NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066975

Metagenome / Metatranscriptome Family F066975

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066975
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 60 residues
Representative Sequence ERKVRTPQSSVPDNVRDVGFKPDGRKVPQKTYRLGGNAGVRVKRCGKSAPPLQ
Number of Associated Samples 117
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.76 %
% of genes near scaffold ends (potentially truncated) 87.30 %
% of genes from short scaffolds (< 2000 bps) 88.89 %
Associated GOLD sequencing projects 116
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.857 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(19.048 % of family members)
Environment Ontology (ENVO) Unclassified
(26.984 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.143 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF12704MacB_PCD 3.97
PF13418Kelch_4 1.59
PF069833-dmu-9_3-mt 1.59
PF03932CutC 1.59
PF08238Sel1 0.79
PF00425Chorismate_bind 0.79
PF01292Ni_hydr_CYTB 0.79
PF00440TetR_N 0.79
PF11721Malectin 0.79
PF04542Sigma70_r2 0.79
PF14870PSII_BNR 0.79
PF13620CarboxypepD_reg 0.79
PF12698ABC2_membrane_3 0.79
PF02566OsmC 0.79
PF03544TonB_C 0.79
PF00012HSP70 0.79
PF01431Peptidase_M13 0.79
PF01850PIN 0.79
PF02405MlaE 0.79
PF13657Couple_hipA 0.79
PF09286Pro-kuma_activ 0.79
PF01872RibD_C 0.79
PF00069Pkinase 0.79
PF02687FtsX 0.79
PF04366Ysc84 0.79
PF07732Cu-oxidase_3 0.79
PF13185GAF_2 0.79
PF13506Glyco_transf_21 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.17
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 1.59
COG3142Copper homeostasis protein CutCInorganic ion transport and metabolism [P] 1.59
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 1.59
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.79
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.79
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.79
COG0767Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.79
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.79
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.79
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.79
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.79
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.79
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 0.79
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.79
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.79
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 0.79
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 0.79
COG3038Cytochrome b561Energy production and conversion [C] 0.79
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.79
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 0.79
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 0.79
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 0.79
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.86 %
UnclassifiedrootN/A7.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10214319All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300002917|JGI25616J43925_10341638All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium bullatum555Open in IMG/M
3300004114|Ga0062593_100182428All Organisms → cellular organisms → Bacteria1645Open in IMG/M
3300004121|Ga0058882_1006105All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300004152|Ga0062386_101460326All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Caedimonadaceae → Caedimonas → Caedimonas varicaedens570Open in IMG/M
3300004401|Ga0068980_1002787All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK501Open in IMG/M
3300004475|Ga0068969_1005897All Organisms → cellular organisms → Bacteria → Acidobacteria1024Open in IMG/M
3300004616|Ga0068930_1003636All Organisms → cellular organisms → Bacteria → Acidobacteria1042Open in IMG/M
3300005167|Ga0066672_10001517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter8691Open in IMG/M
3300005171|Ga0066677_10026406All Organisms → cellular organisms → Bacteria2739Open in IMG/M
3300005177|Ga0066690_10338320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1020Open in IMG/M
3300005331|Ga0070670_101169301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria703Open in IMG/M
3300005367|Ga0070667_101722610All Organisms → cellular organisms → Bacteria → Proteobacteria589Open in IMG/M
3300005437|Ga0070710_10897142All Organisms → cellular organisms → Bacteria → Proteobacteria640Open in IMG/M
3300005526|Ga0073909_10149413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia973Open in IMG/M
3300005537|Ga0070730_10000107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae104678Open in IMG/M
3300005560|Ga0066670_10734605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300005568|Ga0066703_10114160All Organisms → cellular organisms → Bacteria1600Open in IMG/M
3300005614|Ga0068856_100323100All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 831560Open in IMG/M
3300005718|Ga0068866_10385729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria900Open in IMG/M
3300005764|Ga0066903_100375535All Organisms → cellular organisms → Bacteria2319Open in IMG/M
3300005764|Ga0066903_101359624All Organisms → cellular organisms → Bacteria → Acidobacteria1331Open in IMG/M
3300005764|Ga0066903_107628680All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria557Open in IMG/M
3300005844|Ga0068862_102387069All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M
3300006050|Ga0075028_100426787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum762Open in IMG/M
3300006086|Ga0075019_10758002All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300006102|Ga0075015_100095170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1487Open in IMG/M
3300006175|Ga0070712_101212299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria656Open in IMG/M
3300006176|Ga0070765_100264686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1580Open in IMG/M
3300006640|Ga0075527_10255422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300009088|Ga0099830_11834366All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300009631|Ga0116115_1016856All Organisms → cellular organisms → Bacteria2136Open in IMG/M
3300010048|Ga0126373_13014210Not Available525Open in IMG/M
3300010122|Ga0127488_1013438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Caedimonadaceae → Caedimonas → Caedimonas varicaedens544Open in IMG/M
3300010122|Ga0127488_1063325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300010343|Ga0074044_10148831All Organisms → cellular organisms → Bacteria1567Open in IMG/M
3300010361|Ga0126378_10445060All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae1410Open in IMG/M
3300010867|Ga0126347_1093933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria507Open in IMG/M
3300011120|Ga0150983_12811908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria661Open in IMG/M
3300011120|Ga0150983_14204317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus570Open in IMG/M
3300011340|Ga0151652_12753544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Caedimonadaceae → Caedimonas → Caedimonas varicaedens514Open in IMG/M
3300012203|Ga0137399_10119322All Organisms → cellular organisms → Bacteria → Acidobacteria2069Open in IMG/M
3300012390|Ga0134054_1120469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300012469|Ga0150984_115740653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1245Open in IMG/M
3300012931|Ga0153915_10076585All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3496Open in IMG/M
3300012971|Ga0126369_11219644All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300013105|Ga0157369_10399676All Organisms → cellular organisms → Bacteria → Acidobacteria1426Open in IMG/M
3300013306|Ga0163162_10714159All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB601123Open in IMG/M
3300014497|Ga0182008_10336076All Organisms → cellular organisms → Bacteria → Proteobacteria798Open in IMG/M
3300015206|Ga0167644_1164069All Organisms → cellular organisms → Bacteria → Proteobacteria530Open in IMG/M
3300015245|Ga0137409_10175450All Organisms → cellular organisms → Bacteria1945Open in IMG/M
3300015262|Ga0182007_10219293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria671Open in IMG/M
3300015374|Ga0132255_100172068All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB603042Open in IMG/M
3300017955|Ga0187817_10124515All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300018034|Ga0187863_10275381All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300019179|Ga0184593_128156Not Available527Open in IMG/M
3300019194|Ga0184586_111981All Organisms → cellular organisms → Bacteria → Proteobacteria554Open in IMG/M
3300019251|Ga0187795_1073195All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300019273|Ga0187794_1171238All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae555Open in IMG/M
3300019275|Ga0187798_1269797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria725Open in IMG/M
3300019284|Ga0187797_1048245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria878Open in IMG/M
3300020581|Ga0210399_10242889Not Available1500Open in IMG/M
3300021401|Ga0210393_10583099All Organisms → cellular organisms → Bacteria → Proteobacteria913Open in IMG/M
3300021405|Ga0210387_10718334All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium885Open in IMG/M
3300021861|Ga0213853_11354911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus552Open in IMG/M
3300022502|Ga0242646_1004931All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK968Open in IMG/M
3300022504|Ga0242642_1098662All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300022509|Ga0242649_1049315All Organisms → cellular organisms → Bacteria → Proteobacteria588Open in IMG/M
3300022522|Ga0242659_1081216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria617Open in IMG/M
3300022528|Ga0242669_1073729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria622Open in IMG/M
3300022531|Ga0242660_1040483All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron980Open in IMG/M
3300022532|Ga0242655_10237402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria572Open in IMG/M
3300022532|Ga0242655_10249472All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria561Open in IMG/M
3300022708|Ga0242670_1043190Not Available621Open in IMG/M
3300022712|Ga0242653_1043010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria714Open in IMG/M
3300022716|Ga0242673_1097351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300022716|Ga0242673_1130213All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300022722|Ga0242657_1073907All Organisms → cellular organisms → Bacteria → Proteobacteria796Open in IMG/M
3300022724|Ga0242665_10215517All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria639Open in IMG/M
3300022726|Ga0242654_10336148Not Available565Open in IMG/M
3300022732|Ga0224569_101088All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2313Open in IMG/M
3300023536|Ga0247552_101408All Organisms → cellular organisms → Bacteria → Proteobacteria717Open in IMG/M
3300023560|Ga0247514_117201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus642Open in IMG/M
3300025912|Ga0207707_10026315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5085Open in IMG/M
3300025928|Ga0207700_11903527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria521Open in IMG/M
3300026041|Ga0207639_11208492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → unclassified Methylovirgula → Methylovirgula sp. HY1709Open in IMG/M
3300026355|Ga0257149_1046399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → Magnetospirillum magneticum → Magnetospirillum magneticum AMB-1625Open in IMG/M
3300026550|Ga0209474_10473955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300027502|Ga0209622_1080368All Organisms → cellular organisms → Bacteria → Proteobacteria597Open in IMG/M
3300027609|Ga0209221_1005160All Organisms → cellular organisms → Bacteria3305Open in IMG/M
3300027616|Ga0209106_1126869All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus572Open in IMG/M
3300027857|Ga0209166_10000096All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae116538Open in IMG/M
3300027903|Ga0209488_10573358All Organisms → cellular organisms → Bacteria → Acidobacteria821Open in IMG/M
3300028673|Ga0257175_1040164All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae837Open in IMG/M
3300028772|Ga0302209_10117528All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300029636|Ga0222749_10113678All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300030626|Ga0210291_10292512All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus527Open in IMG/M
3300030687|Ga0302309_10515607All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300030738|Ga0265462_12459736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus518Open in IMG/M
3300030761|Ga0265722_106071Not Available546Open in IMG/M
3300030834|Ga0265738_106188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Caedimonadaceae → Caedimonas → Caedimonas varicaedens522Open in IMG/M
3300030836|Ga0265767_107364Not Available699Open in IMG/M
3300030862|Ga0265753_1130439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria532Open in IMG/M
3300030885|Ga0265743_120753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300030937|Ga0138302_1142602All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum526Open in IMG/M
3300030941|Ga0265737_109850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii584Open in IMG/M
3300031016|Ga0265732_102982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Caedimonadaceae → Caedimonas → Caedimonas varicaedens603Open in IMG/M
3300031028|Ga0302180_10209249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter1044Open in IMG/M
3300031044|Ga0265747_106744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Caedimonadaceae → Caedimonas → Caedimonas varicaedens661Open in IMG/M
3300031057|Ga0170834_104896790All Organisms → cellular organisms → Bacteria2067Open in IMG/M
3300031231|Ga0170824_121554649All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Candidatus Kentron → unclassified Candidatus Kentron → Candidatus Kentron sp. DK676Open in IMG/M
3300031521|Ga0311364_10074444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3589Open in IMG/M
3300031663|Ga0307484_117643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300031823|Ga0307478_10194242All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1630Open in IMG/M
3300031826|Ga0316031_111103Not Available569Open in IMG/M
3300031826|Ga0316031_113133All Organisms → cellular organisms → Bacteria → Proteobacteria537Open in IMG/M
3300031955|Ga0316035_104291Not Available964Open in IMG/M
3300031962|Ga0307479_10335258All Organisms → cellular organisms → Bacteria → Proteobacteria1495Open in IMG/M
3300031962|Ga0307479_11195610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha3_Bin4724Open in IMG/M
3300032121|Ga0316040_106871All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus745Open in IMG/M
3300032515|Ga0348332_14093700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria513Open in IMG/M
3300032515|Ga0348332_14668711All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum506Open in IMG/M
3300032955|Ga0335076_10194412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1932Open in IMG/M
3300033004|Ga0335084_12203782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus534Open in IMG/M
3300033412|Ga0310810_11063334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria680Open in IMG/M
3300033475|Ga0310811_10304721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB601830Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.29%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.17%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.17%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.17%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland3.17%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.38%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.38%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.59%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.59%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.59%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.59%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.59%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.59%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.79%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.79%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.79%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.79%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.79%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.79%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.79%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.79%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.79%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.79%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004401Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004475Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004616Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006640Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11BEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010122Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015206Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300019179Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019194Soil microbial communities from Bohemian Forest, Czech Republic ? CSE1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019251Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019273Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022502Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022504Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022509Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022732Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1Host-AssociatedOpen in IMG/M
3300023536Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023560Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027609Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028673Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-BEnvironmentalOpen in IMG/M
3300028772Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_1EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030761Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030834Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030836Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030885Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030937Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030941Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031016Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLE4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031044Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031663Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031826Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI3 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031955Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032121Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1021431913300000567Peatlands SoilKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRPGRKAQVRVKRCGKSAPPAQ*
JGI25616J43925_1034163813300002917Grasslands SoilMPDRMIAVFARRGRKVRTPQSSVPDNVRDGGFKSVRRKVQQRIYRLVRKGGVRVKRCGKSAPLAQ*
Ga0062593_10018242813300004114SoilLIYRQPDRTAASRVFGREERKVRTPQGSVPDNVRDVRLKPDGRKVPQKRYRLGGNARVRVKRCGKSAPPRQ*
Ga0058882_100610523300004121Forest SoilRKVRTPQSSVPDNVREGGFKSARRKVPQKTYRLDGNAGVRVKRCGKSAPPRQ*
Ga0062386_10146032613300004152Bog Forest SoilERKVRTPQSSVPDNVRDVGFKPDGRKVPQKTYRLGGNAGVRVKRCGKSAPPLQ*
Ga0068980_100278713300004401Peatlands SoilRKVRTPQSSVPDNVREGGFKSARRKVPQKTYRLGGNAGVRVKRCGKSAPPRQ*
Ga0068969_100589723300004475Peatlands SoilRGERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRPVGNVEVRVKRCGKSAPPRQ*
Ga0068930_100363623300004616Peatlands SoilASSVFGRGERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRPVGNVEVRVKRCGKSAPPRQ*
Ga0066672_1000151783300005167SoilVGSWAGRSLPARERKVRTPQSSVPDNVREAGFKPVRRKVPQKTYRLGCEVRVRVKRCGKSAPPPQ*
Ga0066677_1002640613300005171SoilERKVRTPQSSVPDNVREAGFKPVRRKVPQKTYRPGGNAEVRVKRCGKSAPPPQ*
Ga0066690_1033832013300005177SoilERKVRTPQSSVPDNVREAGFKPGRRKVPQKTYRLGCKAGVRVKRCGKSAPPPQ*
Ga0070670_10116930113300005331Switchgrass RhizosphereTPQSSVPDNVRDGGFKSAGRPVPQKTYRLGGNVQVRVKRCGKSAPPRQ*
Ga0070667_10172261013300005367Switchgrass RhizosphereKVRTPQSSVPDNVRDGGFKSAGRPVPQKTYRLGGNARVRVKRCGKSAPPRQ*
Ga0070710_1089714213300005437Corn, Switchgrass And Miscanthus RhizosphereEERKVRTPQSSVPDNVRDVRFKSDGRKVPQKTYRLGGNAGVRVKRCGKSAPPSQ*
Ga0073909_1014941313300005526Surface SoilERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRLGNGVRVKRCGKSAPPRQ*
Ga0070730_10000107453300005537Surface SoilMGAVRIEYNDFRRQPDRTAAFRVFGREERKVRTPQSSVPDNVRDVRFKPGGRKVPQKTYRPGGNARVRVKRCGKSAPLSQ*
Ga0066670_1073460523300005560SoilGRKVRTPQSSVPDNVREGGFKPVRRKVPQKIYRLGREVRVRVKRCGKSAPPSQ*
Ga0066703_1011416023300005568SoilLECRQSDRTAASRVFGREERKVRTPQGSVPDNVRDVRFKPDGRKVPQKTYRLGGNAGVRVKRCGKSAPPRQ*
Ga0068856_10032310063300005614Corn RhizosphereLICRQPDRTAASRVLGLGERKVRTPQGSVPDNVRDFRFKPDGRKVPQKTYRLGGNAGVRVKRCGKSAPPRQ
Ga0068866_1038572923300005718Miscanthus RhizosphereRGRKVRTPQSSVPDNVREAGFKPGLRKVPQKTYRPGGNVGVRVKRCGKSAPPSQ*
Ga0066903_10037553543300005764Tropical Forest SoilGRKVRTPQGSVPDNVREGAFKRVRRKAPQRIYRPKRELGVRVKRCGKSAPPGQ*
Ga0066903_10135962413300005764Tropical Forest SoilRQPDRTAAFRVLRGERKVRTPQSSVPDNVRDAGFKPGGRKVPQKTYRLGGNAAVRVKRCGKSAPPLQ*
Ga0066903_10762868023300005764Tropical Forest SoilGRKVRTPQGSVPDNVREGAFKRVRRRAPQRIYRHMRKLVVRVKRCGKSAPPGQ*
Ga0068862_10238706913300005844Switchgrass RhizosphereRKVRTPQSSVPDNVRDGGFKSAGRPVPQKTYRLGGNARVRVKRCGKSAPPRQ*
Ga0075028_10042678713300006050WatershedsQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRPGRKAKVRVKRCGKSAPPPQ*
Ga0075019_1075800223300006086WatershedsQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKRYRPGRKAQVRVKRCGKSAPPRE*
Ga0075015_10009517043300006102WatershedsRGRKVRTPQSSVPDNVREAGFKPGLRKVPQKTYRPGGNAEVRVKRCGKSAPLSQ*
Ga0070712_10121229923300006175Corn, Switchgrass And Miscanthus RhizosphereLICRQPDRTAASRVFGREERKVRTPQGSVPDNVRDVRFKPDGRKVPQRIYRRGGNAEVRVKRCGKSAPPRQ*
Ga0070765_10026468643300006176SoilPDRTVAVAKQRKVRTPQSSVPDNVREGPRAVTGGIVRRKVPQKTYRPGRKAQVRVKRCGKSAPPPQ*
Ga0075527_1025542213300006640Arctic Peat SoilRKVRTPQSSVPDNVREAGFKPGRRKVPQKTYRPGGNARVRVKRCGKSAPPPQ*
Ga0099830_1183436613300009088Vadose Zone SoilGERKVRTPQSGVPDNVREGGFKPVRRKAPQKIYRRRRKLAARVKRCGKSAPPGQ*
Ga0116115_101685643300009631PeatlandWQPDRTVAVAKQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRPGRKAQVRVKRCGKSAPPTQ*
Ga0126373_1301421023300010048Tropical Forest SoilMVSRILDRVIAGFARSRRKVRTPLSSVPDNVRDGEFKLARRKVQQRIYRLCREAEVRVKRCGK
Ga0127488_101343823300010122Grasslands SoilMAVQREQSRGQNPDRTAASRVFGREERKVRTPQGSVPDNVRDIRFKPDGRKVPQKTYRLGGNAGVRVKRCGKSAPPRQ*
Ga0127488_106332513300010122Grasslands SoilAVQREQSRGQNPDRTAASRVFGRGERKVRTPQGSVPDNVRDVRFKPDGRKVPQKTYRLGGNAGVRVKRCGKSAPPRQ*
Ga0074044_1014883113300010343Bog Forest SoilTVAVARQRKVRTPQSSVPDNVREGRFKPVRRKVPQKTYRPGCKAQVRVKRCGKSAPPTQ*
Ga0126378_1044506013300010361Tropical Forest SoilFGREGRKVRTPQSSVPDNVRDVWFKPDGRKVPQRTYRPGNGVRVKRCGKSAPPPQQ*
Ga0126347_109393313300010867Boreal Forest SoilRTVARVVFGRRGRKVRTPQGSVPDNVREDRFKPVRRQVPQKIYRLGGNAEVRVKRCGKSAPPTQ*
Ga0150983_1281190823300011120Forest SoilLGRTVASRVFGRRERKVRTPQSSVPDNVREDGFKPVRRQVPQKTYRPDGNGGVRVKRCGKSAPPPQ*
Ga0150983_1420431713300011120Forest SoilGRKVRTPQSSVPDNVREAGFKPVRRKVPQRRYRLGGNARVRVKRCGKSAPPRQ*
Ga0151652_1275354413300011340WetlandPDRTAASRVFGREERKVRTPKGSVPDNVREGPQADTAGIARRKVPQKTYRLGGNAGVRVKRRGKSAPPRQ*
Ga0137399_1011932233300012203Vadose Zone SoilMPDRMIAVFARRGRKVRTPQSSVPDNVRDGGFKSVRRKVQQRIYRLIRKGGVRVKRCGKSAPLAQ*
Ga0134054_112046913300012390Grasslands SoilDRTVASRVFGREERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRPGNGVRVKRCGKSAPPRQ*
Ga0150984_11574065313300012469Avena Fatua RhizosphereARERKVRTPQSSVPDNVRDGEFKLVGRKVPQKTNRPSNGVMVKRCGKSAPPRQ*
Ga0153915_1007658513300012931Freshwater WetlandsMPDRMIAVSARRGRKVRTPQSSVPDNVREGGFKPVRRKAQQRIYRLGRKAGVRVKRCGKSAPLAQ*
Ga0126369_1121964413300012971Tropical Forest SoilCAFGRRERKVRTPQSSVPDNVRDARFKPDGRKVPQKIYRPGNGVRVKRCGKSAPLRQ*
Ga0157369_1039967643300013105Corn RhizosphereLIYRQPDRTAASRVFGREERKVRTPQGSVPDNVRDVRLKPDGRKVPQKRYRLGGNARVRVKRGGKSAPPRQ*
Ga0163162_1071415913300013306Switchgrass RhizosphereQGGRKVRTPQSSVPDNVRDGGFKSAGRPVPQKTYRLGGNVEVRVKRCGKSAPPRQ*
Ga0182008_1033607623300014497RhizosphereERKVRTPQGSVPDNVREGPQAGTAGIARRKVPQKIYRLGGIAGVRVKRCGKSAPPRQ*
Ga0167644_116406913300015206Glacier Forefield SoilVRTPQGSVPDNVRDGRFKAAGRPVQQRIYRRQTRKRLTVRVKRCGKSAPGGQ*
Ga0137409_1017545043300015245Vadose Zone SoilGERKVRTPQSSVPDNVREDGFKVIRRKVPRRIYRHRRKPEVRVKRCGKSAPPVQ*
Ga0182007_1021929313300015262RhizosphereLIDRQPDRTAASHVFGRGERKVRTPQGSVPDNVRDVRFKPDGRKVPQRIYRRGGNAEVRVKRCGKSAPPRQ*
Ga0132255_10017206813300015374Arabidopsis RhizosphereGRKVRTPQSSVPDNVRDGGFKSAGRPVPQKTYRLGGNVEVRVKRCGKSAPPRQ*
Ga0187817_1012451513300017955Freshwater SedimentRKVRTPQSSVLDNVREGEFKFARRKVPQKTYRPGGNAGVRVKRCGKSAPPPQ
Ga0187863_1027538113300018034PeatlandTPQSSVPDNVRDARFKPGGRKVPQKIYRLGGNAGVRVKRCGKSAPPRQ
Ga0184593_12815613300019179SoilTVAFRIFGRGERKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPIFRDEVRVKRCGKSAPPPQ
Ga0184586_11198113300019194SoilLDRTVASHVFGRGERKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPDFQNMFFGIGVRVKRCGKSAPPPQ
Ga0187795_107319523300019251PeatlandRMVASCVFGREERKVRTPQSSVPDNVRDVRFKPDGRKVPQKIYRLVYRKMRGVRVKRCGKSAPPPQ
Ga0187794_117123813300019273PeatlandPDRTVAVAIQRKVRTPQSSVPDNIRDGRLKPVGRKVPQKTYRSGRKAQVRVKRCGKSAPPRQ
Ga0187798_126979713300019275PeatlandDRTAAPPILAGRKVRTPQSSVPDNVRDVRFKSDGRKVPQKIYRLAGNGRVRVKRCGKSAPPRQ
Ga0187797_104824533300019284PeatlandRKVRTPQSSVPDNVRDVGFKPDGRKVPQKIYRPAGDGVVRVKRCGKSAPPRQ
Ga0210399_1024288923300020581SoilGGEERKVRTPQSSVPDNVRDIRFKPDGRKVPQKIYRPGNGVRVKRCGKSAPPRQ
Ga0210393_1058309913300021401SoilGRRERKVRTPQSSVPDNVRDVRFKPDGRKVPQRTYRPGGNARVRVKRCGKSAPPRQ
Ga0210387_1071833423300021405SoilAVVRQRKVRTPQSSVPDNVREGPRAFMGGIVRRKVPQKTYRRDRKVPVRVKRCGKSAPPS
Ga0213853_1135491123300021861WatershedsASRVFGCEERKVRTPQSSVPDNVRDVRFKPGGRKVPQKTYRHGNVVRVKRCGKSAPPRQ
Ga0242646_100493123300022502SoilCAFGRGERKVRTPQSSVPDNVREGGFKSARRKVPQKIYRLGGNARVRVKRCGKSAPPRQ
Ga0242642_109866213300022504SoilRMVAVFARRERKVRTPESSVPDNVRDGGFKPVRRPVQQRTYRLGRKAGVRVKRCGKSAPLAQ
Ga0242649_104931513300022509SoilERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRQGGNASVRVKRGGKSAPPRQ
Ga0242659_108121613300022522SoilRTVAVAKQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKIYRRGRKAQVRGKRCGKSAPPRQ
Ga0242669_107372913300022528SoilAASSVFGRGERKVRTPQSSVPDNVRDGRFKPARRKVPQKIYRLSGNAKVRVKRCGKSAPPRQ
Ga0242660_104048323300022531SoilSASGGFRCEERKVRTPQSSVPDNVRDVRFKPDGRKVPQKIYRPGNGVRVKRCGKSAPPRQ
Ga0242655_1023740213300022532SoilPDRTVAVAKQRKVRTPQSSVPDNVRESPRAFTGGIVRRKVPQKTYRPGRKAQVRVKRCGKSAPPPQ
Ga0242655_1024947213300022532SoilQPDRTAASRVFGCEERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRPGNGVRVKRCGKSAPPRQ
Ga0242670_104319023300022708SoilVRIPQSSVPDNVREVGFKPGRRKVPQKTYRPGRKAEVRVKRCGKSAPPPQ
Ga0242653_104301023300022712SoilVARVIFGRRGRKVRTPQSSVPDNVREAGFKPVRRQVPQKTYRPGGNAEVRVKRCGKSAPPPQ
Ga0242673_109735113300022716SoilPDRTAASRVFRCEERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRPGNGVRVKRCGKSAPPRQ
Ga0242673_113021313300022716SoilRTVAVAKQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKIYRRGRKAQVRVKRCGKSAPPRQ
Ga0242657_107390713300022722SoilDGRFPFQRGERKVRTPQSSVPDNVRDARFKPGGRKVPQKTYRLGGNTGVRVKRCGKSAPPCQ
Ga0242665_1021551713300022724SoilPDRTAASRVFGCEERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRPGNGVRVKRCGKSAPPRQ
Ga0242654_1033614813300022726SoilWTKVNKSNVRSPQSSLTDNIRDGLFKPVGRKVPQKIYRPGRKARVRVKRCGKSAPPGQ
Ga0224569_10108833300022732RhizosphereVFGRGERKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPDFQNMFFGIGVRVKRCGKSAPPPQ
Ga0247552_10140813300023536SoilVAFCVFGRGERKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPDFQNMFFGIGVRVKRCGKSAPPPQ
Ga0247514_11720113300023560SoilAVAVARQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRPGRKVQVRVKRCGKSAPPTQ
Ga0207707_1002631543300025912Corn RhizosphereLIYRQPDRTAASRVFGREERKVRTPQGSVPDNVRDVRLKPDGRKVPQKRYRLGGNARVRVKRCGKSAPPRQ
Ga0207700_1190352713300025928Corn, Switchgrass And Miscanthus RhizosphereASRVFGREERKVRTPQGSVPDNVRDVRFKPDGRKVPQRIYRRGGNAEVRVKRCGKSAPPR
Ga0207639_1120849213300026041Corn RhizosphereTERERKVRTPQSNVPDNVRDGAFKGVGRKVPQRIYRLGRKAAVRVKRCGKSAPAGQ
Ga0257149_104639923300026355SoilDRTVAVAKQRKVRTPQSSVPDNVREGPRAFTGGIVRRKVPQKTYRPGRKAQVRVKRCGKSAPPPQ
Ga0209474_1047395513300026550SoilSVPDNVREGPQAGIAGIARRKVPQKIYRHGGNAGVRVKRCGKSAPPRQ
Ga0209622_108036813300027502Forest SoilEERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRPGNGVRVKRCGKSAPPRQ
Ga0209221_100516013300027609Forest SoilRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRLGRKVQVRVKRCGKSAPPTQ
Ga0209106_112686913300027616Forest SoilWQPDRTAAVARQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRRGRKAQVRVKRCGKSAPPSQ
Ga0209166_10000096593300027857Surface SoilMGAVRIEYNDFRRQPDRTAAFRVFGREERKVRTPQSSVPDNVRDVRFKPGGRKVPQKTYRPGGNARVRVKRCGKSAPLSQ
Ga0209488_1057335833300027903Vadose Zone SoilMPDRMIAVFARRGRKVRTPQSSVPDNVRDGGFKSVRRKVQQRIYRLVRKGGVRVKRCGKSAPLAQ
Ga0257175_104016413300028673SoilDRTVAVARQRKVRTPQSSVPDNVREAGFKLSRRKVPQKIYRPSRKAQVRVKRCGKSAPPL
Ga0302209_1011752823300028772FenQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRLGRKTAVRVKRCGKSAPPRQ
Ga0222749_1011367813300029636SoilERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRPGNGVRVKRCGKSAPPWQ
Ga0210291_1029251223300030626SoilLLFRKGWGRKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPGGNARVRVKRCGKSAPPRQ
Ga0302309_1051560713300030687PalsaIGWQPDRTVAVAKQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRPGRKARVRVKRCGKSAPPTQ
Ga0265462_1245973613300030738SoilSLSFRKEWGRKVRTPPRSVPDDVRKAGFKPVRRKVPQRRYRPGGNARVRVKRCGKSAPPR
Ga0265722_10607113300030761SoilLDRTVAFRIFGRGERKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPIFRDEVRVKRCGKSAPPPQ
Ga0265738_10618813300030834SoilERKVRTPQSSVPDNVREDGFKSIRRPVPQKIYRLGVRKNVEVRVKRCGKSAPLPQ
Ga0265767_10736413300030836SoilQDRTVAFRIFGRGERKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPIFRDEVRVKRCGKSAPPPQ
Ga0265753_113043913300030862SoilGRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRPGRKVQVRVKRCGKSAPPRQ
Ga0265743_12075313300030885SoilMWWRKVRTPQSGVPDNVREGAVKGVRRRVQQKIYRREGNFAVRVKRCGKSAPDA
Ga0138302_114260213300030937SoilVARQRKVRTPQSSVPDNVREGPRAFTGGIVRRKVPQKIYRPGRKAQVRVKRCGKSAPPEQ
Ga0265737_10985013300030941SoilPGRTVAFCAFGHGERKVRTPQSSVPDNVRDAGFKSGGRKVPQKTYRLGGNAAVRVKRCGKSAPPHE
Ga0265732_10298213300031016SoilTVASRVFGRRERKVRTPQSSVPDNVRDVRFKPDGRKVPQKTYRLGGNASVRVKRCGKSAPPRQ
Ga0302180_1020924913300031028PalsaDGRKVRTPQSSVPDNVREGRFKPVRRKVPQKTYRRGRKAQVRVKRCGKSAPPAQ
Ga0265747_10674413300031044SoilAFGHGERKVRTPQSSVPDNVRDAGFKSGGRKVPQKTYRLGGNAKVRVKRCGKSAPPRQ
Ga0170834_10489679013300031057Forest SoilSRVFGCEERKVRTPQSSVPDNVRDVRFKPDGRKVPQKIYRPGNGVRVKRCGKSAPPRQ
Ga0170824_12155464913300031231Forest SoilERKVRTPQSSVPDNVREGGFKSARRKVPQKIYRPGGNARVRVKRCGKSAPPRQ
Ga0311364_1007444413300031521FenDRTIAVVRQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRLGRKTAVRVKRCGKSAPPR
Ga0307484_11764313300031663Hardwood Forest SoilPDWTVASCAFGRRERKVRTPQSSVPDNVRDVGFKSDGRKVPQKTYRPAVLVSSAQPTDENGGVRVKR
Ga0307478_1019424243300031823Hardwood Forest SoilERVKRGERKVRTPQSSVPDNVREAGFKPVRRKVPQKTYRPSLPARVRVKRCGKSAPPPQ
Ga0316031_11110313300031826SoilGNTGVEAKAQVGVAFRIFGRGERKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPIFRDEVRVKRCGKSAPPPQ
Ga0316031_11313313300031826SoilFGRGERKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPDFQNMFFGIGVRVKRCGKSAPPPQ
Ga0316035_10429123300031955SoilERKVRTPQSSVPDNVREAGFKPVRRKVPQRIYRPIFRDEVRVKRCGKSAPPPQ
Ga0307479_1033525813300031962Hardwood Forest SoilRQRERKVRTPQSSVPDNVREAGFKPGRRKVPQKTYRPDGDIRVRVKRCGKSAPPRQ
Ga0307479_1119561023300031962Hardwood Forest SoilPIAYNENSWQLGRTVASRVFGRGERKVRTPQSSVPDNVREDGFKPVRRQVPQKTYRLGGNARVRVKRCGKSAPPPQ
Ga0316040_10687113300032121SoilPDRTVAVVRQRKVRTPQSSVPDNVREGRFKPVRRKVPQKTYRPGRKAQVRVKRCGKSAPPSQ
Ga0348332_1409370013300032515Plant LitterPDRTVAVARQRKVRTPQSSVPDNVRDGRFKPVGRKVPQKTYRPGREAQVRVKRCGKSAPPPQ
Ga0348332_1466871123300032515Plant LitterVAVARQRKVRTPQSSVPDNVREGRFKPVRRKVPQKTYRPGRKVQVRVKRCGKSAPPTQ
Ga0335076_1019441223300032955SoilMIASAMPGRKVRTPQSSVPDNVRDDRFKPVGRKVPQRTYRRGREAQVRVKRCGKSAPPGE
Ga0335084_1220378213300033004SoilRARKRARKVRTPQSSVPDNVRDVEWKLNGRPVPQKTYRPREGVRVKRCGKSAPPVQ
Ga0310810_1106333413300033412SoilREERKVRTPQGSVPDNVRDVRFKPDGRKVPQRIYRRGGNAEVRVKRCGKSAPPRQ
Ga0310811_1030472113300033475SoilKVRTPQSSVPDNVRDGGFKSAGRPVPQKTYRLGGNVEVRVKRCGKSAPPRQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.