Basic Information | |
---|---|
Family ID | F068108 |
Family Type | Metagenome |
Number of Sequences | 125 |
Average Sequence Length | 41 residues |
Representative Sequence | MSVMLVCLVLWAATGAVALLFAAVLAGLGVLYVVLLTNL |
Number of Associated Samples | 35 |
Number of Associated Scaffolds | 125 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 17.60 % |
% of genes near scaffold ends (potentially truncated) | 24.80 % |
% of genes from short scaffolds (< 2000 bps) | 92.80 % |
Associated GOLD sequencing projects | 33 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.800 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (63.200 % of family members) |
Environment Ontology (ENVO) | Unclassified (64.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (68.800 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 125 Family Scaffolds |
---|---|---|
PF12680 | SnoaL_2 | 3.20 |
PF05239 | PRC | 1.60 |
PF00313 | CSD | 1.60 |
PF06803 | DUF1232 | 1.60 |
PF13426 | PAS_9 | 0.80 |
PF03551 | PadR | 0.80 |
PF01979 | Amidohydro_1 | 0.80 |
PF00903 | Glyoxalase | 0.80 |
PF13472 | Lipase_GDSL_2 | 0.80 |
PF13545 | HTH_Crp_2 | 0.80 |
PF03819 | MazG | 0.80 |
PF08450 | SGL | 0.80 |
PF10823 | DUF2568 | 0.80 |
PF02673 | BacA | 0.80 |
PF00563 | EAL | 0.80 |
PF02517 | Rce1-like | 0.80 |
PF08592 | Anthrone_oxy | 0.80 |
PF12681 | Glyoxalase_2 | 0.80 |
PF00685 | Sulfotransfer_1 | 0.80 |
PF13147 | Obsolete Pfam Family | 0.80 |
PF08241 | Methyltransf_11 | 0.80 |
PF01548 | DEDD_Tnp_IS110 | 0.80 |
PF07883 | Cupin_2 | 0.80 |
PF13340 | DUF4096 | 0.80 |
PF10604 | Polyketide_cyc2 | 0.80 |
PF13205 | Big_5 | 0.80 |
PF03061 | 4HBT | 0.80 |
PF00561 | Abhydrolase_1 | 0.80 |
PF13564 | DoxX_2 | 0.80 |
PF00582 | Usp | 0.80 |
PF13561 | adh_short_C2 | 0.80 |
COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
---|---|---|---|
COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 1.60 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.80 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.80 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.80 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.80 |
COG1968 | Undecaprenyl pyrophosphate phosphatase | Lipid transport and metabolism [I] | 0.80 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.80 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.80 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.80 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.80 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.80 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.80 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.80 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.80 % |
All Organisms | root | All Organisms | 43.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002568|C688J35102_120979172 | All Organisms → cellular organisms → Bacteria | 4582 | Open in IMG/M |
3300005562|Ga0058697_10027796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium | 2032 | Open in IMG/M |
3300005562|Ga0058697_10073210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1365 | Open in IMG/M |
3300005562|Ga0058697_10100980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1196 | Open in IMG/M |
3300005562|Ga0058697_10122201 | All Organisms → Viruses → Predicted Viral | 1106 | Open in IMG/M |
3300005562|Ga0058697_10128548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1083 | Open in IMG/M |
3300005562|Ga0058697_10176626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
3300005562|Ga0058697_10213117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 881 | Open in IMG/M |
3300005562|Ga0058697_10298851 | Not Available | 767 | Open in IMG/M |
3300005562|Ga0058697_10475538 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300005562|Ga0058697_10479082 | Not Available | 631 | Open in IMG/M |
3300005562|Ga0058697_10596119 | Not Available | 576 | Open in IMG/M |
3300005981|Ga0081538_10089455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1598 | Open in IMG/M |
3300005981|Ga0081538_10114717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1312 | Open in IMG/M |
3300006169|Ga0082029_1308671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1929 | Open in IMG/M |
3300006876|Ga0079217_11446704 | Not Available | 540 | Open in IMG/M |
3300006894|Ga0079215_11120537 | Not Available | 591 | Open in IMG/M |
3300006918|Ga0079216_10456138 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300006918|Ga0079216_11295779 | Not Available | 594 | Open in IMG/M |
3300007004|Ga0079218_10724709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces brasiliscabiei | 938 | Open in IMG/M |
3300009789|Ga0126307_10186144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1665 | Open in IMG/M |
3300009789|Ga0126307_10202866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1591 | Open in IMG/M |
3300009789|Ga0126307_10254488 | Not Available | 1412 | Open in IMG/M |
3300009789|Ga0126307_10282257 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300009789|Ga0126307_10434149 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
3300009789|Ga0126307_10519119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 962 | Open in IMG/M |
3300009789|Ga0126307_10679195 | Not Available | 831 | Open in IMG/M |
3300009789|Ga0126307_10681503 | Not Available | 829 | Open in IMG/M |
3300009789|Ga0126307_10756738 | Not Available | 784 | Open in IMG/M |
3300009789|Ga0126307_11159550 | Not Available | 625 | Open in IMG/M |
3300009789|Ga0126307_11573952 | Not Available | 533 | Open in IMG/M |
3300009840|Ga0126313_10200995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1529 | Open in IMG/M |
3300009840|Ga0126313_10218072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 1470 | Open in IMG/M |
3300009840|Ga0126313_10886510 | Not Available | 728 | Open in IMG/M |
3300009840|Ga0126313_10944837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
3300009840|Ga0126313_11146937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300009840|Ga0126313_11594642 | Not Available | 543 | Open in IMG/M |
3300009840|Ga0126313_11656879 | Not Available | 533 | Open in IMG/M |
3300010036|Ga0126305_10157093 | Not Available | 1418 | Open in IMG/M |
3300010036|Ga0126305_10280984 | All Organisms → Viruses → Predicted Viral | 1077 | Open in IMG/M |
3300010036|Ga0126305_10489582 | Not Available | 819 | Open in IMG/M |
3300010036|Ga0126305_10737978 | Not Available | 667 | Open in IMG/M |
3300010036|Ga0126305_10823957 | Not Available | 631 | Open in IMG/M |
3300010036|Ga0126305_10942232 | Not Available | 590 | Open in IMG/M |
3300010037|Ga0126304_10057285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2381 | Open in IMG/M |
3300010037|Ga0126304_10085840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 1970 | Open in IMG/M |
3300010037|Ga0126304_10155091 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
3300010037|Ga0126304_10688625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter marinus | 690 | Open in IMG/M |
3300010037|Ga0126304_10797863 | Not Available | 640 | Open in IMG/M |
3300010037|Ga0126304_10869727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Geminicoccaceae → Geminicoccus → Geminicoccus roseus | 612 | Open in IMG/M |
3300010037|Ga0126304_10940257 | Not Available | 588 | Open in IMG/M |
3300010038|Ga0126315_10054406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 2183 | Open in IMG/M |
3300010038|Ga0126315_10115191 | Not Available | 1558 | Open in IMG/M |
3300010038|Ga0126315_11177095 | Not Available | 520 | Open in IMG/M |
3300010038|Ga0126315_11245286 | Not Available | 506 | Open in IMG/M |
3300010038|Ga0126315_11245524 | Not Available | 506 | Open in IMG/M |
3300010040|Ga0126308_10147693 | Not Available | 1482 | Open in IMG/M |
3300010040|Ga0126308_10198818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1287 | Open in IMG/M |
3300010040|Ga0126308_10299680 | Not Available | 1056 | Open in IMG/M |
3300010040|Ga0126308_10519719 | Not Available | 806 | Open in IMG/M |
3300010040|Ga0126308_10728055 | Not Available | 683 | Open in IMG/M |
3300010040|Ga0126308_10796830 | Not Available | 654 | Open in IMG/M |
3300010040|Ga0126308_11244138 | Not Available | 528 | Open in IMG/M |
3300010041|Ga0126312_10338252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1065 | Open in IMG/M |
3300010041|Ga0126312_10814610 | Not Available | 678 | Open in IMG/M |
3300010041|Ga0126312_10900905 | Not Available | 644 | Open in IMG/M |
3300010041|Ga0126312_11091382 | Not Available | 586 | Open in IMG/M |
3300010042|Ga0126314_10086121 | Not Available | 2114 | Open in IMG/M |
3300010042|Ga0126314_10455645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 925 | Open in IMG/M |
3300010042|Ga0126314_10464602 | Not Available | 916 | Open in IMG/M |
3300010042|Ga0126314_11269548 | Not Available | 551 | Open in IMG/M |
3300010042|Ga0126314_11373870 | Not Available | 530 | Open in IMG/M |
3300010044|Ga0126310_10068886 | Not Available | 2040 | Open in IMG/M |
3300010044|Ga0126310_10303977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1100 | Open in IMG/M |
3300010044|Ga0126310_10352273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 1033 | Open in IMG/M |
3300010044|Ga0126310_10569427 | Not Available | 839 | Open in IMG/M |
3300010044|Ga0126310_10639437 | Not Available | 798 | Open in IMG/M |
3300010044|Ga0126310_10668322 | Not Available | 783 | Open in IMG/M |
3300010044|Ga0126310_10684531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 775 | Open in IMG/M |
3300010044|Ga0126310_11546637 | Not Available | 546 | Open in IMG/M |
3300010044|Ga0126310_11690548 | Not Available | 525 | Open in IMG/M |
3300010045|Ga0126311_10170509 | Not Available | 1567 | Open in IMG/M |
3300010045|Ga0126311_10439161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1011 | Open in IMG/M |
3300010045|Ga0126311_10543336 | Not Available | 914 | Open in IMG/M |
3300010045|Ga0126311_10674409 | Not Available | 824 | Open in IMG/M |
3300010045|Ga0126311_10743704 | Not Available | 787 | Open in IMG/M |
3300010045|Ga0126311_10935796 | Not Available | 705 | Open in IMG/M |
3300010045|Ga0126311_11866906 | Not Available | 510 | Open in IMG/M |
3300010166|Ga0126306_10053793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 2797 | Open in IMG/M |
3300010166|Ga0126306_10083012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2285 | Open in IMG/M |
3300010166|Ga0126306_10212292 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
3300010166|Ga0126306_10369735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1117 | Open in IMG/M |
3300010166|Ga0126306_10570178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter marinus | 900 | Open in IMG/M |
3300010166|Ga0126306_10790465 | Not Available | 765 | Open in IMG/M |
3300010166|Ga0126306_10993209 | Not Available | 684 | Open in IMG/M |
3300010166|Ga0126306_11081142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium | 656 | Open in IMG/M |
3300010166|Ga0126306_11239712 | Not Available | 614 | Open in IMG/M |
3300010166|Ga0126306_11293221 | Not Available | 601 | Open in IMG/M |
3300010166|Ga0126306_11789036 | Not Available | 514 | Open in IMG/M |
3300014487|Ga0182000_10102731 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300014487|Ga0182000_10491923 | Not Available | 568 | Open in IMG/M |
3300018422|Ga0190265_11467477 | Not Available | 796 | Open in IMG/M |
3300018432|Ga0190275_11308673 | Not Available | 801 | Open in IMG/M |
3300018469|Ga0190270_10116768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 2087 | Open in IMG/M |
3300018469|Ga0190270_10322593 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300018476|Ga0190274_11530684 | Not Available | 759 | Open in IMG/M |
3300019377|Ga0190264_10920986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae | 686 | Open in IMG/M |
3300019767|Ga0190267_10094845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1169 | Open in IMG/M |
3300019767|Ga0190267_10730814 | Not Available | 643 | Open in IMG/M |
3300027750|Ga0209461_10102446 | Not Available | 651 | Open in IMG/M |
3300030510|Ga0268243_1039227 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300030510|Ga0268243_1147611 | Not Available | 568 | Open in IMG/M |
3300030516|Ga0268255_10213176 | Not Available | 558 | Open in IMG/M |
3300031731|Ga0307405_11583717 | Not Available | 578 | Open in IMG/M |
3300031911|Ga0307412_11132023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 698 | Open in IMG/M |
3300031911|Ga0307412_11268502 | Not Available | 662 | Open in IMG/M |
3300032002|Ga0307416_101811764 | Not Available | 714 | Open in IMG/M |
3300032004|Ga0307414_11861341 | Not Available | 562 | Open in IMG/M |
3300032126|Ga0307415_100484225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1078 | Open in IMG/M |
3300032159|Ga0268251_10036730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1548 | Open in IMG/M |
3300032159|Ga0268251_10096629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1047 | Open in IMG/M |
3300032159|Ga0268251_10233106 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300032159|Ga0268251_10324855 | Not Available | 645 | Open in IMG/M |
3300032159|Ga0268251_10331406 | Not Available | 640 | Open in IMG/M |
3300032159|Ga0268251_10396346 | Not Available | 596 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 63.20% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 14.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.40% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.80% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.20% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.60% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.80% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.80% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
3300030516 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J35102_1209791724 | 3300002568 | Soil | MSVMLVCLVLWAATGAVSLLFAAVLAGLGVLYVVLLINR* |
Ga0058697_100277962 | 3300005562 | Agave | LMSVMLVCLVLWAATGAVALLFGAVLAALGVLYMVLLTNL* |
Ga0058697_100732101 | 3300005562 | Agave | GNTLGWVLWALMSVMLVCLVLWAATGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0058697_101009802 | 3300005562 | Agave | MSVMLVCLVLWAATGAVALLFGAVLAALGVLYVVLLTNL* |
Ga0058697_101222012 | 3300005562 | Agave | LMSVMLICLVLWAATGAVPLLFGAVVAGLGVLYVVLLINR* |
Ga0058697_101285484 | 3300005562 | Agave | LGWVVWALFSVMLLCLVLWAATGAVALLFAAVLAALGVLYVVLFTNL* |
Ga0058697_101766262 | 3300005562 | Agave | LMSVMLVCLLLWAATGAVVLLFAAVLAALGVLYVVLLTNL* |
Ga0058697_102131171 | 3300005562 | Agave | WALMSVMLICLVLWAATGAVVLLFAAVLAALGVLYVVLLINR* |
Ga0058697_102988511 | 3300005562 | Agave | LVWVVLLLVMLACLLLWASTGAAVLFFVALVAGLGVLYVGLFTDL* |
Ga0058697_104755382 | 3300005562 | Agave | LMSVMLICLVLWAATGAVALLFAAVLAGLRVLYVVLLINR* |
Ga0058697_104790821 | 3300005562 | Agave | LMSVMLVCIVLWALTGTVALLFAAVLAALGVLYVVLLTNL* |
Ga0058697_105961191 | 3300005562 | Agave | LMSVMLVCLVLWAATGAVVLLFAAVLAALGVLYVVLLTNL* |
Ga0081538_100894552 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSVMLVCLLLWAATGAVALLFGAVLAGLGVLYVVLLTNL* |
Ga0081538_101147171 | 3300005981 | Tabebuia Heterophylla Rhizosphere | LSWVVWALISVMLVCILLWAATGAVALLFGAVLAGLGVIYVVLLTNL* |
Ga0082029_13086714 | 3300006169 | Termite Nest | LGWVVWALMSVMLVCLLLWAATGAVPLLFGAVLAALGVLYVVLLTNL* |
Ga0079217_114467042 | 3300006876 | Agricultural Soil | LMSVMLICLVLWEATGAVPLLFAAVLAGLRVLYVVLLINR* |
Ga0079215_111205371 | 3300006894 | Agricultural Soil | LLSVMLVSIVLWALTGTVALLFAAVLAGLGVLYLVLLTNL* |
Ga0079216_104561381 | 3300006918 | Agricultural Soil | LVWVVWALMSVMLVCLLLWAATGAVPLLFAAVLAGLGVLYVVLLTNL* |
Ga0079216_112957792 | 3300006918 | Agricultural Soil | MSVMVVCLVLWAATGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0079218_107247091 | 3300007004 | Agricultural Soil | LMSVMLVCLVLWAATGAVPLLFAAVLAGLGVLYVVLLTNL* |
Ga0126307_101861444 | 3300009789 | Serpentine Soil | MLVCLLLWAATSSFPLLFAAVMAGLGLLYVVLFTDL* |
Ga0126307_102028662 | 3300009789 | Serpentine Soil | MSVMLVCLLLWALTGAVWLLFGAVLAGVGVLYVVLLTNL* |
Ga0126307_102544882 | 3300009789 | Serpentine Soil | MSVMLISLVLWAATGAVPLLFAAMLAGLRVLYVVLLINR* |
Ga0126307_102822572 | 3300009789 | Serpentine Soil | MLVCIVLWASTGAVALLFAAVPDTLVMLYVVLFTNF* |
Ga0126307_104341491 | 3300009789 | Serpentine Soil | MSVMLVCLVLWAATGAVPLLFAAVLAGLGVLYVVLLTNL* |
Ga0126307_105191192 | 3300009789 | Serpentine Soil | LVWVVWILLSVMLLCMVLWALTGTVALLFAAVLAGLGGLYVVLFTNL* |
Ga0126307_106791953 | 3300009789 | Serpentine Soil | MLACLVLWALTGAVPLLFAAVMVGLGVLYMVLFTNL* |
Ga0126307_106815032 | 3300009789 | Serpentine Soil | MSVMLVCLVLWAATGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0126307_107567382 | 3300009789 | Serpentine Soil | LVWVVWVLLSVMLVCLLLWAVTTAVPLLFAAVLAGLGVRYVVLFTNL* |
Ga0126307_111595501 | 3300009789 | Serpentine Soil | MSVMLLCFVLWAATGAVALLFAAVLAALGVLYVVLTNL* |
Ga0126307_115739521 | 3300009789 | Serpentine Soil | VCLVLWAATGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0126313_102009953 | 3300009840 | Serpentine Soil | LVWVVWILLSVMLLCIVLWALTGTVALLFAAVLAGLGGLYVVLFTNL* |
Ga0126313_102180723 | 3300009840 | Serpentine Soil | MLACLLLWALTGAVPLLFAAVLVGLGVLYMVLFTNL* |
Ga0126313_108865102 | 3300009840 | Serpentine Soil | MSVMLVSIVLWAATGAVWLLFGAVLAGLGVLYIVLVTNL* |
Ga0126313_109448372 | 3300009840 | Serpentine Soil | MSVMLVCLLLWAATGAVTLLIAAVLAALGVLYVVLLTNL* |
Ga0126313_111469371 | 3300009840 | Serpentine Soil | MSVMLVSIVLWAATGAVAVLFAAVLAGLGGLYVVLLTNL* |
Ga0126313_115946422 | 3300009840 | Serpentine Soil | VWALMSVMLLCLVLWAATGAVALLFAAVPAALGVLYVVLLTNL* |
Ga0126313_116568791 | 3300009840 | Serpentine Soil | MLVCLVLWAATGAVPLLFAAVLAGLGVLYVVLLTNL* |
Ga0126305_101570932 | 3300010036 | Serpentine Soil | MLVCLVLWVVTGVVPLLFAAVLAALGMLYMVLFTNL* |
Ga0126305_102809841 | 3300010036 | Serpentine Soil | MSVMLVCLVLWATTGAVALLFGAVLAGLGVLYVVLLTNL* |
Ga0126305_104895822 | 3300010036 | Serpentine Soil | MSVMLVCLLLWASTGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0126305_107379782 | 3300010036 | Serpentine Soil | LVWVVWILLSVMLVCIVLWAATGAVALLFAAVLAGLGVLYVALFTNL* |
Ga0126305_108239572 | 3300010036 | Serpentine Soil | MLACLVLWALTGAVWLLFAAVLVGLGVLYMVLFTNL* |
Ga0126305_109422323 | 3300010036 | Serpentine Soil | ALMSVMLLCLVLWAATGAVALLFAAVLAALGVLYVVLLTNLQRPL* |
Ga0126304_100572852 | 3300010037 | Serpentine Soil | MSVMLICLVLWAATGAVPLLFAAVLAGLRVLYVVLLINR* |
Ga0126304_100858402 | 3300010037 | Serpentine Soil | MTVMLVCLVLWAATGAVALLFAAVLAGLGVLYVALLTNL* |
Ga0126304_101550912 | 3300010037 | Serpentine Soil | MSVMLVCLVLWAATGAVPLLFAAVLAALRVLYVVLLTNL* |
Ga0126304_106886251 | 3300010037 | Serpentine Soil | MLVCLLLWALTGTVPLLFAAVLVGLGVLYVVLFTNL* |
Ga0126304_107978632 | 3300010037 | Serpentine Soil | VVWALMSVMLLCLVLWAATGAVALLFAAVLAALGVLYVVLLTNL* |
Ga0126304_108697271 | 3300010037 | Serpentine Soil | MLVCLVLWAATGVVALLFGAVVAGLGVLYMVLFTNS* |
Ga0126304_109402573 | 3300010037 | Serpentine Soil | LMSVMLLCLVLWAATGAVALLFAAVLAALGVLYVVLLTNLQRPL* |
Ga0126315_100544064 | 3300010038 | Serpentine Soil | LVWVVWILLSVMLLCIVLWALTGTVALLFAAVLAGLGGLYVVLLTNL* |
Ga0126315_101151913 | 3300010038 | Serpentine Soil | MSVMLVCLFLWALTGAVWLLFGAVLAGLGVLYVVLLTNL* |
Ga0126315_111770952 | 3300010038 | Serpentine Soil | MSVMLVCLVLWAATGAVALLFAAVLAALGVLYVVLLTNL* |
Ga0126315_112452861 | 3300010038 | Serpentine Soil | LVWVVWVLLSVMLVCLLLWAVTTAVPLLFGAVLAGLGVLYVVLFTNL* |
Ga0126315_112455241 | 3300010038 | Serpentine Soil | TIGWVVWALMSVMLLCLVLWAATGAVALLFAAVPAALGVLYVVLLTNL* |
Ga0126308_101476932 | 3300010040 | Serpentine Soil | MSVMLVSIVLWAATGAVAVLFAAVLAGLGVLYVVLLTNL* |
Ga0126308_101988182 | 3300010040 | Serpentine Soil | MSVMLVCLLLWAATGAVWLLFGAVLAGLGVLYVVLLTNL* |
Ga0126308_102996801 | 3300010040 | Serpentine Soil | MSVMLLCLVLWAATGAVALLFAAVLAALGVLYVVLLTNLQRPL* |
Ga0126308_105197193 | 3300010040 | Serpentine Soil | GWVVWALMSVMLVCLLLWAATGAVWLLFGAVLAGVGVLYVVLLTNL* |
Ga0126308_107280552 | 3300010040 | Serpentine Soil | MSVMLVCLLLWAATGAVALLFGAVLAALGVLYVVLLTNL* |
Ga0126308_107968302 | 3300010040 | Serpentine Soil | MSVMLVCLVLWAATGAVWLLFGAVLAGLGVLYVVLLT |
Ga0126308_112441382 | 3300010040 | Serpentine Soil | GWVVLALMSVMLVCLVLWAATGAVWLLFGAVLAGLGVLYVVLLTNL* |
Ga0126312_103382522 | 3300010041 | Serpentine Soil | MSVMLVCLVLWAATGAVWLLFGAVLAGLGVLYVVLLTNL* |
Ga0126312_108146101 | 3300010041 | Serpentine Soil | MLACLVLWALSGAVWLLFAAVLVGLGVLYMVLFTNL* |
Ga0126312_109009052 | 3300010041 | Serpentine Soil | MSVMLVCIVLWAATGAVALLFGAVLAGLGVLYVVLLTNL* |
Ga0126312_110913822 | 3300010041 | Serpentine Soil | MSVMLVCLLLWAATGAVALLFGAVLAGLGVLYIVLVTNL* |
Ga0126314_100861214 | 3300010042 | Serpentine Soil | MSVMLVCLFLWALTGAVALLFGAVLAGLGVLYVVLLTNL* |
Ga0126314_104556451 | 3300010042 | Serpentine Soil | MSVMLVCLVLWAATGAVWLLFGAVLAGLGVLYVVLLTN |
Ga0126314_104646022 | 3300010042 | Serpentine Soil | MSVMLICLVLWAATGAVPLLFAAVLAGLRVLYVVLLTNL* |
Ga0126314_112695481 | 3300010042 | Serpentine Soil | MSVMLVSLILWAATGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0126314_113738701 | 3300010042 | Serpentine Soil | ALMSVMLVCLVLWAATGAVWLLFGAVLAGLGVLYVVLLTNL* |
Ga0126310_100688865 | 3300010044 | Serpentine Soil | VMLVCLVLWAATGVVPLLFGAVLAGLGVLYVVLLTNL* |
Ga0126310_103039772 | 3300010044 | Serpentine Soil | MLGWVVWGLLSVMLVCILLWAATGAVSLLFAAMLATLVMIYVVLFTNL* |
Ga0126310_103522731 | 3300010044 | Serpentine Soil | LVWVVWILLSVMLVCIVLWAATGAVALLFGAVLAGLGVLYVV |
Ga0126310_105694272 | 3300010044 | Serpentine Soil | MSVMLVCLVLWAATGAVPLLFAAVLATLVMIYEVLL |
Ga0126310_106394371 | 3300010044 | Serpentine Soil | MLVCLLLWAATGAVALLFAAVLAGLGVLYVVLFTNL* |
Ga0126310_106683221 | 3300010044 | Serpentine Soil | LVWVFWVLLSVMLVSIVLWALTGTVALLFAAVLAGLGVLYLVLFTNL* |
Ga0126310_106845312 | 3300010044 | Serpentine Soil | MSVMLVCLVLWAAAGAVALLFTAVLAALGVLYVVLLLNR* |
Ga0126310_115466372 | 3300010044 | Serpentine Soil | MSVMLICLVLWAATGAVPLLFAAVLAGLRVLYVVLLINL* |
Ga0126310_116905481 | 3300010044 | Serpentine Soil | MSVMLICLVLWAATGAVPLLFAAVLAGLRVLYEVLLINR* |
Ga0126311_101705092 | 3300010045 | Serpentine Soil | MLLCLLLWALTGSVPLLFAAVLAGLGVLYVVLFTNL* |
Ga0126311_104391612 | 3300010045 | Serpentine Soil | MSVMLVSLVLWAATGSVALLFGAVLAGLGVLYVVLLTNL* |
Ga0126311_105433361 | 3300010045 | Serpentine Soil | MSVMLICLVLWAATGAVPLLFAAVLAGLRMLYVVLLTNL* |
Ga0126311_106744092 | 3300010045 | Serpentine Soil | MSVMLLCLVLWAATGAVALLFAAVLAALGVLYVVLLTNL* |
Ga0126311_107437041 | 3300010045 | Serpentine Soil | KGNTIGWVVWALMSVMLICLVLWAATGAVPLLFAAVLAGLRVLYEVLLINR* |
Ga0126311_109357961 | 3300010045 | Serpentine Soil | LVWVFWVLLSVMLVSIVLWALTGTVTLLFAAVLAGLGGLYLMLFTNL* |
Ga0126311_118669062 | 3300010045 | Serpentine Soil | WVLLSVMLVCLLLWAATGAVALLFGAVLATLVMIYVVLFTNL* |
Ga0126306_100537932 | 3300010166 | Serpentine Soil | LGWVIWGLLSVMLVCLVLWVATGAVPLLFPAVLGALVMLYTVLLTNL* |
Ga0126306_100830123 | 3300010166 | Serpentine Soil | MSVMLICLVLWAATGAVALLFAAVLAGLRVLYVVLLINR* |
Ga0126306_102122922 | 3300010166 | Serpentine Soil | MLVCLVLWVATGAVALLFAAVLAALVMLYLVLFTNL* |
Ga0126306_103697352 | 3300010166 | Serpentine Soil | MSVMLVCLLLWATTGAVWLLFAAVLAGLGVLYVVLFTNL* |
Ga0126306_105701782 | 3300010166 | Serpentine Soil | MLVCLLLWALTGTVALLFAAVLAGLGGLYVVLFTNL* |
Ga0126306_107904651 | 3300010166 | Serpentine Soil | MTVMLVCLVLWAATGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0126306_109932092 | 3300010166 | Serpentine Soil | WVLLSVLLVCLVLWAATSSFPLLVAAVLAGLGGLCVVLFTNL* |
Ga0126306_110811422 | 3300010166 | Serpentine Soil | LVWVVWILLSVMLVCLLLWASTGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0126306_112397122 | 3300010166 | Serpentine Soil | MSVMLVCLALWASTGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0126306_112932211 | 3300010166 | Serpentine Soil | MLVCLVLWALTGAIPLLFAAVVAGLGVLYMVLFTNS* |
Ga0126306_117890361 | 3300010166 | Serpentine Soil | SVMLVCLLLWASTGAVALLFAAVLAGLGVLYVVLLTNL* |
Ga0182000_101027311 | 3300014487 | Soil | MSVMLVCIVLWAATGAFALLFCAVLAGLGVLYVVL |
Ga0182000_104919232 | 3300014487 | Soil | LVWVVWISLSVMLVCIVLWALTGTVPLLFAAVLAGLGGLYVALFTNL* |
Ga0190265_114674771 | 3300018422 | Soil | TLGWVVWALMSVMVVCLLLWAATGAVALLFAAVLAALGVLYVVLLINL |
Ga0190275_113086732 | 3300018432 | Soil | LMSVMLLCLVLWAATGAVWLLFGAVVAGLGVLYMVLLTNL |
Ga0190270_101167682 | 3300018469 | Soil | MSVMLICLVLWAATGAVPLLFAAVLAGLRVLYVVLLINR |
Ga0190270_103225933 | 3300018469 | Soil | WVVWASMSVMLVCLLLWAATGAVWLLFGAVLAGLGVLYVVLLTNL |
Ga0190274_115306841 | 3300018476 | Soil | MSVMLVCLVLWAATGAVALLFAAVLAALGVLYVVLLTNL |
Ga0190264_109209862 | 3300019377 | Soil | MSVMLVCLLLWAATGAVPLLFAAVLAGLGVLYVVLLTNL |
Ga0190267_100948453 | 3300019767 | Soil | LMSVMLICLVLWAATGAVPLLFAAVLAGLRVLYVVLLINR |
Ga0190267_107308141 | 3300019767 | Soil | MSVMVVCLLLWAATGAFALLFAAVLAALGVLYVVLLTNL |
Ga0209461_101024462 | 3300027750 | Agave | MSVMLVCLVLWAATGAVVLLFAAVLAALGVLYVVLLTNL |
Ga0268243_10392272 | 3300030510 | Soil | MSVMLVCLVLWAATGAVALLFGAVLAALGVLYVVLLTNL |
Ga0268243_11476112 | 3300030510 | Soil | MSVMVVCLLLWAATGAFALLFGAVLAALGVLYVVLL |
Ga0268255_102131761 | 3300030516 | Agave | MSVMLVCIVLWAATGALPLLFGAVVAGLGVLYVVLLTNL |
Ga0307405_115837172 | 3300031731 | Rhizosphere | LMSVMLVCLLLWAATGAVALLFAAVLAALGVLYVVLLTNL |
Ga0307412_111320232 | 3300031911 | Rhizosphere | MSVMLVCLVLWAATGAVWLLFGAVLAALGVLYVVLLTNL |
Ga0307412_112685022 | 3300031911 | Rhizosphere | LGWVIWGLLSVMLVCLVLWAATGAVWLLFGAVLAALGVLYVVLL |
Ga0307416_1018117642 | 3300032002 | Rhizosphere | WVVWALMSVMLLCLVLWAATGAVWLLFGAVVAGLRVLYVVLLINR |
Ga0307414_118613411 | 3300032004 | Rhizosphere | MSVMLVCLVLWATTGAVALLFGAVLAGLGVLYVVLLTNL |
Ga0307415_1004842252 | 3300032126 | Rhizosphere | VWALMSVMLLCLVLWAATGAVWLLFGAVVAGLGVLYMVLLTNL |
Ga0268251_100367302 | 3300032159 | Agave | MSVMLVCLLLWAATGAVVLLFAAVLAALGVLYVVLLTNL |
Ga0268251_100966292 | 3300032159 | Agave | LMSVMLVCLVLWAATGAVALLFGAVLAALGVLYMVLLTNL |
Ga0268251_102331061 | 3300032159 | Agave | LMSVMLVCLVLWAATGAVPLFFAAVVAGLGVLYVVLLTNL |
Ga0268251_103248551 | 3300032159 | Agave | LMSVMLVCLVLWAATGAVALLFGAVLAGLGVLYVVLLTNL |
Ga0268251_103314061 | 3300032159 | Agave | LMSVMLVCLVLWAATGAAALLFGAVLAALGVLYVVLLTNL |
Ga0268251_103963462 | 3300032159 | Agave | LMSVMLICLVLWAATGAVVLLFAAVLAALGVLYVVLLTNL |
⦗Top⦘ |