NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067916

Metagenome / Metatranscriptome Family F067916

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067916
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 45 residues
Representative Sequence LQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Number of Associated Samples 111
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.40 %
% of genes from short scaffolds (< 2000 bps) 85.60 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.000 % of family members)
Environment Ontology (ENVO) Unclassified
(42.400 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.62%    β-sheet: 0.00%    Coil/Unstructured: 46.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF00005ABC_tran 96.00
PF13242Hydrolase_like 0.80
PF12806Acyl-CoA_dh_C 0.80
PF00909Ammonium_transp 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 0.80


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502000|ACOD_GAKN62C01EC1NQAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis504Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig573154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SB2674Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0849356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium2067Open in IMG/M
3300000580|AF_2010_repII_A01DRAFT_1059534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300000955|JGI1027J12803_101727954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila909Open in IMG/M
3300001686|C688J18823_10020244All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4474Open in IMG/M
3300001977|JGI24746J21847_1040405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales648Open in IMG/M
3300004480|Ga0062592_100864970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila810Open in IMG/M
3300004633|Ga0066395_10148601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1185Open in IMG/M
3300004633|Ga0066395_10831438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales556Open in IMG/M
3300005164|Ga0066815_10055825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales662Open in IMG/M
3300005168|Ga0066809_10081009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila770Open in IMG/M
3300005332|Ga0066388_107750261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales538Open in IMG/M
3300005451|Ga0066681_10438612All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila802Open in IMG/M
3300005471|Ga0070698_101683183All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales587Open in IMG/M
3300005713|Ga0066905_100899770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila774Open in IMG/M
3300005713|Ga0066905_101455933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales622Open in IMG/M
3300005764|Ga0066903_105649138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa acidiphila658Open in IMG/M
3300006032|Ga0066696_10041010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2545Open in IMG/M
3300006038|Ga0075365_10055276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2634Open in IMG/M
3300006186|Ga0075369_10618609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales519Open in IMG/M
3300006580|Ga0074049_13054669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria569Open in IMG/M
3300006844|Ga0075428_101951119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis609Open in IMG/M
3300006847|Ga0075431_101770545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis574Open in IMG/M
3300006852|Ga0075433_11497786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis583Open in IMG/M
3300006854|Ga0075425_101226847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales852Open in IMG/M
3300006871|Ga0075434_101088224All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300009792|Ga0126374_10592037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria817Open in IMG/M
3300010046|Ga0126384_11682401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium599Open in IMG/M
3300010048|Ga0126373_13261483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium505Open in IMG/M
3300010326|Ga0134065_10435000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. SC2534Open in IMG/M
3300010359|Ga0126376_12358674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300010360|Ga0126372_11389985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300010360|Ga0126372_12098730All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales613Open in IMG/M
3300010361|Ga0126378_11445621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria779Open in IMG/M
3300010362|Ga0126377_10928548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria934Open in IMG/M
3300010362|Ga0126377_11423869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales766Open in IMG/M
3300010398|Ga0126383_12846447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria565Open in IMG/M
3300010400|Ga0134122_10111609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2179Open in IMG/M
3300010863|Ga0124850_1022426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2026Open in IMG/M
3300011434|Ga0137464_1171529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium660Open in IMG/M
3300012198|Ga0137364_10033444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3303Open in IMG/M
3300012199|Ga0137383_11237837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium535Open in IMG/M
3300012209|Ga0137379_11662601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium536Open in IMG/M
3300012212|Ga0150985_108830401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium791Open in IMG/M
3300012355|Ga0137369_10326887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis1128Open in IMG/M
3300012361|Ga0137360_11348274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300012911|Ga0157301_10452925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300012930|Ga0137407_12095820All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300012971|Ga0126369_10851162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium996Open in IMG/M
3300012972|Ga0134077_10517454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium530Open in IMG/M
3300015374|Ga0132255_100007303All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales12619Open in IMG/M
3300016270|Ga0182036_11906786All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300016294|Ga0182041_11388262All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium644Open in IMG/M
3300016319|Ga0182033_11875374All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300016341|Ga0182035_11756136All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium561Open in IMG/M
3300016357|Ga0182032_10066519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2413Open in IMG/M
3300016371|Ga0182034_10525422All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium990Open in IMG/M
3300016404|Ga0182037_10163546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1691Open in IMG/M
3300016422|Ga0182039_10662620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium917Open in IMG/M
3300016422|Ga0182039_11821660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium558Open in IMG/M
3300016445|Ga0182038_10522019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1016Open in IMG/M
3300018056|Ga0184623_10421041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300018433|Ga0066667_11582634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium583Open in IMG/M
3300020581|Ga0210399_10419502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1116Open in IMG/M
3300021406|Ga0210386_10277329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1434Open in IMG/M
3300021420|Ga0210394_10580001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium986Open in IMG/M
3300021475|Ga0210392_10062084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2343Open in IMG/M
3300021560|Ga0126371_12370507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300025900|Ga0207710_10680785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria539Open in IMG/M
3300026342|Ga0209057_1055245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1837Open in IMG/M
3300027866|Ga0209813_10486104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium510Open in IMG/M
3300027874|Ga0209465_10492868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium612Open in IMG/M
3300027908|Ga0209006_10817761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria754Open in IMG/M
3300031170|Ga0307498_10381788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300031198|Ga0307500_10243936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300031474|Ga0170818_101116688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria516Open in IMG/M
3300031544|Ga0318534_10415335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium772Open in IMG/M
3300031545|Ga0318541_10268475All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium949Open in IMG/M
3300031545|Ga0318541_10555316All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria642Open in IMG/M
3300031573|Ga0310915_10251124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1244Open in IMG/M
3300031680|Ga0318574_10209930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1120Open in IMG/M
3300031681|Ga0318572_10971848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria504Open in IMG/M
3300031708|Ga0310686_103165740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria11615Open in IMG/M
3300031719|Ga0306917_10349970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1148Open in IMG/M
3300031719|Ga0306917_10892985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium695Open in IMG/M
3300031719|Ga0306917_11532009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300031744|Ga0306918_10000427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales18822Open in IMG/M
3300031744|Ga0306918_10416744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1047Open in IMG/M
3300031747|Ga0318502_10314307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium923Open in IMG/M
3300031765|Ga0318554_10620252All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300031768|Ga0318509_10748342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300031768|Ga0318509_10818983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria515Open in IMG/M
3300031781|Ga0318547_10055764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2142Open in IMG/M
3300031792|Ga0318529_10026923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2349Open in IMG/M
3300031795|Ga0318557_10546883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300031805|Ga0318497_10180982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1161Open in IMG/M
3300031819|Ga0318568_10489995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium767Open in IMG/M
3300031846|Ga0318512_10010207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3595Open in IMG/M
3300031879|Ga0306919_11294277All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300031890|Ga0306925_11485759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium664Open in IMG/M
3300031894|Ga0318522_10238878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium689Open in IMG/M
3300031896|Ga0318551_10843764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium533Open in IMG/M
3300031897|Ga0318520_10638391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300031897|Ga0318520_10805084All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium590Open in IMG/M
3300031912|Ga0306921_10993627All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria947Open in IMG/M
3300031943|Ga0310885_10266322All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium874Open in IMG/M
3300031946|Ga0310910_10944275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium675Open in IMG/M
3300031954|Ga0306926_11021995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium982Open in IMG/M
3300031954|Ga0306926_12504551All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300031954|Ga0306926_12519724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300031962|Ga0307479_10796282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium921Open in IMG/M
3300031981|Ga0318531_10567269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300032035|Ga0310911_10082781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1733Open in IMG/M
3300032035|Ga0310911_10845554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium528Open in IMG/M
3300032042|Ga0318545_10356751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300032060|Ga0318505_10012976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3066Open in IMG/M
3300032066|Ga0318514_10306357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium840Open in IMG/M
3300032067|Ga0318524_10652781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium554Open in IMG/M
3300032068|Ga0318553_10708267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300032090|Ga0318518_10026015All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2633Open in IMG/M
3300032174|Ga0307470_10032242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2506Open in IMG/M
3300032205|Ga0307472_102319502All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300032261|Ga0306920_100909532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium1286Open in IMG/M
3300033290|Ga0318519_10637045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium649Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.40%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.40%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.40%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.60%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.60%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.80%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.80%
Fungus GardenHost-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.80%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.80%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502000Fungus garden microbial communities from Atta colombica in Panama - dump bottomHost-AssociatedOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000580Forest soil microbial communities from Amazon forest - 2010 replicate II A01EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001977Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5Host-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006186Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4Host-AssociatedOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010863Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032042Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ACODB_213833002040502000Fungus GardenVLGVPFSWPPFTVLQAGAVLAIAFSAILGLAGAFLPAWRVRRMAPYALIQTEGRAT
KansclcFeb2_008064202124908045SoilPPAAVLQTGAVLAIVFSAVLGLIGAFLPAWRVRRMAPYALIQAEGR
ICChiseqgaiiDRAFT_084935613300000033SoilPLAVLQISAVLAVSFSAVLGLVGAFLPAWRARRMAPYALIQAEGR*
AF_2010_repII_A01DRAFT_105953423300000580Forest SoilAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR*
JGI1027J12803_10172795413300000955SoilAVLQVGAIVAIAFSALLGLAGALLPAWRVRRMAPYALIQSEAH*
C688J18823_1002024453300001686SoilPPLAVLQISAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR*
JGI24746J21847_104040523300001977Corn, Switchgrass And Miscanthus RhizosphereQISAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR*
Ga0062592_10086497013300004480SoilVLQISAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR*
Ga0066395_1014860123300004633Tropical Forest SoilQIGAVLAIVFSAVLGLAGAFLPAWRVRRMAPYALIQAEGR*
Ga0066395_1083143813300004633Tropical Forest SoilLGIPFSWPPFAILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR*
Ga0066815_1005582523300005164SoilLVVLQAAAVLAVVFSAVLGLIGAFLPAWRVRRTAPYALIPAEAQAT*
Ga0066809_1008100923300005168SoilISAILAISFSAILGLAGAFLPAWRARRMAPYALIQAEGR*
Ga0066388_10775026113300005332Tropical Forest SoilLEIGALAALAFSALLGLLGAALPAWRARCMAPYALIRSEAR*
Ga0066681_1043861223300005451SoilWPPAAVLEAGAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR*
Ga0070698_10168318323300005471Corn, Switchgrass And Miscanthus RhizosphereLAVLQVGAIVAIVFSAILGLVGALLPAWRVRRMAPYALIQTEGR*
Ga0066905_10089977023300005713Tropical Forest SoilAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR*
Ga0066905_10145593313300005713Tropical Forest SoilAIIAVAFSALLGLVGAFLPAWRVRRMAPYELILAEGR*
Ga0066903_10564913823300005764Tropical Forest SoilVALTFSAALGLVGAFIPAWRVRRIAPYALIQAENAVK*
Ga0066696_1004101013300006032SoilGAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR*
Ga0075365_1005527613300006038Populus EndosphereFSWPPFTVLQAGAVLAIAFSAILGLAGAFLPAWRVRRMAPYTLIQTEGRPT*
Ga0075369_1061860923300006186Populus EndosphereVLQISAILAISFSTILGLVGAFLPAWRARRMAPYALIQAEGR*
Ga0074049_1305466923300006580SoilPMIVFSAILGLLGALLPAWRVRRMAPDALIHAEGR*
Ga0075428_10195111923300006844Populus RhizosphereGFYFALAGVPFSWPPAAVLEAAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR*
Ga0075431_10177054523300006847Populus RhizospherePLAVLQISAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR*
Ga0075433_1149778623300006852Populus RhizosphereYFALAGVPFSWPPAAVLEAAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR*
Ga0075425_10122684713300006854Populus RhizosphereVLEAAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR*
Ga0075434_10108822423300006871Populus RhizosphereLAIVFSAVLGLVGALLPAWRVRRMAPYALIQTEGR*
Ga0126374_1059203713300009792Tropical Forest SoilFRLLGIPFSWPPPAILETGAVVAVAFSAVLGLVGAFVPAWRVLGMAPYALIQAEVR*
Ga0126384_1168240123300010046Tropical Forest SoilLAIVFSAVLGLIGAVLPAWRVRRMAPYALIQAEER*
Ga0126373_1326148323300010048Tropical Forest SoilYFGLLGIPFSWPPFAILEAGAVLAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR*
Ga0134065_1043500013300010326Grasslands SoilGFYFALLGVPFSWPPAAVLEAGAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR*
Ga0126376_1235867413300010359Tropical Forest SoilIVLQLGSLTAIGLSAGLGLVGAFLPAWRVRRTEPYALVQTEAR*
Ga0126372_1138998523300010360Tropical Forest SoilFSWPPFAILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR*
Ga0126372_1209873013300010360Tropical Forest SoilLLGIPFAWPPLSVLPAIAVLALAFSALLGLVGALLPAWRVRRLAPYELIQAEGR*
Ga0126378_1144562113300010361Tropical Forest SoilPFAILEAGAVLAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR*
Ga0126377_1092854823300010362Tropical Forest SoilLQLGSVTAIGLSTVLGLAGAFLPAWRVRRTAPYALVQTEAR*
Ga0126377_1142386913300010362Tropical Forest SoilPFSWPPAAVIETGAVLAIVCSVALGLLGAFMPAWRVRRMAPYALIQADAR*
Ga0126383_1284644713300010398Tropical Forest SoilPAAVLQAGALLVIMFSVLLGLLGAFVPAWRVRRMAPYALIQSEAR*
Ga0134122_1011160933300010400Terrestrial SoilEAAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR*
Ga0124850_102242613300010863Tropical Forest SoilQASALLAIVFSAVLGLAGAFLPAWRVRRMAPYALIQAEGR*
Ga0137464_117152913300011434SoilGVPFSWPPFAVLQTAAIVAIAFSTILGLVGAFLPAWRVRRMAPYELIRAEGR*
Ga0137364_1003344433300012198Vadose Zone SoilPAAVLEAGALLAIVFSVALGLLGAFLPAWRVRRMEPYALIQAEAR*
Ga0137383_1123783723300012199Vadose Zone SoilVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR*
Ga0137379_1166260113300012209Vadose Zone SoilPLAVLQVTVLAALVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR*
Ga0150985_10883040123300012212Avena Fatua RhizosphereLAISFSAVLGLVGAFLPAWRARRMAPYALIQAEGQ*
Ga0137369_1032688723300012355Vadose Zone SoilVPFSWPPAAVLEAGALLAIVFSVTLGLLGAFLPAWRVRRMEPYALIQAEAR*
Ga0137360_1134827413300012361Vadose Zone SoilAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQMEGR*
Ga0157301_1045292523300012911SoilSSAILAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR*
Ga0137407_1209582023300012930Vadose Zone SoilLIFARTLGFYFGQLGIPFSWPPLAILEIGGGVAVAASAILGLARASMPAWRVCRKAPYALIQPEAR*
Ga0126369_1085116213300012971Tropical Forest SoilGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR*
Ga0134077_1051745413300012972Grasslands SoilAVLEAGAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR*
Ga0132255_100007303153300015374Arabidopsis RhizosphereFIVLQAGAVLAIAFSAILGLAGAFLPAWRVRRMAPYPLIQTEGRAT*
Ga0182036_1190678623300016270SoilAVLQLSVFMALGFSVILGLVGAFVPAWRVRQLPPHALIQTEAR
Ga0182041_1138826213300016294SoilPAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0182033_1187537423300016319SoilGALLVIMFSVLLGVLGAFVPAWRVRRMAPYALIQSEAR
Ga0182035_1175613623300016341SoilSWPPAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR
Ga0182032_1006651913300016357SoilQASALLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0182034_1052542223300016371SoilLGIPFSWPPFAILETGAVVAVTFSATLGLVGAFVPAWRVRGMAPYGLIQAEVR
Ga0182037_1016354623300016404SoilGFYFALLGVPFSWPPAAVLQAGALLVIMFSVLLGLLGAFVPAWRVRRMAPYALIQSEAR
Ga0182039_1066262013300016422SoilSALLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0182039_1182166023300016422SoilFSWPPAAVLQIGAVLAIVFSAVLGLVGAFLQAWRVRRMAPYALIQAEGR
Ga0182038_1052201913300016445SoilGLLGIPFSWPPFAILETGAIVAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR
Ga0184623_1042104113300018056Groundwater SedimentQTAAIVAIAFSTILGLVGAFLPAWRVRRMAPYELIQAEGR
Ga0066667_1158263413300018433Grasslands SoilWPPGAVPQGAAALAIVFSVTLGFLGAFVPAWRVRRMAPYALIQAEAR
Ga0210399_1041950213300020581SoilLALLQESAVVAVVFSAVLGLVGSFLPAWRARGLDPYALIQTQVR
Ga0210386_1027732923300021406SoilVAIAFSGILGLVGAFVPAWRVRQLAPHALIQAEVR
Ga0210394_1058000113300021420SoilGIPFSWPPPAILEAGSGVAVVLSAILGLLGAFLPAWRVRRMAPHALIQTEAR
Ga0210392_1006208413300021475SoilVPFSWPPLPVLQVSALVAIVFSAILGLLGALLPAWRVRRMAPDALIHAEGR
Ga0126371_1237050713300021560Tropical Forest SoilLAIVFSALLGLIGAFLPAWRVRRMAPYALIQAEGR
Ga0207710_1068078523300025900Switchgrass RhizosphereWPPLSVLQAGALVALVFSALLGLVGALLPAWRVRRMAPHALIQSEGR
Ga0209057_105524533300026342SoilFALLGVPFSWPPAAVLEAGAVLAIVFSVVLGLLGAFVPAWRVRRMAPYALIQAEAR
Ga0209813_1048610413300027866Populus EndosphereLALSFSAVLGLVGAFLPAWRARRMAPYALIQAEGR
Ga0209465_1049286813300027874Tropical Forest SoilLLGIPFSWPPLAILETSALVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR
Ga0209006_1081776113300027908Forest SoilPFSWPPLPVLQVSALVAIVFSAILGLLGALLPAWRVRRMAPDALIHAEGR
Ga0307498_1038178823300031170SoilAVLAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR
Ga0307500_1024393613300031198SoilLAVLQISAVLAISFSAILGLVGAFLPAWRARRMAPYALIQAEGR
Ga0170818_10111668823300031474Forest SoilVLQVTALVAIAFSGILGVLGALLPAWRVRRMAPDALIHAEGR
Ga0318534_1041533513300031544SoilVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR
Ga0318541_1026847513300031545SoilLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0318541_1055531623300031545SoilFSWPPFAILETGAIVAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR
Ga0310915_1025112413300031573SoilPAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR
Ga0318574_1020993013300031680SoilAILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR
Ga0318572_1097184813300031681SoilETGAIVAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR
Ga0310686_10316574093300031708SoilLQASAVVAVLFSGIIGLLGAFVPAWRVRRMAPYALIQSDTLR
Ga0306917_1034997023300031719SoilILETGAVVAVAFSAALGLVGAFVPAWRVRAMAPYALIQAEVH
Ga0306917_1089298523300031719SoilILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR
Ga0306917_1153200923300031719SoilLGVPFSWPPAAVLQIGAGLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0306918_1000042713300031744SoilGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0306918_1041674413300031744SoilSWPPFAILETGAIVAVAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR
Ga0318502_1031430723300031747SoilLETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR
Ga0318554_1062025223300031765SoilAVVAVIFSAALGLVGAFVPAWRVRGMAPYALIQAEVR
Ga0318509_1074834223300031768SoilIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0318509_1081898313300031768SoilPFAILATGATVAVAFSATLGLAGAFVPAWRVRGMAPYALIQAEVR
Ga0318547_1005576433300031781SoilVLQIGAVLAIVFSAVLGLVGAFLQAWRVRRMAPYALIQAEGR
Ga0318529_1002692313300031792SoilAALALSALLGLLGAALPAWRARRMAPFALIRSEAR
Ga0318557_1054688313300031795SoilLLGVPFSWPPAAVLQIGAGLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0318497_1018098213300031805SoilLEIGSLAALALSALLGLLGAALPAWRARRMAPYALIRSEAR
Ga0318568_1048999513300031819SoilVPFSWPPAAVLQAGALLVIMFSVLLGLLGAFVPAWRVRRMAPYALIQSEAR
Ga0318512_1001020713300031846SoilLLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0306919_1129427713300031879SoilASLLLLFDRSLGFWFAMLGIPFSWPPAGVLLASAAVAVLVSALLGLLGAFVPAWRVRRMPPYALIQPEVPG
Ga0306925_1148575913300031890SoilLGFYFGLLGIPFSWPPFAILETGAIVAAAFSATLGLVGAFVPAWRVRGMAPYALIQAEVR
Ga0318522_1023887823300031894SoilETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR
Ga0318551_1084376423300031896SoilGFYFGLLGIPFSWPPFAILETGAVVAVTFSAALGLVGAFVPAWRVRGMAPYALIQVEVR
Ga0318520_1063839123300031897SoilPPAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0318520_1080508413300031897SoilVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQMEGR
Ga0306921_1099362713300031912SoilPFSWPPAGVLQASAAVAMLVSALLGLVGAFVPAWRVRRMPPYALIQPEVPG
Ga0310885_1026632223300031943SoilQISAILAISFSTILGLVGAFLPAWRARRMAPYALIQAEGR
Ga0310910_1094427513300031946SoilFSWPPFAILATGATVAVAFSATLGLAGAFVPAWRVRGMAPYALIQAEVR
Ga0306926_1102199513300031954SoilWPPFAILETGAVVAVAFSAILGLVGAFVPAWRVRRMAPYALIQAEVR
Ga0306926_1250455123300031954SoilLGISFSWPPPGILQASAIAALVFSAILGVVGAFVPAWRVRRMAPYALIQAEAR
Ga0306926_1251972413300031954SoilQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQMEGR
Ga0307479_1079628213300031962Hardwood Forest SoilPFSWPPLTILETGAVVAVAFSAILGLVGAFVPAWRVRRMAPYTLIQTEVG
Ga0318531_1056726913300031981SoilIPFSWPPFAILATGATVAVAFSATLGLAGAFVPAWRVRGMAPYALIQAEVR
Ga0310911_1008278123300032035SoilGLLGIPFSWPPFAILETGAILTVTFSAALGLVGAFVPAWRACGMAPYALIQAEVC
Ga0310911_1084555423300032035SoilVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR
Ga0318545_1035675113300032042SoilPPAAVLQIGAGLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQAEGR
Ga0318505_1001297613300032060SoilLETGAVVAVIFSAALGLVGAFVPAWRVRGMAPYALIQVEVR
Ga0318514_1030635723300032066SoilSWPPFAILETGAVVAITFSAALGLVGAFVPAWRVRGMAPYALIQVEVR
Ga0318524_1065278113300032067SoilFSWPPAAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR
Ga0318553_1070826723300032068SoilLGVPFSWPPAAVLQAGALLVIMFSVLLGLLGAFVPAWRVRRMAPYALIQSEAR
Ga0318518_1002601513300032090SoilAVLQIGAVLAIVFSAVLGLVGAFLPAWRVRRMAPYALIQTEGR
Ga0307470_1003224213300032174Hardwood Forest SoilFSWPPPAILEAGSGVAVVLSASLGLLGAFLPAWRVRRMAPHALIQTEAR
Ga0307472_10231950213300032205Hardwood Forest SoilVPFSWPPPAVLHAGAILAIVFSAILGLVGAFLPAWRVRRMAPYALIQRDGR
Ga0306920_10090953223300032261SoilSAAVALLLSALLGLLGAFVPAWRVRRVAPYALIQPEAPG
Ga0318519_1063704523300033290SoilFGLLGIPFFWPPFAILETGAIVAVTFSATLGLVGAFVPAWRACGMAPYALIQAEVR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.