NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F068175

Metagenome Family F068175

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068175
Family Type Metagenome
Number of Sequences 125
Average Sequence Length 58 residues
Representative Sequence PYLDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN
Number of Associated Samples 114
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.80 %
% of genes near scaffold ends (potentially truncated) 99.20 %
% of genes from short scaffolds (< 2000 bps) 93.60 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.000 % of family members)
Environment Ontology (ENVO) Unclassified
(32.800 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.200 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 10.13%    Coil/Unstructured: 89.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF02630SCO1-SenC 83.20
PF14321DUF4382 10.40
PF00903Glyoxalase 1.60
PF06508QueC 0.80
PF07587PSD1 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG1225PeroxiredoxinPosttranslational modification, protein turnover, chaperones [O] 83.20
COG1999Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC familyPosttranslational modification, protein turnover, chaperones [O] 83.20
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 0.80
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 0.80
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 0.80
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.80
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.80
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 0.80
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 0.80
COG0780NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamilyTranslation, ribosomal structure and biogenesis [J] 0.80
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 0.80


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101809502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300000787|JGI11643J11755_11371449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300000953|JGI11615J12901_10779216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium698Open in IMG/M
3300000955|JGI1027J12803_101021238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1264Open in IMG/M
3300003987|Ga0055471_10215267All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300004022|Ga0055432_10273390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300004114|Ga0062593_102370290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M
3300004463|Ga0063356_104482371All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300005213|Ga0068998_10157603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300005289|Ga0065704_10545066All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300005295|Ga0065707_10246974All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1137Open in IMG/M
3300005330|Ga0070690_100956264All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium673Open in IMG/M
3300005347|Ga0070668_100389219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1188Open in IMG/M
3300005355|Ga0070671_101555291All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300005439|Ga0070711_100870975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium767Open in IMG/M
3300005457|Ga0070662_100503917All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1010Open in IMG/M
3300005467|Ga0070706_100235099All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1711Open in IMG/M
3300005467|Ga0070706_101525973All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium610Open in IMG/M
3300005471|Ga0070698_100440471All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1238Open in IMG/M
3300005540|Ga0066697_10735044All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300005558|Ga0066698_10639211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium711Open in IMG/M
3300005558|Ga0066698_10639212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium711Open in IMG/M
3300005598|Ga0066706_11438376All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300005615|Ga0070702_100021157All Organisms → cellular organisms → Bacteria3419Open in IMG/M
3300005764|Ga0066903_104668263All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300005842|Ga0068858_100673607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1006Open in IMG/M
3300005842|Ga0068858_102013713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300005842|Ga0068858_102229690All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300006163|Ga0070715_10457454All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium722Open in IMG/M
3300006194|Ga0075427_10093222All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300006804|Ga0079221_10412771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium842Open in IMG/M
3300006844|Ga0075428_101392315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium736Open in IMG/M
3300006847|Ga0075431_100251675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1795Open in IMG/M
3300006852|Ga0075433_10048569All Organisms → cellular organisms → Bacteria3691Open in IMG/M
3300006931|Ga0097620_102723666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300007076|Ga0075435_100330648All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1305Open in IMG/M
3300009153|Ga0105094_10395365All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium800Open in IMG/M
3300009156|Ga0111538_10521294All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1506Open in IMG/M
3300009157|Ga0105092_10006964All Organisms → cellular organisms → Bacteria5959Open in IMG/M
3300009157|Ga0105092_10753946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium568Open in IMG/M
3300009797|Ga0105080_1037187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300009801|Ga0105056_1031239All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium693Open in IMG/M
3300009802|Ga0105073_1041521All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium579Open in IMG/M
3300009804|Ga0105063_1037799All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium648Open in IMG/M
3300010039|Ga0126309_11153342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300010046|Ga0126384_11592650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300010047|Ga0126382_11834878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300010362|Ga0126377_10396773All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1389Open in IMG/M
3300010398|Ga0126383_12536181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300010399|Ga0134127_10392108All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1370Open in IMG/M
3300011417|Ga0137326_1050034All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium909Open in IMG/M
3300012199|Ga0137383_11050631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300012201|Ga0137365_10988670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300012225|Ga0137434_1021131All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium854Open in IMG/M
3300012353|Ga0137367_10777558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300012354|Ga0137366_10150666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1751Open in IMG/M
3300012354|Ga0137366_10185305All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1559Open in IMG/M
3300012582|Ga0137358_10244468All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1221Open in IMG/M
3300012685|Ga0137397_10691229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium758Open in IMG/M
3300012904|Ga0157282_10416432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300012925|Ga0137419_10356899All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1132Open in IMG/M
3300012943|Ga0164241_11445817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300012971|Ga0126369_10258794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1717Open in IMG/M
3300012984|Ga0164309_11505862All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300013297|Ga0157378_11771458All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium665Open in IMG/M
3300013297|Ga0157378_11837114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium654Open in IMG/M
3300013308|Ga0157375_10602152All Organisms → cellular organisms → Bacteria1258Open in IMG/M
3300014270|Ga0075325_1011020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1576Open in IMG/M
3300014271|Ga0075326_1036157All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1276Open in IMG/M
3300014324|Ga0075352_1101584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium755Open in IMG/M
3300014325|Ga0163163_13058204All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300015241|Ga0137418_10393459All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1132Open in IMG/M
3300015264|Ga0137403_10388877All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1276Open in IMG/M
3300015359|Ga0134085_10515848All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300015372|Ga0132256_102531665All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300015374|Ga0132255_101972348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium888Open in IMG/M
3300015374|Ga0132255_103659834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300016294|Ga0182041_10447234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1110Open in IMG/M
3300016404|Ga0182037_11351389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300017930|Ga0187825_10124135All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium903Open in IMG/M
3300017966|Ga0187776_10998140All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300018054|Ga0184621_10007029All Organisms → cellular organisms → Bacteria3139Open in IMG/M
3300018054|Ga0184621_10347385All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300018056|Ga0184623_10233079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium843Open in IMG/M
3300018071|Ga0184618_10428984All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium558Open in IMG/M
3300018076|Ga0184609_10019734All Organisms → cellular organisms → Bacteria2656Open in IMG/M
3300018076|Ga0184609_10070785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1527Open in IMG/M
3300018433|Ga0066667_10068386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2234Open in IMG/M
3300018476|Ga0190274_10142735All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2004Open in IMG/M
3300019362|Ga0173479_10082588All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1146Open in IMG/M
3300019377|Ga0190264_11991100All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300019879|Ga0193723_1054274All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1174Open in IMG/M
3300020198|Ga0194120_10477399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300021081|Ga0210379_10156647All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium970Open in IMG/M
3300021344|Ga0193719_10300399All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium673Open in IMG/M
3300022209|Ga0224497_10342227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300025796|Ga0210113_1005117All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2956Open in IMG/M
3300025920|Ga0207649_10887246All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300025925|Ga0207650_11119876All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium670Open in IMG/M
3300025933|Ga0207706_11282329All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300025935|Ga0207709_10921190All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium711Open in IMG/M
3300025938|Ga0207704_11594114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300026035|Ga0207703_12182084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300026116|Ga0207674_11327686All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium689Open in IMG/M
3300026523|Ga0209808_1129947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1015Open in IMG/M
3300027511|Ga0209843_1034056All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium933Open in IMG/M
3300027639|Ga0209387_1225482All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300027750|Ga0209461_10172634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300027787|Ga0209074_10286607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300027873|Ga0209814_10082687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1355Open in IMG/M
3300027880|Ga0209481_10354705All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium748Open in IMG/M
3300027907|Ga0207428_10439009All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium952Open in IMG/M
3300027907|Ga0207428_10540519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium843Open in IMG/M
3300028381|Ga0268264_12507173All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium521Open in IMG/M
3300028814|Ga0307302_10318270All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300028828|Ga0307312_10217488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1230Open in IMG/M
3300030499|Ga0268259_10158524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300031229|Ga0299913_10716236All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium978Open in IMG/M
3300031740|Ga0307468_101149242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium696Open in IMG/M
3300031910|Ga0306923_12066938All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300031954|Ga0306926_10421618All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1646Open in IMG/M
3300032001|Ga0306922_10917745All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium909Open in IMG/M
3300032180|Ga0307471_104091501All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300033417|Ga0214471_10734052All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium774Open in IMG/M
3300034151|Ga0364935_0136869All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium769Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.20%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.00%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand4.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.20%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.40%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.40%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.40%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.40%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.40%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.40%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.60%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.60%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.60%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave1.60%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.80%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.80%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.80%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.80%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.80%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.80%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009797Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20EnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009802Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60EnvironmentalOpen in IMG/M
3300009804Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300022209Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027750Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes)Host-AssociatedOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10180950223300000364SoilRITHRVEPAALTEHLDLVECALLLPVRIPPGEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
JGI11643J11755_1137144913300000787SoilPKEIAEYLDLVECALLLPVRLRPGEEQIFNSTYIVRGDLPDGTRVLDVTYEFKIEG*
JGI11615J12901_1077921613300000953SoilPGEEETYNSTYILRGDLPDGTKHLDVIYEFKVDS*
JGI1027J12803_10102123843300000955SoilVTRIVHRVEPKEMAPYLDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN*
Ga0055471_1021526713300003987Natural And Restored WetlandsHRVEPKEMAEYLDLVECALLLPVRLQPREEQIYKSTYVVRGDLPDGIKSLNVTYEFKVEN
Ga0055432_1027339013300004022Natural And Restored WetlandsNPTAKEIVTRIVHRVEPKELAQFLDLVECALLLPVRIRPGEAQTYRSTYVVRGDLPDGTKTVNVTYEFSIENQ*
Ga0062593_10237029013300004114SoilRREIVTRIAHRVEPKEVAPYLDLVECALLLPVRLKPGEEQTYNSTYAVRGDLPDGIKSFDVTYEFKIEN*
Ga0063356_10448237113300004463Arabidopsis Thaliana RhizosphereVDLVECALLLPVKLQPSEEREFSSTYMARGDLPDGSKHVKVTYDFQVEN*
Ga0068998_1015760323300005213Natural And Restored WetlandsRVEPKELAQYLDLVECALLLPVRMRAGEAQTYRSTYVVRGDLPDGTKTLNVTYEFTIENQ
Ga0065704_1054506613300005289Switchgrass RhizosphereLPVRIPPGEEQSYSSTYVVRGDIPDGTKRIDVTYEFKVEH*
Ga0065707_1024697433300005295Switchgrass RhizosphereECALLLPVRIPPGEEQSYSSTYVVRGDIPDGIKRLDVTYEFKVEH*
Ga0070690_10095626423300005330Switchgrass RhizosphereQYLELVQCALLLPVRLRAGEEQVYNSTYVVRGDLPEGTKRLDVIYEFKVDN*
Ga0070668_10038921913300005347Switchgrass RhizosphereREVVTRIVHRVEPKEMAPYLDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN*
Ga0070671_10155529123300005355Switchgrass RhizosphereTRIVHRVEPKEMAPYLDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN*
Ga0070711_10087097513300005439Corn, Switchgrass And Miscanthus RhizosphereKEMAPYLELVECALLLPVRLRPGEEQTYNSTYVVRSDLPDGVKNLNVTYEFKVEN*
Ga0070662_10050391713300005457Corn RhizosphereTSRELVTRIVHRVEPKEMAPYLDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN*
Ga0070706_10023509943300005467Corn, Switchgrass And Miscanthus RhizosphereKVKNRASREVITRIAHRVEPKELAQYLDLVECALLLPVRLRPGEEQIYNSTYVVRGDLPDGIKSLDVTYEFKIEN*
Ga0070706_10152597313300005467Corn, Switchgrass And Miscanthus RhizosphereLKQYLDLVECALLLPVRLRPGEEQVYNSTYLVRGDLPDGTRAFDVTYEFKVES*
Ga0070698_10044047133300005471Corn, Switchgrass And Miscanthus RhizosphereRMRIVHRVEPKELVRYLDLVECALLLPVRLRPGEEQIYNSTYTVRGDLPDGTKGFDVTYEFKVEP*
Ga0066697_1073504423300005540SoilVECALLLPVRMLPGEEKEYASTYLLQGDLPDDAKELTVTYEFKVEH*
Ga0066698_1063921113300005558SoilLDLVECALLLPVRMLPGEEKEYASTYLLQGELPDDAKELNVTYEFKVER*
Ga0066698_1063921213300005558SoilLDLVECALLLPVRMLPGEEKEYASTYLLQGELPDDAKELSVTYEFKVEH*
Ga0066706_1143837623300005598SoilLSAKKISARIVHRVEPKSVAQHLDLVECALLLPVRMLPGEEKEYASTYLLQGELPDDAKELSVTYEFKVEH*
Ga0070702_10002115763300005615Corn, Switchgrass And Miscanthus RhizosphereTRIVHRIEPKELAQYLELVQCALLLPVRLRPGEEETYNSTYILRGDLPDGTKHLDVIYEFKVDS*
Ga0066903_10466826323300005764Tropical Forest SoilCALLLPVRLRPGEEQTYNSTYVVRGDLPEGAKRLDVIYEFKVDN*
Ga0068858_10067360713300005842Switchgrass RhizosphereHRIEPKELAQYLELVQCALLLPVRLRPGEEQTYNSTYILRGDLPDGTKHLDVIYEFKVDS
Ga0068858_10201371323300005842Switchgrass RhizosphereDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN*
Ga0068858_10222969013300005842Switchgrass RhizosphereRAQQEMVTRISHHVEPQELAQYLDLVECALLLPVRIRPGEEQVYNSTYLIRGDLPDGVKDLNVTYEFNVER*
Ga0070715_1045745423300006163Corn, Switchgrass And Miscanthus RhizosphereCALLLPVRLRPGEEQTYNSTYVVRSDLPDGVKNLNVTYEFKVEN*
Ga0075427_1009322213300006194Populus RhizosphereMAPYLDLVECALLLPVRLLPGEEQTYNSTYVVRSDLPDGLKNLNVTYEFKVEN*
Ga0079221_1041277123300006804Agricultural SoilLVQCALLLPVRLRPGEEQTYNSTYILRVDLPDGTKHLDVIYEFKVDS*
Ga0075428_10139231523300006844Populus RhizosphereIAEYLDLVECALLLPVRLRPGEEQIFNSTYIVRGDLPDGTRVLDVTYEFKIEG*
Ga0075431_10025167513300006847Populus RhizosphereNEIVTRIVHRVEPKELAQYLDLVECALLLPVRVRPGEVQTYRSTYVVRGDLPDGTKTVNVTYEFKIENQ*
Ga0075433_1004856913300006852Populus RhizosphereKELAQYLELVQCALLLPVQLRPGEEQTYNSTYVVRGDLPDGAGRLDVIYEFKIDN*
Ga0097620_10272366623300006931Switchgrass RhizosphereTRIVHRIEPKELAQYLELVQCALLLPVRLRPGEEQTYNSTYILRGDLPDGTKHLDVIYEFKVDS*
Ga0075435_10033064843300007076Populus RhizosphereVHRVEPKELAQYLELVQCALLLPVQLRPGEEQTYNSTYVVRGDLPEGAKRMDVIYEFKVDN*
Ga0105094_1039536523300009153Freshwater SedimentLDLVQCALLLPVRIRPGEEQIYNSTYVVRGDLPDGIKALNVTYDFKIES*
Ga0111538_1052129413300009156Populus RhizosphereLTDKEVFARITHRVEPAALTEHLDLVECALLLPVRIPPGVEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0105092_1000696483300009157Freshwater SedimentLPVRIPPGEEQSYSSTYVVRGDIPDGTKSVDVTYEFKVEP*
Ga0105092_1075394613300009157Freshwater SedimentECGLRLPVRILPGEEQSYSSTYVIRGDIPDGTKSVDVTYEFKVEP*
Ga0105080_103718723300009797Groundwater SandDLVECALLLPVRIPPGEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0105056_103123913300009801Groundwater SandLTDKEVFARITHRVEPAALTEHLDLVECALLLPVRIPPGEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0105073_104152123300009802Groundwater SandFARITHRVEPAALTEHLDLVECALLLPVRIPPGEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0105063_103779923300009804Groundwater SandKVSNPTAKEIVTRIVHRVEPKELAQYLDLVECALLLPVRVRPGESQTYRSTYVVRGDLPDGTKTVNVTYEFRIDNQ*
Ga0126309_1115334213300010039Serpentine SoilAQQETVTRIRHHVEPQELAQYLDLVECALLLPVRIRPGEEQVYKSTYLIRGDLPDGVKNLNVTYEFNVER*
Ga0126384_1159265013300010046Tropical Forest SoilDKEVFARITHRIEPAALSAHLDVVECALLLPVRILPGEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0126382_1183487813300010047Tropical Forest SoilALSAHLDVVECALLLPVRIPPGEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0126377_1039677313300010362Tropical Forest SoilEHLDVVECALLLPVRIPPGEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0126383_1253618123300010398Tropical Forest SoilRILPGEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0134127_1039210813300010399Terrestrial SoilVECALLLPVRLRAGEEQIFNSTYVVRGDLPDGTKVLGVTYEFKVEN*
Ga0137326_105003413300011417SoilCALLLPVRVGPGEEQLFNSTYLVRGDLPDGAKTLKVTYEFKVESN*
Ga0137383_1105063113300012199Vadose Zone SoilNEIHIRIVHLVDPAKLKQYLDLVECALLLPVRLRPGEEQVYNSTYLVRGDLPDGTKALDVTYEFKVES*
Ga0137365_1098867013300012201Vadose Zone SoilLPVRIPPREEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0137434_102113123300012225SoilIKVANPTTKEVVTRIVHRVEPKELAPYLDLVECALLLPVRVRPGEEQLFNSTYLVRGDLPDGAKTLKVTYEFKVESN*
Ga0137367_1077755823300012353Vadose Zone SoilPVRIPPGEEQSYSSTYVVRGDIPDGTQRLDATYEFKVEH*
Ga0137366_1015066613300012354Vadose Zone SoilSVAQHLDLVECALLLPVRMLPGEEKEYASTYLLQGELPDDAKELSVTYEFKVEH*
Ga0137366_1018530513300012354Vadose Zone SoilIVHLVDPAKLKQYLDLVECALLLPVRLRPGEEQVYNSTYLVRGDLPDGTKALDVTYEFKVES*
Ga0137358_1024446833300012582Vadose Zone SoilQYLDLVECALLLPVRLRPGEEQIYNSTYVVRGDLPDGIKSLDVTYEFKIEN*
Ga0137397_1069122923300012685Vadose Zone SoilVFARITHRVAPAALTEHLDVVECALLLPVRIAPGQEQSYSSTYVVRGDIPDGTKSLDVTYEFKVEH*
Ga0157282_1041643213300012904SoilNLSDQMIATRIIHRVEPQELRQYLDLVECALLLPVKLKPGEEREFSSTYMARGDLPDGSKQVKVTYEFQVEK*
Ga0137419_1035689913300012925Vadose Zone SoilTRIAHRVEPKELAQYLDLVECALLLPVRLRPGEEQIYNSTYVVRGDLPDGIKSLDVTYEFKIEN*
Ga0164241_1144581723300012943SoilGEIVTRIVHRVEPKAIAEYLDLVECALLLPVRLRPGEAQIFHSTYIVRGDLPDETKSLDVTYEFKVDN*
Ga0126369_1025879413300012971Tropical Forest SoilRVKNLTDKEVFARITHRIEPAALSAHLDVVECALLLPVRIPPEEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH*
Ga0164309_1150586213300012984SoilPKEMAPYLDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN*
Ga0157378_1177145823300013297Miscanthus RhizosphereECALLLPVRIRPGEEQVYNSTYLIHGDLPDGVKDLNVTYEFKVER*
Ga0157378_1183711423300013297Miscanthus RhizosphereVHRIEPKELAQYLELVQCALLLPVRLRAGEEQVYNSTYVVRGDLPEGTKRLDVIYEFKVDN*
Ga0157375_1060215213300013308Miscanthus RhizosphereLLLPVRLRPGEEQVYNSTYVVRGDLPEGTKRLDVIYEFKVDN*
Ga0075325_101102023300014270Natural And Restored WetlandsMAQYLDLVECALLLPVRLRAGEEQVFNSTYVVRGDLPDGARSFYVTYEFQIER*
Ga0075326_103615713300014271Natural And Restored WetlandsRIEPGALSEYLDVVECALLLPVKIPAGEEQTYSSTYVVRGDIPDGTKRIEVTYEFKIEG*
Ga0075352_110158413300014324Natural And Restored WetlandsRVEPKELSQYLDLVECALLLPVRIRPGETQTYRSTYVVRGDLPDGTKTLNVTYEFTIENN
Ga0163163_1305820423300014325Switchgrass RhizospherePEELRQFLDLVECALLLPVKLKPKEVREFSSTYMTRSDLPDGSKEVKVTYEFQVEK*
Ga0137418_1039345933300015241Vadose Zone SoilTRIAHRVEPKELAQYLDLVECALLLPVQLRPGEEQIYNSTYVVRGDLPDGIKSLDVTYEFKIEN*
Ga0137403_1038887713300015264Vadose Zone SoilVVTRIVHQVEPKEMAPYLDLVECALLLPVRLRPGEEQIYNSTYVVRGDLPDGIKSLDVTYEFKIEN*
Ga0134085_1051584813300015359Grasslands SoilMLPGEEKEYASTYLLQGELPDDAKELSVTYEFKVEH*
Ga0132256_10253166513300015372Arabidopsis RhizosphereVRVQPGEEQLFNSTYLVRGDLPDGAKTLKVTYEFKVESN*
Ga0132255_10197234813300015374Arabidopsis RhizosphereDLVECAMLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN*
Ga0132255_10365983413300015374Arabidopsis RhizosphereRVEPKEMAPYLDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN*
Ga0182041_1044723413300016294SoilLDLVECALLLPVKLSPGEEQSYSSTYVVRGNIPEGTKHLDVTYEFKVEH
Ga0182037_1135138913300016404SoilELVECALLLPVRLRPGEEQTYNSTYVVRGDLPEGAKRLDVIYEFKVDN
Ga0187825_1012413513300017930Freshwater SedimentMAQYLDLVECALLLPVRLRAGEEQVFNSTYVVRGDLPDDAKALNVIYEFQIER
Ga0187776_1099814013300017966Tropical PeatlandRITHRIEPKELAPYLDLVDCALLLPVRIRPGEEQIYHSTYVVRGDLPDGTKTIHVTYDFQTENR
Ga0184621_1000702973300018054Groundwater SedimentHRVAPAALTEHLDVVECALLLPVRIAPGQEQSYSSTYVVRGDIPDGTKSLDVTYEFKVEH
Ga0184621_1034738513300018054Groundwater SedimentKVNNPTAEQVVTRIVHHVEPKELTQYLDLVECALLLPVRLRPGEEQVYNSTYLVRGDLPDGAKAISVTYEFKVEP
Ga0184623_1023307923300018056Groundwater SedimentPVRVRPGEEQLFNSTYLVRGDLPDGAKTLKVTYEFKVESN
Ga0184618_1042898423300018071Groundwater SedimentANPTTKEIVTRIVHRVEPKELAPYLDLVECALLLPVRVRPGEEQLFNSTYLVRGDLPDGAKALKVTYEFKVESN
Ga0184609_1001973413300018076Groundwater SedimentRDTVAHSGDVFTIGFKVKNVTANEIRTRIIHRVEPKELVRYLDLVECALLLPVRLRPGEEQIYNSTYTMRGDLPDGTKAFDVTYEFKVEP
Ga0184609_1007078533300018076Groundwater SedimentPVRLRPGEEQVYNSTYLVRGDLPDGAKAISVTYEFKVEP
Ga0066667_1006838613300018433Grasslands SoilHLDLVECALLLPVRMLPGEEKEYASTYLLQGELPDDAKELNVTYEFKVER
Ga0190274_1014273513300018476SoilSNQAIATRIIHRVEPEELRHYVDLVECALLLPVKLRPSEEREFSSTYMARGDLPDGSKHVKVTYDFQVEN
Ga0173479_1008258833300019362SoilVTRIVHRIEPKELAQYLELVQCALLLPVRLRAGEEQVYNSTYVVRGDLPEGTKRLDVIYEFKVDS
Ga0190264_1199110013300019377SoilNEIITRIGHRVEPKEIAGYLDLVECALLLPVRLRPGEEQIFNSTYVVRGDLPDGTKSLDVTYEFKVEN
Ga0193723_105427413300019879SoilHRVEPKELAQYLDLVECALLLPVRLRPGEEQIYNSTYVVRGDLPDGIKSLDVTYEFKIEN
Ga0194120_1047739913300020198Freshwater LakeRVEPKAVAQYLDLVECALLLPVRMGPGEVQTFRSTYVIRGDLPDGTKSVNVTYEFKTENQ
Ga0210379_1015664733300021081Groundwater SedimentKELAQYLDLVECALLFPVRVRPGEAQTYRSTYVVRGDLPDGTKTVNVTYEFKIDNY
Ga0193719_1030039923300021344SoilPYLDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN
Ga0224497_1034222713300022209SedimentDLVECALLLPVRLLPGEEREYASTYLVRGDLPEGVKELNVTYEFTLDR
Ga0210113_100511743300025796Natural And Restored WetlandsQSTNEITTRIIHHVEPKEMAESLDLVECALLLPVSLRPNEEQTFNSTYMIRGDVPDGVKALDVTYEFKLEN
Ga0207649_1088724613300025920Corn RhizosphereTRIVHRIEPKELAQYLELVQCALLLPVRLRAGEEQVYNSTYVVRGDLPEGTKRLDVIYEFKVDN
Ga0207650_1111987613300025925Switchgrass RhizosphereYLDLVECALLLPVKLKPGEEREFSSTYMARGDLPDGSKQVKVTYEFQVEK
Ga0207706_1128232913300025933Corn RhizosphereELAQYLELVQCALLLPVRLRPGEEETYNSTYVVRADLPEGTKRLDVIYEFKVDN
Ga0207709_1092119013300025935Miscanthus RhizosphereEVVTRIVHRVEPKEMAPYLDLVECALLLPVRLRPGEEQTYNSTYVVRGDLPDGIKNLDVTYEFKVEN
Ga0207704_1159411413300025938Miscanthus RhizosphereNREIATRIVHRIEPKELAQYLELVQCALLLPVRLRPGEEQVYNSTYVVRGDLPEGTKRLDVIYEFKVDN
Ga0207703_1218208423300026035Switchgrass RhizosphereEMVTRISHHVEPQELAQYLDLVECALLLPVRIRPGEEQVYNSTYLIRGDLPDGVKDLNVTYEFNVER
Ga0207674_1132768613300026116Corn RhizospherePVRLRPGEEQVYNSTYVVRGDLPEGTKRLDVIYEFKVDN
Ga0209808_112994733300026523SoilLLLPVRMLPGEEKEYASTYLLQGELPDDAKELNVTYEFKVEH
Ga0209843_103405613300027511Groundwater SandHLDLVECALLLPVRIPPGEEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH
Ga0209387_122548213300027639Agricultural SoilRPGEEQIFNSTYIVRGDLPEGTRTLDVTYEFKIEG
Ga0209461_1017263423300027750AgaveDRAIVTRIVHRVEPKELAQYLELVQCALLLPVQLRPGEEQTYDSTYVVRGDLPDGAERLDVIYEFKIDN
Ga0209074_1028660723300027787Agricultural SoilECALLLPVRLQPGEEQTYNSTYAVRGDLPDSIKSFDVTYEFKIEN
Ga0209814_1008268733300027873Populus RhizosphereIHIRIVHLVDPAKLKQYLDLVECALLLPVRLRPGEEQVYNSTYLVRGDLPDVTKTLDVTYEFKVES
Ga0209481_1035470523300027880Populus RhizosphereNKGTSEILTRIVHRVEPKEIAEYLDLVECALLLPVRLRPGEEQIFNSTYIVRGDLPDGTRVLDVTYEFKIEG
Ga0207428_1043900913300027907Populus RhizosphereVTRIVHRVEPKELAQYLELVQCALLLPVQLRPGEEQTYNSTYVVRGDLPEGAKRMDVIYEFKVDN
Ga0207428_1054051913300027907Populus RhizosphereHRVEPKELAQYLELVQCALLLPVQLRPGEEQTYNSTYVVRGDLPDGAGRLDVIYEFKIDN
Ga0268264_1250717323300028381Switchgrass RhizosphereDLVECALLLPVRIRPGEEQVYNSTYLIRGDLPDGVKDLNVTYEFNVER
Ga0307302_1031827013300028814SoilEPKELTQYLDLVECALLLPVRLRPGEEQVYNSTYLVRGDLPDGAKAISVTYEFKVEP
Ga0307312_1021748813300028828SoilLDLVECTLLLPVRLRPGEEQIYNSTYVVRGDLPDGIKSLDVTYEFKIED
Ga0268259_1015852413300030499AgaveTDRAIVTRIVHRVEPKELAQYLELVQCALLLPVQLRPGEEQTYDSTYVVRGDLPDGAERLDVIYEFKIDN
Ga0299913_1071623633300031229SoilKEMAEYLDLVECALLLPVRLQPGEEQIYKSTYVVRGDLPDGTKSLNVTYEFKVEN
Ga0307468_10114924213300031740Hardwood Forest SoilDVVECALLLPVRIPPGQEQNYSSTYVVRGDIPDGTKSFDVTYEFKVEH
Ga0306923_1206693823300031910SoilKNLTDKDLFARITHRVEPAILKEHLDLVECALLLPVKLSPGEEQSYSSTYVVRGNIPEGTKHLDVTYEFKVEH
Ga0306926_1042161813300031954SoilELFTIAYRVKNLTDKDLFARITHRVEPAILKEHLDLVECALLLPVKLSPGEEQSYSSTYVVRGNIPEGTKHLDVTYEFKVEH
Ga0306922_1091774523300032001SoilYRVKNVTDKDLFARITHRVEPAILKEHLDLVECALLLPVKLSPGEEQSYSSTYVVRGNIPEGTKHLDVTYEFKVEH
Ga0307471_10409150113300032180Hardwood Forest SoilNLTDKEVFARITHRVEPAALTEHLDVVECALLLPVRIPPGEEQSYSSTYVVRGDIPDGTKRIDVTYEFKVEH
Ga0214471_1073405223300033417SoilLPVRLQPGEEQVYKSTYIVRGDLPDSAKTLDVTYEFTIEN
Ga0364935_0136869_645_7673300034151SedimentLPVRIPPGQEQSYSSTYVVRGDIPDGTKRLDVTYEFKVEH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.