Basic Information | |
---|---|
Family ID | F066950 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 126 |
Average Sequence Length | 44 residues |
Representative Sequence | TTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSGL |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 126 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.94 % |
% of genes near scaffold ends (potentially truncated) | 92.06 % |
% of genes from short scaffolds (< 2000 bps) | 93.65 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.69 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.698 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.952 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.571 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (35.714 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.69 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 126 Family Scaffolds |
---|---|---|
PF13280 | WYL | 4.76 |
PF03588 | Leu_Phe_trans | 4.76 |
PF13460 | NAD_binding_10 | 3.17 |
PF13207 | AAA_17 | 2.38 |
PF08818 | DUF1801 | 2.38 |
PF08327 | AHSA1 | 2.38 |
PF01548 | DEDD_Tnp_IS110 | 2.38 |
PF00903 | Glyoxalase | 1.59 |
PF08448 | PAS_4 | 1.59 |
PF13787 | HXXEE | 1.59 |
PF00296 | Bac_luciferase | 1.59 |
PF11716 | MDMPI_N | 1.59 |
PF04607 | RelA_SpoT | 0.79 |
PF00196 | GerE | 0.79 |
PF13458 | Peripla_BP_6 | 0.79 |
PF12802 | MarR_2 | 0.79 |
PF01042 | Ribonuc_L-PSP | 0.79 |
PF00440 | TetR_N | 0.79 |
PF00766 | ETF_alpha | 0.79 |
PF02371 | Transposase_20 | 0.79 |
PF04191 | PEMT | 0.79 |
PF13581 | HATPase_c_2 | 0.79 |
PF04978 | DUF664 | 0.79 |
PF04266 | ASCH | 0.79 |
PF01638 | HxlR | 0.79 |
PF04672 | Methyltransf_19 | 0.79 |
PF09995 | MPAB_Lcp_cat | 0.79 |
PF13751 | DDE_Tnp_1_6 | 0.79 |
PF01799 | Fer2_2 | 0.79 |
PF02738 | MoCoBD_1 | 0.79 |
PF02687 | FtsX | 0.79 |
PF07883 | Cupin_2 | 0.79 |
PF04402 | SIMPL | 0.79 |
PF04185 | Phosphoesterase | 0.79 |
PF01370 | Epimerase | 0.79 |
PF12833 | HTH_18 | 0.79 |
COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
---|---|---|---|
COG2360 | Leu/Phe-tRNA-protein transferase | Posttranslational modification, protein turnover, chaperones [O] | 4.76 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.17 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 2.38 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 2.38 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 2.38 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.59 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.79 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.79 |
COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.79 |
COG2411 | Predicted RNA-binding protein, contains PUA-like ASCH domain | General function prediction only [R] | 0.79 |
COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.79 |
COG3097 | Uncharacterized conserved protein YqfB, UPF0267 family | Function unknown [S] | 0.79 |
COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.79 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
COG4405 | Predicted RNA-binding protein YhfF, contains PUA-like ASCH domain | General function prediction only [R] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 62.70 % |
Unclassified | root | N/A | 37.30 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908016|OU_2_1_1_newblercontig00634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1742 | Open in IMG/M |
2166559006|FI_contig26644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 582 | Open in IMG/M |
3300001356|JGI12269J14319_10009596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7958 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101590429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
3300005177|Ga0066690_10181584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1395 | Open in IMG/M |
3300005179|Ga0066684_10897599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
3300005329|Ga0070683_102230884 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300005334|Ga0068869_101898559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
3300005337|Ga0070682_100541259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 909 | Open in IMG/M |
3300005435|Ga0070714_100428199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1254 | Open in IMG/M |
3300005436|Ga0070713_100264378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1573 | Open in IMG/M |
3300005439|Ga0070711_101217604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
3300005439|Ga0070711_101563946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
3300005455|Ga0070663_100074535 | All Organisms → cellular organisms → Bacteria | 2478 | Open in IMG/M |
3300005537|Ga0070730_10910550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 551 | Open in IMG/M |
3300005602|Ga0070762_11157659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia | 534 | Open in IMG/M |
3300005718|Ga0068866_10496583 | Not Available | 807 | Open in IMG/M |
3300005764|Ga0066903_100582419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1932 | Open in IMG/M |
3300005764|Ga0066903_101467867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1285 | Open in IMG/M |
3300006028|Ga0070717_11098180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 724 | Open in IMG/M |
3300006028|Ga0070717_11249924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 675 | Open in IMG/M |
3300006176|Ga0070765_100419628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1251 | Open in IMG/M |
3300009683|Ga0116224_10403595 | Not Available | 650 | Open in IMG/M |
3300010048|Ga0126373_10738624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1044 | Open in IMG/M |
3300010048|Ga0126373_12044428 | Not Available | 635 | Open in IMG/M |
3300010048|Ga0126373_12640391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 560 | Open in IMG/M |
3300010329|Ga0134111_10213907 | Not Available | 782 | Open in IMG/M |
3300010360|Ga0126372_11961545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 631 | Open in IMG/M |
3300010366|Ga0126379_10499277 | Not Available | 1288 | Open in IMG/M |
3300010366|Ga0126379_11299205 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300010366|Ga0126379_11581196 | Not Available | 761 | Open in IMG/M |
3300010396|Ga0134126_12195909 | Not Available | 602 | Open in IMG/M |
3300010396|Ga0134126_12619103 | Not Available | 548 | Open in IMG/M |
3300010400|Ga0134122_10700453 | Not Available | 952 | Open in IMG/M |
3300012199|Ga0137383_10576707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Leekyejoonella → Leekyejoonella antrihumi | 823 | Open in IMG/M |
3300012207|Ga0137381_11170716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
3300012210|Ga0137378_11061823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Leekyejoonella → Leekyejoonella antrihumi | 724 | Open in IMG/M |
3300012349|Ga0137387_10694104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300012356|Ga0137371_11430160 | Not Available | 506 | Open in IMG/M |
3300012987|Ga0164307_10369056 | Not Available | 1048 | Open in IMG/M |
3300013306|Ga0163162_11256798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
3300013307|Ga0157372_11497609 | Not Available | 777 | Open in IMG/M |
3300015359|Ga0134085_10457602 | Not Available | 579 | Open in IMG/M |
3300015373|Ga0132257_101889032 | Not Available | 768 | Open in IMG/M |
3300016294|Ga0182041_10939236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 779 | Open in IMG/M |
3300016357|Ga0182032_11572706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 572 | Open in IMG/M |
3300017924|Ga0187820_1058279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1055 | Open in IMG/M |
3300017933|Ga0187801_10407349 | Not Available | 566 | Open in IMG/M |
3300017937|Ga0187809_10144541 | Not Available | 820 | Open in IMG/M |
3300017966|Ga0187776_10962587 | Not Available | 624 | Open in IMG/M |
3300017972|Ga0187781_10228503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium aerolatum | 1315 | Open in IMG/M |
3300017973|Ga0187780_10992323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 612 | Open in IMG/M |
3300018007|Ga0187805_10056482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1764 | Open in IMG/M |
3300020069|Ga0197907_11353825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Ornithinimicrobiaceae → Ornithinimicrobium → unclassified Ornithinimicrobium → Ornithinimicrobium sp. CNJ-824 | 692 | Open in IMG/M |
3300020070|Ga0206356_11483307 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
3300020070|Ga0206356_11885623 | Not Available | 1196 | Open in IMG/M |
3300020082|Ga0206353_10851390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
3300020580|Ga0210403_11286875 | Not Available | 559 | Open in IMG/M |
3300021178|Ga0210408_10641048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura formosensis | 839 | Open in IMG/M |
3300021180|Ga0210396_10584975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 972 | Open in IMG/M |
3300021403|Ga0210397_10298921 | Not Available | 1182 | Open in IMG/M |
3300021404|Ga0210389_11550683 | Not Available | 503 | Open in IMG/M |
3300021406|Ga0210386_10567597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium haemophilum | 980 | Open in IMG/M |
3300021445|Ga0182009_10579687 | Not Available | 599 | Open in IMG/M |
3300021560|Ga0126371_13186686 | Not Available | 555 | Open in IMG/M |
3300024181|Ga0247693_1025042 | Not Available | 809 | Open in IMG/M |
3300025906|Ga0207699_11241518 | Not Available | 552 | Open in IMG/M |
3300025908|Ga0207643_10580199 | Not Available | 721 | Open in IMG/M |
3300025912|Ga0207707_11124097 | Not Available | 639 | Open in IMG/M |
3300025916|Ga0207663_11701031 | Not Available | 507 | Open in IMG/M |
3300025919|Ga0207657_10174115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1742 | Open in IMG/M |
3300025928|Ga0207700_12020790 | Not Available | 503 | Open in IMG/M |
3300025929|Ga0207664_10569549 | Not Available | 1017 | Open in IMG/M |
3300025932|Ga0207690_11165166 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300025934|Ga0207686_10057083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2456 | Open in IMG/M |
3300026035|Ga0207703_11708998 | Not Available | 605 | Open in IMG/M |
3300026088|Ga0207641_12054099 | Not Available | 572 | Open in IMG/M |
3300026374|Ga0257146_1067904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 579 | Open in IMG/M |
3300026557|Ga0179587_10168813 | Not Available | 1372 | Open in IMG/M |
3300027905|Ga0209415_10287872 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300028872|Ga0307314_10036152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1194 | Open in IMG/M |
3300028906|Ga0308309_10354589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1251 | Open in IMG/M |
3300031152|Ga0307501_10029830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1107 | Open in IMG/M |
3300031544|Ga0318534_10648270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
3300031572|Ga0318515_10672081 | Not Available | 549 | Open in IMG/M |
3300031573|Ga0310915_10408146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
3300031640|Ga0318555_10180602 | Not Available | 1135 | Open in IMG/M |
3300031681|Ga0318572_10739490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
3300031682|Ga0318560_10152581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1223 | Open in IMG/M |
3300031708|Ga0310686_104455914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2104 | Open in IMG/M |
3300031713|Ga0318496_10168842 | Not Available | 1198 | Open in IMG/M |
3300031713|Ga0318496_10599644 | Not Available | 608 | Open in IMG/M |
3300031747|Ga0318502_10413659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 803 | Open in IMG/M |
3300031765|Ga0318554_10844357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces puniciscabiei | 511 | Open in IMG/M |
3300031771|Ga0318546_10823298 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300031792|Ga0318529_10448491 | Not Available | 600 | Open in IMG/M |
3300031795|Ga0318557_10472683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 576 | Open in IMG/M |
3300031797|Ga0318550_10279072 | Not Available | 811 | Open in IMG/M |
3300031799|Ga0318565_10077327 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300031819|Ga0318568_10787382 | Not Available | 590 | Open in IMG/M |
3300031832|Ga0318499_10199537 | Not Available | 780 | Open in IMG/M |
3300031845|Ga0318511_10020332 | All Organisms → cellular organisms → Bacteria | 2420 | Open in IMG/M |
3300031880|Ga0318544_10113914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1025 | Open in IMG/M |
3300031893|Ga0318536_10393809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 699 | Open in IMG/M |
3300031894|Ga0318522_10029081 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
3300031894|Ga0318522_10151830 | Not Available | 873 | Open in IMG/M |
3300031896|Ga0318551_10485908 | Not Available | 707 | Open in IMG/M |
3300031897|Ga0318520_10487524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 760 | Open in IMG/M |
3300031938|Ga0308175_101625015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
3300031942|Ga0310916_11140297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 646 | Open in IMG/M |
3300031947|Ga0310909_10256871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha | 1460 | Open in IMG/M |
3300031954|Ga0306926_10761029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1170 | Open in IMG/M |
3300032066|Ga0318514_10111279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1397 | Open in IMG/M |
3300032068|Ga0318553_10296368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 846 | Open in IMG/M |
3300032089|Ga0318525_10656102 | Not Available | 534 | Open in IMG/M |
3300032090|Ga0318518_10722838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 506 | Open in IMG/M |
3300032261|Ga0306920_102197094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
3300032261|Ga0306920_103334159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 598 | Open in IMG/M |
3300032783|Ga0335079_11323041 | Not Available | 719 | Open in IMG/M |
3300032893|Ga0335069_10051394 | All Organisms → cellular organisms → Bacteria | 5406 | Open in IMG/M |
3300032896|Ga0335075_10018797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 10241 | Open in IMG/M |
3300032896|Ga0335075_10955151 | Not Available | 776 | Open in IMG/M |
3300032897|Ga0335071_10671905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 986 | Open in IMG/M |
3300033134|Ga0335073_11354581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
3300033158|Ga0335077_10536909 | Not Available | 1231 | Open in IMG/M |
3300033289|Ga0310914_10117192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2312 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.35% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.35% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.56% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.97% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.17% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.38% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.38% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.38% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.38% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.38% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.59% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.59% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.79% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.79% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.79% | |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_02459970 | 2124908016 | MPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL | |
FI_00458330 | 2166559006 | Grass Soil | PTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIIGAL |
JGI12269J14319_100095962 | 3300001356 | Peatlands Soil | MANTGIGSPDQIRSDLSARLDRFGLSYLVAGEDSLPGLAEIVGGL* |
JGIcombinedJ26739_1015904292 | 3300002245 | Forest Soil | TIYIGSPDQIRADLQARRQRFGLSYLVVGEDGLPALAEIVSGL* |
Ga0066690_101815843 | 3300005177 | Soil | FIGSPAQIRDDLIARRARFGLSYLVASESNLPALAEVVSAL* |
Ga0066684_108975992 | 3300005179 | Soil | FIGSPAQIRDDLIARRARFGLSYLVAGEGALPALAAVTGAL* |
Ga0070683_1022308842 | 3300005329 | Corn Rhizosphere | TAWQMPTVFIGSAAQIREDLHARRERFGLSYLVAAEDARPALTEIISGL* |
Ga0068869_1018985591 | 3300005334 | Miscanthus Rhizosphere | TVWQMPTIFVGSAEQIRHDLRDRQERHGLSYLIGSDRDLATLTDIISGL* |
Ga0070682_1005412591 | 3300005337 | Corn Rhizosphere | TTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL* |
Ga0070714_1004281991 | 3300005435 | Agricultural Soil | IGSAAQIREDLHARRERFGLSYLVAAEDARPALTEIISGL* |
Ga0070713_1002643783 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ETAWQMPTIFIGSAAQIREDLHARRERFGLSYLVAPETARPALTEIISGL* |
Ga0070711_1012176042 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FIGSPAQIRDDLIARRARFGLSYLVASESALPALAAVTGAL* |
Ga0070711_1015639461 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | WTGISAEQVWQMPTVFVGSPDQIRADLRERRQRFGLSYLVAGEDSRGALAEVISGL* |
Ga0070663_1000745351 | 3300005455 | Corn Rhizosphere | IDAETVWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL* |
Ga0070730_109105502 | 3300005537 | Surface Soil | VWQMPTIFIGSPEQIRADLSARRDRFGLSYLVVGEDGWPALAEIVSGL* |
Ga0070762_111576591 | 3300005602 | Soil | QIRLDLLARRERFGLSYLVVGEDSQPALAEIISGL* |
Ga0068866_104965831 | 3300005718 | Miscanthus Rhizosphere | AQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL* |
Ga0066903_1005824191 | 3300005764 | Tropical Forest Soil | AVWQMPTIFIGSLDQIRADLLARRERFGLSYLVVGEGEQPALAEIISGL* |
Ga0066903_1014678673 | 3300005764 | Tropical Forest Soil | GIDVEAVWQMPTIFIGSLGQIRADLRARRERFGLSYLVVGEDGLPSLAEIVSGL* |
Ga0070717_110981801 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QIREDLHARRERFGLSYLVAAEDARPALTEIISGL* |
Ga0070717_112499242 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | WQMPTIFIGSAAQIREDLHARRERFGLSYLVAPETARPALTEIISGL* |
Ga0070765_1004196283 | 3300006176 | Soil | WQMPTIFIGSAEQIRSDLQQRQQRYGLSYLVAGEDALPVLAEIASGL* |
Ga0116224_104035952 | 3300009683 | Peatlands Soil | WQMPTIFIGSLDQIRSDLQERQQRFGLSYLVAGEDGLPVLAEIASGL* |
Ga0126373_107386241 | 3300010048 | Tropical Forest Soil | DAEEVWQMPTIFIGSLDQIRADLQARRERFGLSYLVVGEEGLPVLTEIISGL* |
Ga0126373_120444282 | 3300010048 | Tropical Forest Soil | EQIRSDLQERRERFGLSYLVVGEDSLPTLTEIITGL* |
Ga0126373_126403911 | 3300010048 | Tropical Forest Soil | PEQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL* |
Ga0134111_102139072 | 3300010329 | Grasslands Soil | DAETVWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAENALPALAEIIGAL* |
Ga0126372_119615452 | 3300010360 | Tropical Forest Soil | IFIGSPQQIRSDLRARQDRFGLSYLVAGENDLPTLAAIVSVL* |
Ga0126379_104992774 | 3300010366 | Tropical Forest Soil | FIGSLDQIRADLLARRERFSLSYLVVGEDGLPALAEIVSGL* |
Ga0126379_112992051 | 3300010366 | Tropical Forest Soil | TIFIGSPDQIRADLHARRERFGLSYLVAGEDNLPALAEIIGGL* |
Ga0126379_115811962 | 3300010366 | Tropical Forest Soil | IRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL* |
Ga0134126_121959091 | 3300010396 | Terrestrial Soil | AETVWQMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAL* |
Ga0134126_126191031 | 3300010396 | Terrestrial Soil | SPAQIRDDLIARRARFGLSYLVAPESALPALADIISAL* |
Ga0134122_107004533 | 3300010400 | Terrestrial Soil | AQIRDDLLARRARFGLSYLVAAEDALPALAEIVGVR* |
Ga0137383_105767071 | 3300012199 | Vadose Zone Soil | QIRADLRARRERFGLSYLVAGEEALAALAEIVSGL* |
Ga0137381_111707162 | 3300012207 | Vadose Zone Soil | DPETVWEMPVIFIGSPAQIRDDLIARRARFGLSYLVASESTLPALAEIVSAL* |
Ga0137378_110618231 | 3300012210 | Vadose Zone Soil | WTGVDVEAVWQMPTMFIGSLDQIRADLRARRERFGLSYLVAGEEALAALAEIVSGL* |
Ga0137387_106941041 | 3300012349 | Vadose Zone Soil | VWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALSEIIGAL* |
Ga0137371_114301601 | 3300012356 | Vadose Zone Soil | VFIGSPAQIREDLLARRARFGLSYLVAAESALPALADVVGVL* |
Ga0164307_103690561 | 3300012987 | Soil | GSPAQIRDDLLARRARFGLSYLVAAENALPALAEIVGAL* |
Ga0163162_112567981 | 3300013306 | Switchgrass Rhizosphere | AETVWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAL* |
Ga0157372_114976092 | 3300013307 | Corn Rhizosphere | WEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL* |
Ga0134085_104576021 | 3300015359 | Grasslands Soil | IHEDLLTRRARFGLSYLVAAESALPALSEVIGAL* |
Ga0132257_1018890322 | 3300015373 | Arabidopsis Rhizosphere | GSPAQIRDDLLARRARFGLSYLVAAESALPALGEIVGAL* |
Ga0182041_109392361 | 3300016294 | Soil | MPTIFIGSLEQIRSDLQARRERFGLSYLVVGEDGLPALAEIVSGL |
Ga0182032_115727061 | 3300016357 | Soil | VETVWQMPTIFIGSPQQIRSDLRARQERFGLSYLVVGENDLPAIAEIVSDL |
Ga0187820_10582791 | 3300017924 | Freshwater Sediment | VWQLPTIFIGSAEQIRSDLLERRDRSGLSYRVAGDSALPALAEIAGGL |
Ga0187801_104073492 | 3300017933 | Freshwater Sediment | WQMPTIFIGSAAQIRADLRERREIFGLSYLVAGEAALPALAEIASGL |
Ga0187809_101445411 | 3300017937 | Freshwater Sediment | MPTIFIGSTEQIRSDLLERRDRCGLSYLVAGAGALPALAEIASGL |
Ga0187776_109625872 | 3300017966 | Tropical Peatland | MADADDLHRSPDQIRSDLQDRHQRFGLSYLVAGEDALPMLAEIASGL |
Ga0187781_102285031 | 3300017972 | Tropical Peatland | SPDQIRSDLHVRRDRFGLSYLVAGEDNLPALAEIVSGL |
Ga0187780_109923231 | 3300017973 | Tropical Peatland | VEALWQMPTVFIGSLDQIRSDLQARRERFGLSYLVAGEDNLPALAEIVSGL |
Ga0187805_100564824 | 3300018007 | Freshwater Sediment | TIFIGSAAQIRADLRERREIFGLSYLVAGEAALPALAEIASGL |
Ga0197907_113538252 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VWQMPTIFIGSPDQVRSDLQERRERFGLSYLVAGEDSLPVLAEVIRGL |
Ga0206356_114833073 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | GTPDQIRADLRARQERFGLSYLVAGQDALPALTSIISGL |
Ga0206356_118856231 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | IGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL |
Ga0206353_108513902 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | DAVWEMPTIFIGTPDQIRADLRARQERFGLSYLVAGQDALPALTSIISGL |
Ga0210403_112868752 | 3300020580 | Soil | GSPAQIRDDLLARRARFGLSYLVAAESALPALTKIVSAL |
Ga0210408_106410482 | 3300021178 | Soil | SPAQIRDDLIARRARFGLSYLVASESSLPALAEVVSAL |
Ga0210396_105849752 | 3300021180 | Soil | SPAQIRDDLLARRARFGLSYLVAAESALPALTKIVSAL |
Ga0210397_102989211 | 3300021403 | Soil | AETVWEMPTIFIGSPAQIRDDLLARRARFGLSYLVAGESALPALTEIVSAL |
Ga0210389_115506832 | 3300021404 | Soil | TPPVFIGSPAQIRDDLLARRPRFGLSYLVAPESALPALADIVSAL |
Ga0210386_105675973 | 3300021406 | Soil | IFIGSPEQIRTDLQARLERFGLSYLVAGEDVRPALAEIIGGLKKDI |
Ga0182009_105796871 | 3300021445 | Soil | TTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSGL |
Ga0126371_131866861 | 3300021560 | Tropical Forest Soil | SLDQIRADLLARRERFCLSYLVVGEDGLPALAEIVSGL |
Ga0247693_10250422 | 3300024181 | Soil | TTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL |
Ga0207699_112415182 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GIDAEAAWQMPTIFIGSAAQIREDLHARRERFGLSYLVAAESARPALTEIISGL |
Ga0207643_105801991 | 3300025908 | Miscanthus Rhizosphere | FIGSPAQIRDDLLARRARFGLSYLVAAEDALPALAEIVGAL |
Ga0207707_111240971 | 3300025912 | Corn Rhizosphere | TFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL |
Ga0207663_117010312 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VCSPAQIRDDLIARRARFGLSYLVAGESALPALAAVTGAL |
Ga0207657_101741153 | 3300025919 | Corn Rhizosphere | IDVEQVWQMPTVFIGSPDQIRADLHARRERFGLSYLVAGEDSQPALAEVISGL |
Ga0207700_120207901 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DAETAWQMPTIFIGSAAQIREDLHARRERFGLSYLVAAETARPALTEIISGL |
Ga0207664_105695493 | 3300025929 | Agricultural Soil | FIGSAAQIREDLHARRERFGLSYLVAAEDARPALTEIISGL |
Ga0207690_111651661 | 3300025932 | Corn Rhizosphere | EQVWQMPTVFIGSPDQIRADLHARRERFGLSYLVAGEDSQSALAEVISGL |
Ga0207686_100570835 | 3300025934 | Miscanthus Rhizosphere | MPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAL |
Ga0207703_117089981 | 3300026035 | Switchgrass Rhizosphere | TSFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL |
Ga0207641_120540992 | 3300026088 | Switchgrass Rhizosphere | SPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL |
Ga0257146_10679042 | 3300026374 | Soil | VWQMPTVFIGSPAQIRDDLLARRARFGLSYLVAAESALPALADIVSAL |
Ga0179587_101688132 | 3300026557 | Vadose Zone Soil | AWQMPTVFIGSPAQIRDDLLARRARFGLSYLVAAESALPALADIVGAL |
Ga0209415_102878722 | 3300027905 | Peatlands Soil | MANTGIGSPDQIRSDLSARLDRFGLSYLVAGEDSLPGLAEIVGGL |
Ga0307314_100361523 | 3300028872 | Soil | AETVWQMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAL |
Ga0308309_103545891 | 3300028906 | Soil | GSAEQIRSDLQQRQQRYGLSYLVAGEDALPVLAEIASGL |
Ga0307501_100298301 | 3300031152 | Soil | WEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIIGAL |
Ga0318534_106482701 | 3300031544 | Soil | VWQMPTIFIGSPDQIRSDLHARRERSGLSYLVAGQDNLPALAEIAGGL |
Ga0318515_106720811 | 3300031572 | Soil | FIGSPAQIRDDLRARRDRFGLSYLVVGEDTLPALTGIVGAL |
Ga0310915_104081463 | 3300031573 | Soil | ETVWEMPTIFIGSPAQIRDDLMARRARFGLSYLVASESALPALAEIVSAL |
Ga0318555_101806023 | 3300031640 | Soil | PTIFIGSPAQIRDDLMARRARFGLSYLVAGESALPALAKIVSAL |
Ga0318572_107394901 | 3300031681 | Soil | LDVEAVWQMPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALAEIIGGL |
Ga0318560_101525812 | 3300031682 | Soil | IFIGSPDQIRSDLHARRERFGLSYLVAGEGNLPALAEIAGGL |
Ga0310686_1044559144 | 3300031708 | Soil | MANTGIGTPDQIRSDLSARLDRFGLSYLVAGEDSLPGLAEIVGGL |
Ga0318496_101688421 | 3300031713 | Soil | VWEMPTIFIGSLAQIRDDLMARRARFGLSYLVAGESALPALAEIVSAL |
Ga0318496_105996441 | 3300031713 | Soil | TIFIGSPAQIRDDLMARRARFGLSYLVASESALPALTQVVSAL |
Ga0318502_104136591 | 3300031747 | Soil | AETVWQMPTIFIGSPGQIRDDLRARAQRFGLSYLVAPDRDLPTLATIISGL |
Ga0318554_108443572 | 3300031765 | Soil | VEAVWQMPTIFIGSPEQIRSDLRARRERFGLSYLVVGEDGLPALTEIVGGL |
Ga0318546_108232982 | 3300031771 | Soil | IWQMPTIFIGSPDQIRSDLHARRERFGLSYLVAGEGNLPALAEIAGGL |
Ga0318529_104484911 | 3300031792 | Soil | AQIRDDLMARRARFGLSYLVAGESALPALAKIVNAL |
Ga0318557_104726831 | 3300031795 | Soil | MPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALAEIISGL |
Ga0318550_102790722 | 3300031797 | Soil | VWQMPTIFVGSLEQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL |
Ga0318565_100773273 | 3300031799 | Soil | MPTMFIGSPAQIRDDLMARRARFGLSYLVAGESALPALAKIVNAL |
Ga0318568_107873821 | 3300031819 | Soil | VWQMPTIFIGSPQQIRSDLRARQERFGLSYLVAGENDLPTLAEIVIDL |
Ga0318499_101995373 | 3300031832 | Soil | IFIGSPAQIRDDLMARRARFGLSYLVASESALPALAEIVSAL |
Ga0318511_100203324 | 3300031845 | Soil | MPTIFIGSPAQIRDDLMARRARFGLSYLVASESALPALAEIVSAL |
Ga0318544_101139141 | 3300031880 | Soil | FVGSLEQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL |
Ga0318536_103938091 | 3300031893 | Soil | AVWQMPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALPEIIGGL |
Ga0318522_100290811 | 3300031894 | Soil | QMPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALAEIISGL |
Ga0318522_101518301 | 3300031894 | Soil | QIRDDLMARRARFGLSYLVASESALPALAEIVSAL |
Ga0318551_104859082 | 3300031896 | Soil | EQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL |
Ga0318520_104875243 | 3300031897 | Soil | VWQMPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALAEIVGGL |
Ga0308175_1016250151 | 3300031938 | Soil | DAETVWQMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAF |
Ga0310916_111402972 | 3300031942 | Soil | IDVETVWQMPTIFIGSPQQIRSDLRARQERFGLSYLVVGENDLPAIAEIVSDL |
Ga0310909_102568711 | 3300031947 | Soil | MPTIFIGSLEQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL |
Ga0306926_107610291 | 3300031954 | Soil | GVDVEAIWQMPTIFIGSPDQIRSDLHARRERFGLSYLVAGEGNLPALAEIAGGL |
Ga0318514_101112792 | 3300032066 | Soil | VWQMPTIFIGSPQQIRSDLRARQERFGLSYLVVGENDLPAIAEIVSDL |
Ga0318553_102963681 | 3300032068 | Soil | DQIRSDLHARRERSGLSYLVAGQDNLPALAEIAGGL |
Ga0318525_106561021 | 3300032089 | Soil | DQIRSDLHARRERFGLSYLVAGEGNLPALAEIAGGL |
Ga0318518_107228382 | 3300032090 | Soil | PDQIRSDLQARRERFGLSYLVAGEDNLPALAEIVGGL |
Ga0306920_1021970942 | 3300032261 | Soil | EMPTIFIGSPAQIRDDLMARRARFGLSYLVAGESALPALAKIVNAL |
Ga0306920_1033341592 | 3300032261 | Soil | QIRSDLQERRQRFGLSYLVAGEDGLPALAEIVSGP |
Ga0335079_113230412 | 3300032783 | Soil | AQIRDDLLARQARFGLSYLVAGESALPALTEIVSAL |
Ga0335069_100513942 | 3300032893 | Soil | MPTIFIGSPAQIRNDLMARRARFGLSYLVAGESALPALAEIVSAL |
Ga0335075_1001879713 | 3300032896 | Soil | FIGSPDQIRADLRERQERFGLSYLVATETALPALAEIASGL |
Ga0335075_109551511 | 3300032896 | Soil | WGGIEAEAVWEMPTIFTGSPDQIRTDLHARREQSGLSYLVVGEDSQPVLAEIITGL |
Ga0335071_106719051 | 3300032897 | Soil | MPTIVIGSPAQIRNDLMARRARFGLSYLVAGESALPALAEIVSAL |
Ga0335073_113545811 | 3300033134 | Soil | EMPTIFIGSPAQIRDDLMARRARFGLSYLVVGESTLPALAEIVSAL |
Ga0335077_105369093 | 3300033158 | Soil | IFIGSPAQIRDDLMARRARFGLSYLVVGESALPALAEIVSAL |
Ga0310914_101171924 | 3300033289 | Soil | DQIRSDLQARREQFGLSYLVAGEDNLPALAEIVGGL |
⦗Top⦘ |