Metagenome Family F067180

Basic Information
Family ID	F067180
Family Type	Metagenome
Number of Sequences	126
Average Sequence Length	39 residues
Representative Sequence	MALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Number of Associated Samples	20
Number of Associated Scaffolds	126

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.80 %
% of genes near scaffold ends (potentially truncated)	34.92 %
% of genes from short scaffolds (< 2000 bps)	84.92 %
Associated GOLD sequencing projects	10
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.36

Most Common Taxonomy
Group	Unclassified (92.857 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (69.841 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 126 Family Scaffolds
PF00078	RVT_1	1.59

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
All Organisms	root	All Organisms	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
cellular organisms	root	All Organisms → cellular organisms	7.14 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	5.56 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5.56 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	3.97 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	3.17 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	3.17 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	1.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.59 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	1.59 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	1.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.59 %
Cytophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae	1.59 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	1.59 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	1.59 %
Candidatus Nephrothrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix	1.59 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	0.79 %
Cephalochordata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
unclassified Candidatus Nephrothrix	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix	1.59 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1.59 %
Leptocardii	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii	0.79 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Amphioxiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes	0.79 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.79 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	0.79 %
Chelicerata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	0.79 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.79 %
Branchiostomidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae	0.79 %
Pycnogonida	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Pantopoda	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda	0.79 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Nymphonidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae	0.79 %
Sarcopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii	0.79 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.79 %
Dipnotetrapodomorpha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha	0.79 %
Nymphon	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.79 %
Tetrapoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	0.79 %
Amniota	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Sauropsida	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida	0.79 %
Polyneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Dictyoptera	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera	0.79 %
Sauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Blattodea	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea	0.79 %
Archelosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Testudinata	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata	0.79 %
Blattoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Termitoidae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae	0.79 %
Testudines	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Cryptodira	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira	0.79 %
Rhinotermitidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Coptotermitinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae	0.79 %
Durocryptodira	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Testudinoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea	0.79 %
Coptotermes	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Emydidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae	0.79 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Trachemys	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Trachemys	0.79 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Trachemys scripta	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Trachemys → Trachemys scripta	0.79 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	92.86 %
Candidatus Nephrothrix sp. EaCA	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	1.59 %
Trachemys scripta elegans	subspecies	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Trachemys → Trachemys scripta → Trachemys scripta elegans	0.79 %
Coptotermes formosanus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	0.79 %
Nymphon striatum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	0.79 %
Branchiostoma	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	0.79 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001734\|JGI24668J20090_10064873	Not Available	909	Open in IMG/M
3300001734\|JGI24668J20090_10067823	Not Available	893	Open in IMG/M
3300001734\|JGI24668J20090_10165227	Not Available	619	Open in IMG/M
3300001734\|JGI24668J20090_10208586	Not Available	557	Open in IMG/M
3300001741\|JGI24671J20093_10054335	Not Available	862	Open in IMG/M
3300001741\|JGI24671J20093_10103123	Not Available	684	Open in IMG/M
3300001741\|JGI24671J20093_10185190	Not Available	544	Open in IMG/M
3300001741\|JGI24671J20093_10206798	Not Available	519	Open in IMG/M
3300001741\|JGI24671J20093_10223032	Not Available	502	Open in IMG/M
3300001742\|JGI24673J20094_10023388	Not Available	1304	Open in IMG/M
3300001742\|JGI24673J20094_10065532	Not Available	905	Open in IMG/M
3300001742\|JGI24673J20094_10080984	Not Available	835	Open in IMG/M
3300001742\|JGI24673J20094_10210001	Not Available	562	Open in IMG/M
3300001742\|JGI24673J20094_10242473	Not Available	526	Open in IMG/M
3300001744\|JGI24669J20092_10075979	Not Available	690	Open in IMG/M
3300001744\|JGI24669J20092_10095256	Not Available	636	Open in IMG/M
3300001744\|JGI24669J20092_10163561	Not Available	519	Open in IMG/M
3300001744\|JGI24669J20092_10168464	Not Available	513	Open in IMG/M
3300001746\|JGI24672J20091_10055319	Not Available	766	Open in IMG/M
3300001746\|JGI24672J20091_10100586	Not Available	622	Open in IMG/M
3300001746\|JGI24672J20091_10160053	Not Available	524	Open in IMG/M
3300001746\|JGI24672J20091_10167804	Not Available	515	Open in IMG/M
3300002181\|JGI24670J26820_11204005	Not Available	519	Open in IMG/M
3300002181\|JGI24670J26820_11275707	Not Available	570	Open in IMG/M
3300002181\|JGI24670J26820_11330403	Not Available	617	Open in IMG/M
3300002181\|JGI24670J26820_11363937	Not Available	651	Open in IMG/M
3300002181\|JGI24670J26820_11437153	Not Available	746	Open in IMG/M
3300002181\|JGI24670J26820_11470959	Not Available	805	Open in IMG/M
3300003801\|Ga0056138_1031337	Not Available	674	Open in IMG/M
3300003829\|Ga0056137_1012965	Not Available	931	Open in IMG/M
3300004098\|Ga0065184_10270951	Not Available	610	Open in IMG/M
3300004122\|Ga0065185_10002807	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	3349	Open in IMG/M
3300027540\|Ga0209791_1000401	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	16095	Open in IMG/M
3300027540\|Ga0209791_1002280	Not Available	4840	Open in IMG/M
3300027540\|Ga0209791_1002939	Not Available	4301	Open in IMG/M
3300027540\|Ga0209791_1027839	Not Available	1959	Open in IMG/M
3300027540\|Ga0209791_1058060	Not Available	1504	Open in IMG/M
3300027540\|Ga0209791_1341184	Not Available	569	Open in IMG/M
3300027540\|Ga0209791_1355279	Not Available	549	Open in IMG/M
3300027540\|Ga0209791_1383011	Not Available	513	Open in IMG/M
3300027551\|Ga0209338_1013376	Not Available	3908	Open in IMG/M
3300027551\|Ga0209338_1033038	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2812	Open in IMG/M
3300027551\|Ga0209338_1077493	Not Available	1922	Open in IMG/M
3300027551\|Ga0209338_1083317	Not Available	1852	Open in IMG/M
3300027551\|Ga0209338_1122844	Not Available	1485	Open in IMG/M
3300027551\|Ga0209338_1125669	Not Available	1463	Open in IMG/M
3300027551\|Ga0209338_1229412	Not Available	948	Open in IMG/M
3300027551\|Ga0209338_1233544	Not Available	934	Open in IMG/M
3300027551\|Ga0209338_1242787	Not Available	904	Open in IMG/M
3300027551\|Ga0209338_1259867	Not Available	851	Open in IMG/M
3300027551\|Ga0209338_1278830	Not Available	794	Open in IMG/M
3300027551\|Ga0209338_1317922	Not Available	690	Open in IMG/M
3300027551\|Ga0209338_1324518	Not Available	675	Open in IMG/M
3300027551\|Ga0209338_1375188	Not Available	564	Open in IMG/M
3300027551\|Ga0209338_1382329	Not Available	550	Open in IMG/M
3300027551\|Ga0209338_1398949	Not Available	517	Open in IMG/M
3300027556\|Ga0209743_1040511	Not Available	2000	Open in IMG/M
3300027556\|Ga0209743_1041307	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1986	Open in IMG/M
3300027556\|Ga0209743_1057245	Not Available	1752	Open in IMG/M
3300027556\|Ga0209743_1170119	Not Available	1031	Open in IMG/M
3300027556\|Ga0209743_1266081	Not Available	767	Open in IMG/M
3300027556\|Ga0209743_1274697	Not Available	748	Open in IMG/M
3300027556\|Ga0209743_1335702	Not Available	633	Open in IMG/M
3300027556\|Ga0209743_1345703	Not Available	617	Open in IMG/M
3300027556\|Ga0209743_1346254	Not Available	616	Open in IMG/M
3300027564\|Ga0209428_1071621	Not Available	1788	Open in IMG/M
3300027564\|Ga0209428_1089113	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Cephalochordata → Leptocardii → Amphioxiformes → Branchiostomidae → Branchiostoma	1612	Open in IMG/M
3300027564\|Ga0209428_1209322	Not Available	975	Open in IMG/M
3300027564\|Ga0209428_1235026	Not Available	898	Open in IMG/M
3300027564\|Ga0209428_1268574	Not Available	805	Open in IMG/M
3300027564\|Ga0209428_1293560	Not Available	744	Open in IMG/M
3300027564\|Ga0209428_1315011	Not Available	698	Open in IMG/M
3300027564\|Ga0209428_1316777	Not Available	694	Open in IMG/M
3300027564\|Ga0209428_1335494	Not Available	657	Open in IMG/M
3300027564\|Ga0209428_1336723	Not Available	655	Open in IMG/M
3300027564\|Ga0209428_1342951	Not Available	643	Open in IMG/M
3300027564\|Ga0209428_1415814	Not Available	520	Open in IMG/M
3300027584\|Ga0209637_1054965	Not Available	2099	Open in IMG/M
3300027584\|Ga0209637_1117846	Not Available	1447	Open in IMG/M
3300027584\|Ga0209637_1138731	Not Available	1316	Open in IMG/M
3300027584\|Ga0209637_1186352	Not Available	1090	Open in IMG/M
3300027584\|Ga0209637_1260552	Not Available	852	Open in IMG/M
3300027584\|Ga0209637_1262450	Not Available	847	Open in IMG/M
3300027584\|Ga0209637_1263701	Not Available	843	Open in IMG/M
3300027584\|Ga0209637_1302029	Not Available	745	Open in IMG/M
3300027584\|Ga0209637_1328330	Not Available	688	Open in IMG/M
3300027584\|Ga0209637_1368110	Not Available	611	Open in IMG/M
3300027584\|Ga0209637_1413087	Not Available	534	Open in IMG/M
3300027584\|Ga0209637_1428905	Not Available	510	Open in IMG/M
3300027585\|Ga0209150_1028794	Not Available	2037	Open in IMG/M
3300027585\|Ga0209150_1080091	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Trachemys → Trachemys scripta → Trachemys scripta elegans	1385	Open in IMG/M
3300027585\|Ga0209150_1235763	Not Available	785	Open in IMG/M
3300027613\|Ga0209122_1030069	Not Available	2275	Open in IMG/M
3300027613\|Ga0209122_1119411	Not Available	1265	Open in IMG/M
3300027613\|Ga0209122_1219698	Not Available	886	Open in IMG/M
3300027613\|Ga0209122_1271126	Not Available	756	Open in IMG/M
3300027620\|Ga0209260_10202303	Not Available	642	Open in IMG/M
3300027626\|Ga0209149_1010066	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	6765	Open in IMG/M
3300027626\|Ga0209149_1035604	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Pycnogonida → Pantopoda → Nymphonidae → Nymphon → Nymphon striatum	4077	Open in IMG/M
3300027626\|Ga0209149_1047096	Not Available	3554	Open in IMG/M
3300027626\|Ga0209149_1056662	Not Available	3218	Open in IMG/M
3300027626\|Ga0209149_1071747	Not Available	2807	Open in IMG/M
3300027626\|Ga0209149_1101129	Not Available	2253	Open in IMG/M
3300027626\|Ga0209149_1112184	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Rhinotermitidae → Coptotermitinae → Coptotermes → Coptotermes formosanus	2091	Open in IMG/M
3300027626\|Ga0209149_1149331	Not Available	1665	Open in IMG/M
3300027626\|Ga0209149_1163404	Not Available	1533	Open in IMG/M
3300027626\|Ga0209149_1166759	Not Available	1504	Open in IMG/M
3300027626\|Ga0209149_1166761	Not Available	1504	Open in IMG/M
3300027626\|Ga0209149_1184538	Not Available	1363	Open in IMG/M
3300027626\|Ga0209149_1230699	Not Available	1070	Open in IMG/M
3300027626\|Ga0209149_1242988	Not Available	1007	Open in IMG/M
3300027626\|Ga0209149_1264533	Not Available	905	Open in IMG/M
3300027626\|Ga0209149_1287619	Not Available	807	Open in IMG/M
3300027626\|Ga0209149_1298324	Not Available	764	Open in IMG/M
3300027626\|Ga0209149_1303036	Not Available	747	Open in IMG/M
3300027626\|Ga0209149_1334807	Not Available	640	Open in IMG/M
3300027626\|Ga0209149_1351406	Not Available	588	Open in IMG/M
3300027626\|Ga0209149_1366261	Not Available	543	Open in IMG/M
3300027626\|Ga0209149_1381562	Not Available	503	Open in IMG/M
3300027632\|Ga0209339_1024192	Not Available	4152	Open in IMG/M
3300027632\|Ga0209339_1219159	Not Available	1133	Open in IMG/M
3300027632\|Ga0209339_1234194	Not Available	1065	Open in IMG/M
3300027632\|Ga0209339_1240518	Not Available	1037	Open in IMG/M
3300027632\|Ga0209339_1323986	Not Available	744	Open in IMG/M
3300027632\|Ga0209339_1376999	Not Available	607	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24668J20090_100648733	3300001734	Marine Gutless Worms Symbiont	LPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG*
JGI24668J20090_100678231	3300001734	Marine Gutless Worms Symbiont	VTHLPMKFGADIFIQSGVIDIFPKLKMVCAAIVDLFG*
JGI24668J20090_101652271	3300001734	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQSGVIDIFPQFKMAAAAILELLG*
JGI24668J20090_102085861	3300001734	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIYIFLKLKMVAAAILDLFG*
JGI24671J20093_100543352	3300001741	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDILQKLKMVAAAILDLFG*
JGI24671J20093_101031231	3300001741	Marine Gutless Worms Symbiont	ALMRLPMKFGADIFIQSGIIDICPKLKMAAAAILDLLG*
JGI24671J20093_101851902	3300001741	Marine Gutless Worms Symbiont	CMAVLHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG*
JGI24671J20093_102067982	3300001741	Marine Gutless Worms Symbiont	MTVMHLPMKFGADIFIQSGVIDIFQKLKMVAAAILDLFG*
JGI24671J20093_102230322	3300001741	Marine Gutless Worms Symbiont	MAVMHLPIKFGADIFIQAGVIDIFLKLKMAAAAILEFYVM*
JGI24673J20094_100233883	3300001742	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVINIFQKLKMVAAAILDLFG*
JGI24673J20094_100655322	3300001742	Marine Gutless Worms Symbiont	MALMRLPTKFGADIFIQSGVINIFPKLMMAAAAILELLG*
JGI24673J20094_100809842	3300001742	Marine Gutless Worms Symbiont	MAVTHLPMKFGADIFIQSGVIDIFPKLKMVCAAIVDLFG*
JGI24673J20094_102100011	3300001742	Marine Gutless Worms Symbiont	MHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLLR*
JGI24673J20094_102424731	3300001742	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKTMAAAILDLFG*
JGI24669J20092_100759792	3300001744	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFTKLKMAAAAILKLLG*
JGI24669J20092_100952562	3300001744	Marine Gutless Worms Symbiont	LPMKFGADIFIQSGVIDIFRKLKMLAAAILDLFG*
JGI24669J20092_101635612	3300001744	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAGAAILELFG*
JGI24669J20092_101684641	3300001744	Marine Gutless Worms Symbiont	LMHLPTKFGADIFIQSGVIDIFPKLKMAAAAILGLFG*
JGI24672J20091_100553192	3300001746	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAIVDLFG*
JGI24672J20091_101005862	3300001746	Marine Gutless Worms Symbiont	MALXRLPMKFGADIXIQSGVIDIFPKLKMAAAAILELLG*
JGI24672J20091_101600531	3300001746	Marine Gutless Worms Symbiont	MALVRLSMKFGADIFIRSGVIDIFPKLKVAAAAILELLG*
JGI24672J20091_101678041	3300001746	Marine Gutless Worms Symbiont	MALVRLSMKFGADIFIQSGVIDIFPKLKMAAAAILEL
JGI24670J26820_112040052	3300002181	Marine Gutless Worms Symbiont	SRGHLCMALVRLPMKFGAYIFIQSGVIDIFPQFKMAAAAILELLG*
JGI24670J26820_112757071	3300002181	Marine Gutless Worms Symbiont	AVMHLHIKFGADIFIQSGVIHIFLKLKMAAATIIDFQVM*
JGI24670J26820_113304031	3300002181	Marine Gutless Worms Symbiont	HLPMKFGADIFIQSGVIDIFRKLKMVAAAIVDLFG*
JGI24670J26820_113639371	3300002181	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFFQSRVIDIFPKLMMAAAAILETLG*
JGI24670J26820_114371531	3300002181	Marine Gutless Worms Symbiont	RGHFCMALVRLPMKFGADIFIQSGVIDIFSKIKMAAAAILDLFG*
JGI24670J26820_114709591	3300002181	Marine Gutless Worms Symbiont	RGHLRMAVMHLSIKFGADIFIQAGVIDIFPKLKMAAAAILEFYVM*
Ga0056138_10313371	3300003801	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG*
Ga0056137_10129651	3300003829	Marine Gutless Worms Symbiont	VHLRMAVMHLHIKFGADIFIQSGVIDIFPKLKMAAVAILDFQLM*
Ga0065184_102709512	3300004098	Marine Gutless Worms Symbiont	MAVMHLIMKFGADIFIQSGVIDSFRKLQMVAAAILDLFG*
Ga0065185_100028078	3300004122	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGIIDICPKLKMAAAAILDLLG*
Ga0209791_10004013	3300027540	Marine Gutless Worms Symbiont	MALLRLPMKFGPDIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209791_10022802	3300027540	Marine Gutless Worms Symbiont	MALLRLPMKFGAYIFIQSGVIHIFPKLKMAAAAILELLE
Ga0209791_10029391	3300027540	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209791_10278392	3300027540	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFPKLNMAAAAIVELLG
Ga0209791_10580602	3300027540	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDILQKLKMVAAAILDLFG
Ga0209791_13411842	3300027540	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFSKLKMAAAAILELLG
Ga0209791_13552791	3300027540	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSRVIDIFPKLKMAAAAILELLG
Ga0209791_13830111	3300027540	Marine Gutless Worms Symbiont	RGHLCMALLRLPMKFGAYIFIQSGVIDIFPKLKMAAAAILELFG
Ga0209338_10133765	3300027551	Marine Gutless Worms Symbiont	MAAMHLPMIFGADIFIQSGVIDIFLKLKMAAAAILDLFG
Ga0209338_10330385	3300027551	Marine Gutless Worms Symbiont	MVVMHLPMKFGADIFIQSGVIDIFPKLKMAAAAILNLFG
Ga0209338_10774933	3300027551	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFPKLKMVAAAILDLFG
Ga0209338_10833172	3300027551	Marine Gutless Worms Symbiont	MALVRLSMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209338_11228441	3300027551	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQSGVIDIFPQFKMAAAAILELLG
Ga0209338_11256692	3300027551	Marine Gutless Worms Symbiont	MAMLRLPMKFGADTFIQSGVIDIFPKLKMAAAVILELLG
Ga0209338_12294121	3300027551	Marine Gutless Worms Symbiont	MKFGADIFIQSGVIYIFLKLKMVAAAILDLFGXVMGPQAS
Ga0209338_12335441	3300027551	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAIVDLFG
Ga0209338_12427872	3300027551	Marine Gutless Worms Symbiont	MAVMHLPIKFGARIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209338_12598671	3300027551	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFSKIKMAAAAILDLFG
Ga0209338_12788301	3300027551	Marine Gutless Worms Symbiont	MALLRLLMKFGADIFMQSVVTDIFPKLKMAAAAILELLG
Ga0209338_12988591	3300027551	Marine Gutless Worms Symbiont	MASLHLSMKFGADIFIQSGVIDILPKLTMAAAAILDLFA
Ga0209338_13179221	3300027551	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAVAILDF
Ga0209338_13245182	3300027551	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLE
Ga0209338_13751882	3300027551	Marine Gutless Worms Symbiont	MAVMHLPMKIGADIFIQSGVIDIFLKLKMVAAAILDLFG
Ga0209338_13823291	3300027551	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLGXA
Ga0209338_13989491	3300027551	Marine Gutless Worms Symbiont	MALLRLPLKLGADIFIQSGVIDIFPKLKMAAAAIL
Ga0209743_10405112	3300027556	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209743_10413072	3300027556	Marine Gutless Worms Symbiont	MAVMHLPVKFGADIFIQSGVIDIFPKLKMVAAAILDL
Ga0209743_10572453	3300027556	Marine Gutless Worms Symbiont	MAVTHLPMKFGADIFIQSGVIDIFPKLKMVCAAIVDLFG
Ga0209743_11701191	3300027556	Marine Gutless Worms Symbiont	MAVTRLPMKFGADIFIQCGVIDISSKLKMVVAAILDLFG
Ga0209743_12660811	3300027556	Marine Gutless Worms Symbiont	MALVRLPTKFGADIFIQSGVIDIFPKLKLAAAAILELLG
Ga0209743_12746971	3300027556	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQFGVIDIFPKLKMAAAAILELLG
Ga0209743_13357021	3300027556	Marine Gutless Worms Symbiont	RGHLCMAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209743_13457031	3300027556	Marine Gutless Worms Symbiont	AVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAIVDLFG
Ga0209743_13462541	3300027556	Marine Gutless Worms Symbiont	LVRLPMKFGADIFIQSGVIDIFSKLKMAAAAILELLG
Ga0209428_10716211	3300027564	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFPKLKMAAAAILDLVG
Ga0209428_10891131	3300027564	Marine Gutless Worms Symbiont	RGHLCMALIRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209428_12093221	3300027564	Marine Gutless Worms Symbiont	MKFGADIFIQSGVIDIFRKLKMVAAAILDLFGXAVGPP
Ga0209428_12350261	3300027564	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGIIDICPKLKMAAAAILDLLG
Ga0209428_12685741	3300027564	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDILPKLKMAAAAMLDLFG
Ga0209428_12935601	3300027564	Marine Gutless Worms Symbiont	GHLCMALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209428_13150111	3300027564	Marine Gutless Worms Symbiont	GNLCMALVRLSMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209428_13167772	3300027564	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQSGVIDIFPKLKMVAAAFLEL
Ga0209428_13354941	3300027564	Marine Gutless Worms Symbiont	WSRSHASSMKFSADIFIQSGVIDIFPKLKMVAAAILDLFG
Ga0209428_13367232	3300027564	Marine Gutless Worms Symbiont	MALVRLPMKFGADICIQSRVIDIFPKLKMAAAAILELLG
Ga0209428_13429511	3300027564	Marine Gutless Worms Symbiont	VALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209428_14158141	3300027564	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAIL
Ga0209637_10549651	3300027584	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVINIFQKLKMVAAAILDLFG
Ga0209637_11178461	3300027584	Marine Gutless Worms Symbiont	MAVMHLSIKFGAYILIQAGVIDIFPKLKMAAAAILEFYVMXIWLFRRV
Ga0209637_11387312	3300027584	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKTMAAAILDLFG
Ga0209637_11863521	3300027584	Marine Gutless Worms Symbiont	MALIRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209637_12605521	3300027584	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQCGVIDIFTKLKMAVAAILELFG
Ga0209637_12624501	3300027584	Marine Gutless Worms Symbiont	MAVMHLPMKFGEDIFIQSGVIDIFQKLKMVAAAILDLFG
Ga0209637_12637011	3300027584	Marine Gutless Worms Symbiont	MALMHLPTKFGADIFIQSGVIDIFPKLKMAAAAILDLFG
Ga0209637_13020291	3300027584	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILKLLG
Ga0209637_13283301	3300027584	Marine Gutless Worms Symbiont	MTLVRLPMKFGAYIFIQSGVIDIFPKLKMAAAAILKLLG
Ga0209637_13681101	3300027584	Marine Gutless Worms Symbiont	MHLSIKFGADIFIRSGVIDIFPKLKMTAASILDLLG
Ga0209637_14130872	3300027584	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGVIDVFPKLKMAAAAILELLG
Ga0209637_14289052	3300027584	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFLKLKMVAAAILDLFG
Ga0209150_10287942	3300027585	Marine Gutless Worms Symbiont	MALVRLSMKFGADIFIQSGVIDIFPKLKMAAAAILDLGIAWVGPHT
Ga0209150_10800913	3300027585	Marine Gutless Worms Symbiont	MTVMHLPMKFGADIFIQSGVIDIFQKLKMVAAAILDLFG
Ga0209150_12357632	3300027585	Marine Gutless Worms Symbiont	MKFGADIFIQSGVIDIFRKLKMVAAAILDLFGXAMGP
Ga0209122_10300691	3300027613	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIHSGVIDIFPKLKMAAAAILELLG
Ga0209122_11194112	3300027613	Marine Gutless Worms Symbiont	MALMHLPTKFGADIFIQSGVIDIFPKLKMAAAAILGLFG
Ga0209122_12196982	3300027613	Marine Gutless Worms Symbiont	IATMHLPMKFGADIFIQSGVIDIFRKLKMVTAAILDLFG
Ga0209122_12711261	3300027613	Marine Gutless Worms Symbiont	MALLRLPMKFSADTFIQSGVIDIFPKSMMAAAVILELLG
Ga0209260_102023032	3300027620	Marine Gutless Worms Symbiont	RLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_10100665	3300027626	Marine Gutless Worms Symbiont	MALVRHPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_10356041	3300027626	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_10470965	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILDF
Ga0209149_10566626	3300027626	Marine Gutless Worms Symbiont	MAVVHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209149_10717471	3300027626	Marine Gutless Worms Symbiont	MALMRLPTKFGADIFIQSGVINIFPKLMMAAAAILELLG
Ga0209149_11011292	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQSGVIDIFLKLKMAAAAILELLG
Ga0209149_11121843	3300027626	Marine Gutless Worms Symbiont	MALLCFPMKFGADIFIQSGVIDFFPKLKMAAAAILELLG
Ga0209149_11493311	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFMQSVVTDIFPKLKMAAAAILELLG
Ga0209149_11634041	3300027626	Marine Gutless Worms Symbiont	LLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_11667591	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGAYIFIQSGVIDIIPKLKMAAAAILELLG
Ga0209149_11667612	3300027626	Marine Gutless Worms Symbiont	MALVRLPMKFGAYIFIQSGVIDIFPKLKMVAAAFLELLG
Ga0209149_11845381	3300027626	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIYIFLKLKMVAAAILDLFR
Ga0209149_12306991	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFTQSGVIVFFPKLKMAAAAILELLG
Ga0209149_12429881	3300027626	Marine Gutless Worms Symbiont	MALVRLPMKFGADIFIQSGVIDIFPKLEMAAAAILELL
Ga0209149_12645331	3300027626	Marine Gutless Worms Symbiont	MALMRLLMKFGADIFIQSGVIDIFPKLKMAAAAMLELLG
Ga0209149_12876191	3300027626	Marine Gutless Worms Symbiont	MALLRLPMKFGAYIFIQSGVIDIFPKVNMAAAAILELLGXAMGPPTK
Ga0209149_12983242	3300027626	Marine Gutless Worms Symbiont	MAVMHLPVKFGADIFFQSGVIDIFPKMAAAAILDFQIM
Ga0209149_13030361	3300027626	Marine Gutless Worms Symbiont	MDVMHLPMKFGADIFIQSGVIYIFLKLKMVAAAILDLFG
Ga0209149_13348071	3300027626	Marine Gutless Worms Symbiont	MHLPVKFGADIFIQSGVIDIFQKLKMVAAAILDLFG
Ga0209149_13514061	3300027626	Marine Gutless Worms Symbiont	MAVMHLPMKFGADIFIQSGVIDIFRKLKMVAAAIL
Ga0209149_13662611	3300027626	Marine Gutless Worms Symbiont	MALLRFPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209149_13815622	3300027626	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFIQSGVIDIFPKLKMAAAAILELLG
Ga0209339_10241921	3300027632	Marine Gutless Worms Symbiont	MHLSMKFGAAIFVQSGVIDIFRKLKMVAAAILDLFG
Ga0209339_12191591	3300027632	Marine Gutless Worms Symbiont	TVLIATMHLPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209339_12341941	3300027632	Marine Gutless Worms Symbiont	CMAVVHIPMKFGADIFIQSGVIDIFRKLKMVAAAILDLFG
Ga0209339_12405181	3300027632	Marine Gutless Worms Symbiont	MAFLRLPMKFGADIFIQSGVIDIFPKLKMAAAAILE
Ga0209339_13239862	3300027632	Marine Gutless Worms Symbiont	MALLRLPMKFGADIFIQFRVIDIFPKLKMAAAAILELLG
Ga0209339_13769992	3300027632	Marine Gutless Worms Symbiont	MALMRLPMKFGADIFFQSRVIDIFPKLMMAAAAILETLG

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.36
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.36
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F067180

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001734	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1	Host-Associated	Open in IMG/M
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated	Open in IMG/M
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated	Open in IMG/M
3300001744	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2	Host-Associated	Open in IMG/M
3300001746	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2	Host-Associated	Open in IMG/M
3300002181	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3	Host-Associated	Open in IMG/M
3300003801	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1	Host-Associated	Open in IMG/M
3300003829	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI	Host-Associated	Open in IMG/M
3300004098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (version 2)	Host-Associated	Open in IMG/M
3300004122	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (version 2)	Host-Associated	Open in IMG/M
3300027540	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes)	Host-Associated	Open in IMG/M
3300027551	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes)	Host-Associated	Open in IMG/M
3300027556	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 (SPAdes)	Host-Associated	Open in IMG/M
3300027564	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes)	Host-Associated	Open in IMG/M
3300027584	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes)	Host-Associated	Open in IMG/M
3300027585	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)	Host-Associated	Open in IMG/M
3300027613	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes)	Host-Associated	Open in IMG/M
3300027620	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI (SPAdes)	Host-Associated	Open in IMG/M
3300027626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027632	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign