	Not Available	1074	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	81.75%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.70%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.17%
Roots	Host-Associated → Plants → Roots	2.38%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	81.75%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.70%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.59%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	81.75%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.70%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.59%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	80.95%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	11.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	2.38%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.59%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.79%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.79%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1002486022	3300005334	Miscanthus Rhizosphere	MIFLGLFMYPKIMKIVLSLSYHVMNIYKNFELNWNKLIYFIIFN*
Ga0068869_1004472242	3300005334	Miscanthus Rhizosphere	MIFLGLFIYPKIMKIVLPLSYHVMNIYKNFEVNWNKLIYFIILN*
Ga0068869_1005119492	3300005334	Miscanthus Rhizosphere	MIFLGLFIYPKIMKFVLPLSYHVMNIYKNFELNWNKLIYFIILN*
Ga0068868_1003133151	3300005338	Miscanthus Rhizosphere	MIFLGLINYPKIMKIVLPLSYHVMNIYKNFEPNWNKLIYFIILN*
Ga0068868_1004554283	3300005338	Miscanthus Rhizosphere	MIFLGLINYPKIMKIVLPLSYHVMNIYKNFELNWNKLIYFIILN*
Ga0068868_1010439442	3300005338	Miscanthus Rhizosphere	SMIFLGLNNYPKIMKIVLPLSYHVMSLHKNFELIWRKLIYFIIIN*
Ga0068867_1008658182	3300005459	Miscanthus Rhizosphere	LGLNNYPKIMKIVFPLSYHVMSLHKNLELIWKKLIYFIILNLFN*
Ga0068867_1022244662	3300005459	Miscanthus Rhizosphere	MIFLGLFIYPKIMKIVLPLSYHVMNLYKNFEVNWNKLIYFIILDLIINS*
Ga0070672_1002697052	3300005543	Miscanthus Rhizosphere	MIFLGLINYPKIMKIVLPLSYHVMNLYKNFELNWNKLIYFIIFN*
Ga0070672_1007848321	3300005543	Miscanthus Rhizosphere	MIFLGLFMYPKIMKIVLSLSYHVMNIYKNFELNWNKLIYFII
Ga0068852_1015650151	3300005616	Corn Rhizosphere	MYPKIMKIVLSLSYHVMNIYKNFELNWNKLIYFIILN*
Ga0068866_106526042	3300005718	Miscanthus Rhizosphere	SMIFLGLFIYPKIMKFVLPLSYHVMNIYKNFELNWNKLIYFIILN*
Ga0097621_1008904101	3300006237	Miscanthus Rhizosphere	MIFLGLNNYPKIMKIVLPLSYHVMNFTKILSSIGTS*
Ga0097621_1014962071	3300006237	Miscanthus Rhizosphere	VSMIFLGLINYPKIMKIVLPLSYHVMNLYKNFEFN*
Ga0097621_1020813281	3300006237	Miscanthus Rhizosphere	MIFLGLFIYPKIMKFVLPLSYHVMNIYKNFELNWNKL
Ga0068865_1007254554	3300006881	Miscanthus Rhizosphere	PKIMKFVLPLSYHVMNIYKNFELNWNKLIYFIILN*
Ga0068865_1011319463	3300006881	Miscanthus Rhizosphere	MIFLGLINYPKIMKIVLPLSYHVMNAYKNFEPIGTS*
Ga0068865_1013525261	3300006881	Miscanthus Rhizosphere	MIFLGLYNYPKIMKIVFTLSYHVMSLHKNFELIWKKLIYFIILN*
Ga0105245_123565211	3300009098	Miscanthus Rhizosphere	MGFHDFLGLYNYPKIMKIVLPLSYHMLSLHKNFELNWKKL
Ga0157377_115359161	3300014745	Miscanthus Rhizosphere	MIFLGLINYPKIMKIVLPFSYHVMNLYKNFELIWKK
Ga0182122_10305041	3300015267	Miscanthus Phyllosphere	MIFLGLIIYPKIMKIVLTLSYHEMNMYKNFGLNWNKLIYFII
Ga0182113_10100601	3300015269	Miscanthus Phyllosphere	MIFLGLYNYQKIMRIVFTLSYHVMILHKIFELNWKKLIYFIILN*
Ga0182113_10124641	3300015269	Miscanthus Phyllosphere	MIFLGLFMYPKIMKIVLPLSYHVMNIYKNFEVNWNKLIYFII
Ga0182113_10246202	3300015269	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHVMDLYKNFELNWNKLIYFI
Ga0182172_10147641	3300015275	Miscanthus Phyllosphere	MIFLGLYNYPKIMKIVLPLIYHVMSLPKKFELIWRKLI
Ga0182172_10546321	3300015275	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLSYHVVSLHKNFDLNWKKLIYFTIL
Ga0182170_10057363	3300015276	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLSYLVVSIYKNFEVNWNKLIYFI
Ga0182170_10356231	3300015276	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLSYHVMNIYKNFEVNWNKLIYFII
Ga0182170_10563101	3300015276	Miscanthus Phyllosphere	MIFLGLFLYPKIMKLVLPLSYHEMSIYKNFEVNWN
Ga0182174_10220351	3300015279	Miscanthus Phyllosphere	MIFLGLIKYPKIMKIVLPLSYHVMNIYKNFELNWNKLIYFIILN*
Ga0182174_10701751	3300015279	Miscanthus Phyllosphere	MIFLGLYNYPKIMKIVFPLSYHMMSLHKNFELNWKKLIY
Ga0182174_10786151	3300015279	Miscanthus Phyllosphere	MIFLGLNNYPKIVKIVLSLSYHGMNLYKNFELNWKKLIY
Ga0182174_10805201	3300015279	Miscanthus Phyllosphere	MIFLGLYNYPKILKIVLTLSYHMMSLHKTVELIWKK
Ga0182160_10241341	3300015281	Miscanthus Phyllosphere	MIFLGLHNYPKIMKIVFPLSYHVMSLHKNLELIWK
Ga0182156_10192532	3300015283	Miscanthus Phyllosphere	MIFLGLFIYQKIMKIVLPLSYHVMNIYKNFELNWNKL
Ga0182186_10451551	3300015285	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLSYHMMNISKNFEVNWNKLIYFIIL
Ga0182171_10224241	3300015287	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHEMNIYKNFEVNWNKLIYFIIINYIINS*
Ga0182173_10206021	3300015288	Miscanthus Phyllosphere	MIFLGLNNYQKIMKFIFTLSYHVMSLHKNFELIWKKL
Ga0182173_10813681	3300015288	Miscanthus Phyllosphere	MIFIGLFIYPKIMKIVLPVSYHVMNLYKIFEVNWNKLIYFII
Ga0182141_10229251	3300015292	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHVMNLYKNFEINWNKLIYFIIIN*
Ga0182141_10671501	3300015292	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLSYHVMNIYKNFEVNWNKLIYFI
Ga0182175_10546281	3300015295	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVFTLSYHVMSLHKKFELIWKKLIY
Ga0182157_10725311	3300015296	Miscanthus Phyllosphere	MIFLGLFMYPKIMKIVLSLSYHVMNIYKNFEANWI
Ga0182106_10473682	3300015298	Miscanthus Phyllosphere	SMIFLGLINYPKIMKIVLPLSYHVMNIYKKFAQLE
Ga0182107_10131602	3300015299	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHVMNLYKNFELNWRKLIYFMIFN*
Ga0182107_10402691	3300015299	Miscanthus Phyllosphere	MIFLGLFLYPKIMKLVLSLIYHEMSIYKNFEVKWNKLIYFLIFN
Ga0182107_10959461	3300015299	Miscanthus Phyllosphere	MIFLGLFMYPKIMKIVLPLSYHVMNIYKNFEINWNKL
Ga0182143_10840841	3300015302	Miscanthus Phyllosphere	MIFLGLNNNPKIMKIVLPLSYHVVSLYKNFEISWKKL
Ga0182123_10058101	3300015303	Miscanthus Phyllosphere	MSFHDFLGLFMYPKIMKIVLPLSYHVMNIYKNFEVNWNKLIYFII
Ga0182123_10121171	3300015303	Miscanthus Phyllosphere	MNFRGLFIYSKIMKIVLPLSYHVMNLYKNFELNWNKLIYFII
Ga0182123_10181251	3300015303	Miscanthus Phyllosphere	MIFLGLNNYPKFMEIVFTLSYHVMSLHKNLGLIWKKLIYFIILNYLINK*
Ga0182123_10415041	3300015303	Miscanthus Phyllosphere	MIFLGCIIYPKIMKIVLPLSYNVISLHKNFELIWRKL
Ga0182123_10877961	3300015303	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHVMNLYKNFELNWNKLIYFII
Ga0182112_10280871	3300015304	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVFPLSCHVMSLHKNLELIWKKLIYFIIL
Ga0182112_10462332	3300015304	Miscanthus Phyllosphere	MIFLGLNNYPKILKIVLPLSYHVISLNKKFELIWRKLIYFISFN
Ga0182112_10572353	3300015304	Miscanthus Phyllosphere	MKIVLPLSYHVMNLYKNFDLNWNKLIYFIIFNSIIN
Ga0182112_11023171	3300015304	Miscanthus Phyllosphere	MIFLGFIIYPKIMKIVWPLSYHVISLNKNFELIWRKL
Ga0182158_10480561	3300015305	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIGFPLSYHMMSLHKNLGLI*KKIDLF
Ga0182140_10114721	3300015314	Miscanthus Phyllosphere	MIFHGLFIYPKIMKIGLPLSYHVMNLYKNFEVNWIKLIYFII
Ga0182140_10285772	3300015314	Miscanthus Phyllosphere	MIFLGLINYPKIMKIVLPLIYHVMNLYKNFELS*NKLIYFI
Ga0182140_10574182	3300015314	Miscanthus Phyllosphere	MIFLGLFLYPKIMKLVFPLSCRVMNLYKNFEVNWNKLIYFIILN
Ga0182127_10369761	3300015321	Miscanthus Phyllosphere	MIFLGLNNCPKIMKIIFPLSYHEMNIYKNFELYWNKLIYFIIFN*
Ga0182127_10698161	3300015321	Miscanthus Phyllosphere	MNFLGLFIYPKIMKIVLPLSYHEMNIYKNFGLNWNKLIYF
Ga0182110_11199361	3300015322	Miscanthus Phyllosphere	MIFLGLFMYPKIMKIVLSLSYHVMNIYKNFEDNWNKL
Ga0182187_10118812	3300015341	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLIYHVMNIYKKFDVNWN
Ga0182187_11169271	3300015341	Miscanthus Phyllosphere	MIFLGFIIYPKIMKIVLTLSYHMMSLHKNFELILKKLIY
Ga0182187_11576821	3300015341	Miscanthus Phyllosphere	MIFLGLKYYPKIMKIIFILSYHMMSLHKNLELNWRKLI
Ga0182187_11619961	3300015341	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHVMSLHKNFELIWRKLIYFII
Ga0182187_11728501	3300015341	Miscanthus Phyllosphere	MIFLGLNINPKIMKIVLPLSYHLMNIYKNFEFNWNQLI
Ga0182109_10852802	3300015342	Miscanthus Phyllosphere	MIFLGLNNYPKIMKILLTLSYHVMSLHKSFELIWRKLIYFI
Ga0182109_12204731	3300015342	Miscanthus Phyllosphere	MIFLGLINYPKIMKIVLSLSYHVMNLYKNFELNWNKLIYFIIFN
Ga0182155_10983041	3300015343	Miscanthus Phyllosphere	MIFLGLFIYPKIMKFVLPLSYHVMNIYKNFELNWNKLIY
Ga0182155_11481952	3300015343	Miscanthus Phyllosphere	MIFLGFIIYPKIMKIVLPLSYHVMNLYKNFELNWNKLI
Ga0182189_10607121	3300015344	Miscanthus Phyllosphere	MIFLSLNNYQKIIKIVFRLSYHVMSLHKNLELI*KKL
Ga0182111_10483781	3300015345	Miscanthus Phyllosphere	MIFLGLDNYPKIMKIVFPLSYHVMSILKNLELIWKKLIYIIMLN*
Ga0182111_10682781	3300015345	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIDLPLSYHVMSLHKNFELIWRKL
Ga0182111_10918401	3300015345	Miscanthus Phyllosphere	MIFLGLFNCPKIMKIVLPLSYHVMNIHKNFEVNWNKLI
Ga0182111_11075711	3300015345	Miscanthus Phyllosphere	MIFIGLNNYPKIMKIVLPLSYHVMNLYKNFELNWNKLIYFII
Ga0182111_11196941	3300015345	Miscanthus Phyllosphere	MIFLGLNNYPKIVKIVLSLSYHGMNLYKNFELNWKKLIYFIIF
Ga0182111_12162391	3300015345	Miscanthus Phyllosphere	VSMIFLGLNNYPKIMKIVLPLSYDMMSLHKNFELIWKKLIYFIILN*
Ga0182111_12271131	3300015345	Miscanthus Phyllosphere	MIFLGFIIYPKIMKIVLTLSYQVISLHKNFELIWRKLIYF
Ga0182139_11838411	3300015346	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHVMSLHKTFELIWRKLIY
Ga0182139_12015161	3300015346	Miscanthus Phyllosphere	MSFYDFSSLFIYSKIMKIVLTLSYHVMNLYKNFELNWNKLIYFII
Ga0182139_12159521	3300015346	Miscanthus Phyllosphere	MIFLGLFLYTKIMKLVFPLSYHEMSIYKSFEVHWNKLIYFI
Ga0182139_12356871	3300015346	Miscanthus Phyllosphere	MIFLGLINYPKIMKIVLPLSYHVMNLYKNFELNWNKLIY
Ga0182177_11312751	3300015347	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHVMNLYKKFELNWNKLIYVIIF
Ga0182177_11907491	3300015347	Miscanthus Phyllosphere	LSMIFLGLINYPKIMKIVLPLSYHVMNMYKNFELS*
Ga0182161_10476912	3300015351	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLSYHVMNIYKNFEVNWN
Ga0182161_11003791	3300015351	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLSYHVMNMYKNFEVNWNKFIYF
Ga0182161_12039021	3300015351	Miscanthus Phyllosphere	MIFLGLNNYPKIMNIVFPLSYDLMSVHKNLKIIWKKLIYFIIFN
Ga0182159_10827052	3300015355	Miscanthus Phyllosphere	MIFIGLNNYPKIMKIILPLSYHVMNLYKNFELNWNK
Ga0182159_11717973	3300015355	Miscanthus Phyllosphere	MIFLGLYNYPKIMKIVFTLSYHVMSLQKKFELIWKKLIYF
Ga0182159_11852002	3300015355	Miscanthus Phyllosphere	MGFHVFLGLSNYPKIMKIVFPLSYHVMSIPKNLELIW
Ga0182159_12427871	3300015355	Miscanthus Phyllosphere	MIFLGLFLYPKIMKLVLSLIYHEMSIYKNFEVKWNKLIYFLI
Ga0182159_13453871	3300015355	Miscanthus Phyllosphere	MIFLGLINYPKIMKIVLPLSYHVMNLYKNFELNWNKL
Ga0182145_11100421	3300015361	Miscanthus Phyllosphere	MWDSMIFLSLNNYQKIIKIVFRLSYHVMSLHKNLELIWKKFI
Ga0182203_10461521	3300017404	Miscanthus Phyllosphere	MIFLGLYNYPKLMKIVFTLSYHVMSLHKNFELNWTKLIYFII
Ga0182203_11085621	3300017404	Miscanthus Phyllosphere	YPKIMKIVLSLSYHVMNIYKNFELNWNELIYFIIFN
Ga0182203_11614931	3300017404	Miscanthus Phyllosphere	MIFLGLFIYPKIMKKFLPLSYHEINIYKNFGLNWNKLIYFI
Ga0182220_10153801	3300017407	Miscanthus Phyllosphere	MIFLGLSNYPKIMKIIFPLSYHVLSLHKNIELIWKKLIYFIILN
Ga0182207_10481001	3300017410	Miscanthus Phyllosphere	MNFLGLFIYPKIMKIVLLLSYHVMNNYKNFELNWNELIYFII
Ga0182208_10193842	3300017411	Miscanthus Phyllosphere	MIFLGLFIYQKIMRLVLPLSYHVMNIYKKFEVNWNKLIYFI
Ga0182208_11073061	3300017411	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLSYHVMNIYNNFEVNWNKLIY
Ga0182222_10148251	3300017413	Miscanthus Phyllosphere	MIFLGLFIYPKIMKIVLPLSCHVMNLYKNFELNWNKLIYFIIF
Ga0182202_10843991	3300017415	Miscanthus Phyllosphere	MIFLGLYNYPKIMKIVLPLNYHVMNLHKNFVLIWRKL
Ga0182219_10623051	3300017424	Miscanthus Phyllosphere	VIFLGLNNYPKIMKIVLPLSYHMMSLHTIFELIWKKLI
Ga0182192_10150041	3300017430	Miscanthus Phyllosphere	MIFLGLFMYPKIMKIVLSLSYHVMNIYKNFELNWNKLIYFIIFN
Ga0182192_10994521	3300017430	Miscanthus Phyllosphere	MIFLGFIIYPKIMKIVLPLSYHVISLHKNFELIWRKLIYFI
Ga0182192_11522871	3300017430	Miscanthus Phyllosphere	MIFLGLNNYPTIMKIVFTLSYHVMSLHKNFELIWKKL
Ga0182206_11008811	3300017433	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHMISIHKNFELNWKKFIYF
Ga0182206_11326782	3300017433	Miscanthus Phyllosphere	MIFLGLFICPKIMKIVLPLSYHEVNMYKSFGLIWDKLNYLIIL
Ga0182191_10662981	3300017438	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHVMNHYKNVELNWNKLIYFI
Ga0182191_10819792	3300017438	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVLPLSYHVMNLYKNFELNWNMLIYFIILN
Ga0182193_10026554	3300017443	Miscanthus Phyllosphere	MIFLGLINYPKIMKIVLPLSYHVMNIYKNFEPNWNKLIYFII
Ga0182193_10268121	3300017443	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVFTLSYHVMSLHKKFELIWKKLIYFIILN
Ga0182193_11416591	3300017443	Miscanthus Phyllosphere	MIFLGLNNYPKIMKIVSTLSYHGMSLHKNFELIWRKLI
Ga0182218_10589851	3300017683	Miscanthus Phyllosphere	MIFLVLFIYPKIMKIVLPLSYHVMNIYKNFELNWNKLI
Ga0182227_10689122	3300017685	Miscanthus Phyllosphere	MIFLDLINYPKIMKIVLPLSYHVMNIYKNFELNWNKSIYFI
Ga0182227_10709602	3300017685	Miscanthus Phyllosphere	MIFLGLNIYAQIMKIVLPLSYHVMSLHKNFERVWQKLIYFIIL
Ga0182227_10849921	3300017685	Miscanthus Phyllosphere	MIFLGLFMYQKIMKIVLPLSYHEMNIYKNFELNWNKL
Ga0182205_10862831	3300017686	Miscanthus Phyllosphere	MIFLGLNNYPKIIKIVLPLSYHVMNLYKNFELNWNKLIYFII
Ga0182223_10873551	3300017690	Miscanthus Phyllosphere	MIFLGLNNYQKIMKTVLPLSYHVMNLYKNFELNWRKLIYFIIFN
Ga0182232_10028024	3300021060	Phyllosphere	MYPKIMKIVLSLSYHVMNIYKNFELNWNKLIYFIIFN
Ga0207689_100356788	3300025942	Miscanthus Rhizosphere	MIFLGLFMYPKIMKIVLPLSYLVMNIYKNFELNWNKF
Ga0207677_113701461	3300026023	Miscanthus Rhizosphere	MIFLGLNNYPKIMKIVLPLSYHMMSLHKNLELIWKKLIYFII
Ga0207648_105359482	3300026089	Miscanthus Rhizosphere	MIFLGLNNYPKIMKIVLPLSYHGMNLYKNFELNWNRLIYFI

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F066873

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign