NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F068293

Metagenome Family F068293

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068293
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 63 residues
Representative Sequence GFLGQRTVRVKALQLALRTISAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Number of Associated Samples 16
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 2.42 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 45.97 %
Associated GOLD sequencing projects 16
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.968 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock
(100.000 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(100.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 32.31%    β-sheet: 3.08%    Coil/Unstructured: 64.62%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF01738DLH 4.84
PF14311DUF4379 4.84
PF00078RVT_1 3.23
PF00775Dioxygenase_C 1.61
PF04832SOUL 1.61
PF07298NnrU 1.61
PF13649Methyltransf_25 1.61
PF00083Sugar_tr 1.61
PF13350Y_phosphatase3 0.81
PF00400WD40 0.81
PF01596Methyltransf_3 0.81
PF02291TFIID-31kDa 0.81
PF01193RNA_pol_L 0.81
PF01593Amino_oxidase 0.81
PF01223Endonuclease_NS 0.81
PF04577Glyco_transf_61 0.81
PF00610DEP 0.81
PF00153Mito_carr 0.81
PF00886Ribosomal_S16 0.81
PF03184DDE_1 0.81
PF02978SRP_SPB 0.81
PF03486HI0933_like 0.81
PF02906Fe_hyd_lg_C 0.81
PF13614AAA_31 0.81
PF00075RNase_H 0.81
PF07690MFS_1 0.81
PF00782DSPc 0.81
PF00176SNF2-rel_dom 0.81
PF11913DUF3431 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 1.61
COG4094Uncharacterized membrane proteinFunction unknown [S] 1.61
COG0493NADPH-dependent glutamate synthase beta chain or related oxidoreductaseAmino acid transport and metabolism [E] 1.61
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.61
COG1249Dihydrolipoamide dehydrogenase (E3) component of pyruvate/2-oxoglutarate dehydrogenase complex or glutathione oxidoreductaseEnergy production and conversion [C] 0.81
COG1761DNA-directed RNA polymerase, subunit L/RPAC2Transcription [K] 0.81
COG1864DNA/RNA endonuclease G, NUC1Nucleotide transport and metabolism [F] 0.81
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.81
COG2081Predicted flavoprotein YhiNGeneral function prediction only [R] 0.81
COG2509FAD-dependent dehydrogenaseGeneral function prediction only [R] 0.81
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 0.81
COG3634Alkyl hydroperoxide reductase subunit AhpFDefense mechanisms [V] 0.81
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 0.81
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 0.81
COG4624Iron only hydrogenase large subunit, C-terminal domainEnergy production and conversion [C] 0.81
COG0029Aspartate oxidaseCoenzyme transport and metabolism [H] 0.81
COG0202DNA-directed RNA polymerase, alpha subunit/40 kD subunitTranscription [K] 0.81
COG0228Ribosomal protein S16Translation, ribosomal structure and biogenesis [J] 0.81
COG0446NADPH-dependent 2,4-dienoyl-CoA reductase, sulfur reductase, or a related oxidoreductaseLipid transport and metabolism [I] 0.81
COG0492Thioredoxin reductasePosttranslational modification, protein turnover, chaperones [O] 0.81
COG0541Signal recognition particle GTPaseIntracellular trafficking, secretion, and vesicular transport [U] 0.81
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.81
COG1053Succinate dehydrogenase/fumarate reductase, flavoprotein subunitEnergy production and conversion [C] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.77 %
UnclassifiedrootN/A3.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300030517|Ga0272420_1004208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-211762Open in IMG/M
3300030517|Ga0272420_1014365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-25431Open in IMG/M
3300030517|Ga0272420_1023090All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23940Open in IMG/M
3300030517|Ga0272420_1025013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23708Open in IMG/M
3300030517|Ga0272420_1026940All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23499Open in IMG/M
3300030517|Ga0272420_1040176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22509Open in IMG/M
3300030517|Ga0272420_1055717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21828Open in IMG/M
3300030517|Ga0272420_1067922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21472Open in IMG/M
3300030517|Ga0272420_1068465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21459Open in IMG/M
3300030517|Ga0272420_1068654Not Available1454Open in IMG/M
3300030517|Ga0272420_1082194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21172Open in IMG/M
3300030523|Ga0272436_1006845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae11979Open in IMG/M
3300030523|Ga0272436_1007989All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-210640Open in IMG/M
3300030523|Ga0272436_1008149All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae10462Open in IMG/M
3300030523|Ga0272436_1009441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-29324Open in IMG/M
3300030523|Ga0272436_1016155All Organisms → cellular organisms → Eukaryota5952Open in IMG/M
3300030523|Ga0272436_1031371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23193Open in IMG/M
3300030523|Ga0272436_1041223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22450Open in IMG/M
3300030523|Ga0272436_1099562All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21033Open in IMG/M
3300030523|Ga0272436_1141047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2736Open in IMG/M
3300031447|Ga0272435_1003864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-212307Open in IMG/M
3300031447|Ga0272435_1004100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-211760Open in IMG/M
3300031447|Ga0272435_1010989All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-25400Open in IMG/M
3300031447|Ga0272435_1014668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24320Open in IMG/M
3300031447|Ga0272435_1021910All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23184Open in IMG/M
3300031447|Ga0272435_1027028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22703Open in IMG/M
3300031447|Ga0272435_1027258All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22684Open in IMG/M
3300031447|Ga0272435_1033287All Organisms → Viruses → Predicted Viral2295Open in IMG/M
3300031447|Ga0272435_1039159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22011Open in IMG/M
3300031447|Ga0272435_1044851All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21794Open in IMG/M
3300031447|Ga0272435_1069492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21217Open in IMG/M
3300031447|Ga0272435_1129339All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes652Open in IMG/M
3300031447|Ga0272435_1148274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2558Open in IMG/M
3300031448|Ga0272438_1010235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-28943Open in IMG/M
3300031448|Ga0272438_1040887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23258Open in IMG/M
3300031448|Ga0272438_1040973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23253Open in IMG/M
3300031448|Ga0272438_1047157All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22934Open in IMG/M
3300031448|Ga0272438_1074856All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22058Open in IMG/M
3300031448|Ga0272438_1095687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21685Open in IMG/M
3300031448|Ga0272438_1197048All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2889Open in IMG/M
3300031448|Ga0272438_1238214All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2737Open in IMG/M
3300031448|Ga0272438_1250597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2700Open in IMG/M
3300031449|Ga0272429_1005132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-215274Open in IMG/M
3300031449|Ga0272429_1012887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes9005Open in IMG/M
3300031449|Ga0272429_1016461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-27682Open in IMG/M
3300031449|Ga0272429_1017073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-27502Open in IMG/M
3300031449|Ga0272429_1038273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24088Open in IMG/M
3300031449|Ga0272429_1046551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23453Open in IMG/M
3300031449|Ga0272429_1063268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22605Open in IMG/M
3300031449|Ga0272429_1153652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21090Open in IMG/M
3300031449|Ga0272429_1174904All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2948Open in IMG/M
3300031450|Ga0272433_10179816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21200Open in IMG/M
3300031450|Ga0272433_10198943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21106Open in IMG/M
3300031450|Ga0272433_10435021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2563Open in IMG/M
3300031450|Ga0272433_10450701All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2546Open in IMG/M
3300031451|Ga0272426_1030759All Organisms → cellular organisms → Eukaryota → Viridiplantae2673Open in IMG/M
3300031451|Ga0272426_1043193All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22105Open in IMG/M
3300031451|Ga0272426_1049732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21912Open in IMG/M
3300031451|Ga0272426_1159702All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2769Open in IMG/M
3300031452|Ga0272422_1182672All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Volvocaceae → Gonium → Gonium pectorale633Open in IMG/M
3300031453|Ga0272425_1008918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-29923Open in IMG/M
3300031453|Ga0272425_1027068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23800Open in IMG/M
3300031453|Ga0272425_1066514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21864Open in IMG/M
3300031453|Ga0272425_1083327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21564Open in IMG/M
3300031453|Ga0272425_1084527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21547Open in IMG/M
3300031453|Ga0272425_1245224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2672Open in IMG/M
3300031460|Ga0272430_1005247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-219918Open in IMG/M
3300031460|Ga0272430_1010352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae11013Open in IMG/M
3300031460|Ga0272430_1021916All Organisms → cellular organisms → Eukaryota5752Open in IMG/M
3300031460|Ga0272430_1025430All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes5047Open in IMG/M
3300031460|Ga0272430_1058146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22363Open in IMG/M
3300031460|Ga0272430_1134012All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2912Open in IMG/M
3300031460|Ga0272430_1190832All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2555Open in IMG/M
3300031470|Ga0272432_1010632All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-28074Open in IMG/M
3300031470|Ga0272432_1030827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23703Open in IMG/M
3300031470|Ga0272432_1038528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23103Open in IMG/M
3300031470|Ga0272432_1074147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21820Open in IMG/M
3300031470|Ga0272432_1079573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae1719Open in IMG/M
3300031470|Ga0272432_1230613Not Available695Open in IMG/M
3300031471|Ga0272439_1019774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-26489Open in IMG/M
3300031471|Ga0272439_1032076All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24610Open in IMG/M
3300031471|Ga0272439_1046578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23484Open in IMG/M
3300031471|Ga0272439_1055425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23039Open in IMG/M
3300031471|Ga0272439_1066560All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22610Open in IMG/M
3300031471|Ga0272439_1068142Not Available2558Open in IMG/M
3300031471|Ga0272439_1073715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22392Open in IMG/M
3300031471|Ga0272439_1101928All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21776Open in IMG/M
3300031471|Ga0272439_1120040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21515Open in IMG/M
3300031471|Ga0272439_1124140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21464Open in IMG/M
3300031471|Ga0272439_1164597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21100Open in IMG/M
3300031471|Ga0272439_1178154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta1014Open in IMG/M
3300031471|Ga0272439_1188448All Organisms → cellular organisms → Eukaryota → Viridiplantae957Open in IMG/M
3300031471|Ga0272439_1235698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2761Open in IMG/M
3300031471|Ga0272439_1345776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2523Open in IMG/M
3300031473|Ga0272434_1025565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-25285Open in IMG/M
3300031473|Ga0272434_1028898All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24897Open in IMG/M
3300031473|Ga0272434_1029913All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24793Open in IMG/M
3300031473|Ga0272434_1039087All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-24027Open in IMG/M
3300031473|Ga0272434_1050132All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23409Open in IMG/M
3300031473|Ga0272434_1067611All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22755Open in IMG/M
3300031473|Ga0272434_1072544All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22611Open in IMG/M
3300031473|Ga0272434_1093295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-22140Open in IMG/M
3300031473|Ga0272434_1127307All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21634Open in IMG/M
3300031473|Ga0272434_1130503All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21599Open in IMG/M
3300031473|Ga0272434_1155740All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21358Open in IMG/M
3300031473|Ga0272434_1159512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21327Open in IMG/M
3300031473|Ga0272434_1160242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21321Open in IMG/M
3300031473|Ga0272434_1262715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2793Open in IMG/M
3300031473|Ga0272434_1369091Not Available548Open in IMG/M
3300031473|Ga0272434_1400923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2502Open in IMG/M
3300031909|Ga0272421_1064159All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes1170Open in IMG/M
3300031909|Ga0272421_1104673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2745Open in IMG/M
3300031909|Ga0272421_1126723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2613Open in IMG/M
3300032162|Ga0272424_1002709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-231267Open in IMG/M
3300032162|Ga0272424_1003839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-224937Open in IMG/M
3300032162|Ga0272424_1005673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-219173Open in IMG/M
3300032162|Ga0272424_1007371All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-215866Open in IMG/M
3300032162|Ga0272424_1009720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-213021Open in IMG/M
3300032162|Ga0272424_1103948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21564Open in IMG/M
3300032162|Ga0272424_1104192All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21560Open in IMG/M
3300033181|Ga0272431_10052847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-23239Open in IMG/M
3300033181|Ga0272431_10179224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21256Open in IMG/M
3300033181|Ga0272431_10179660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-21253Open in IMG/M
3300033181|Ga0272431_10429068All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Trebouxiophyceae → Trebouxiales → Trebouxiaceae → Trebouxia → unclassified Trebouxia → Trebouxia sp. A1-2574Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock100.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300030517Rock endolithic microbial communities from Victoria Land, Antarctica - Battleship Promontory nordEnvironmentalOpen in IMG/M
3300030523Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak white sandstoneEnvironmentalOpen in IMG/M
3300031447Rock endolithic microbial communities from Victoria Land, Antarctica - Ricker Hills nordEnvironmentalOpen in IMG/M
3300031448Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead nordEnvironmentalOpen in IMG/M
3300031449Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt sudEnvironmentalOpen in IMG/M
3300031450Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sudEnvironmentalOpen in IMG/M
3300031451Rock endolithic microbial communities from Victoria Land, Antarctica - Siegfried Peak nordEnvironmentalOpen in IMG/M
3300031452Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nordEnvironmentalOpen in IMG/M
3300031453Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte sudEnvironmentalOpen in IMG/M
3300031460Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace nordEnvironmentalOpen in IMG/M
3300031470Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley nordEnvironmentalOpen in IMG/M
3300031471Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead sudEnvironmentalOpen in IMG/M
3300031473Rock endolithic microbial communities from Victoria Land, Antarctica - Trio Nunatak nordEnvironmentalOpen in IMG/M
3300031909Rock endolithic microbial communities from Victoria Land, Antarctica - Buttleship Promontory sudEnvironmentalOpen in IMG/M
3300032162Rock endolithic microbial communities from Victoria Land, Antarctica - Pudding Butte nordEnvironmentalOpen in IMG/M
3300033181Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sudEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0272420_1004208163300030517RockLLTTGFLGQRTVRVKALQLALRTISAALVPPTHAFDGVLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272420_101436513300030517RockQQTCPLLTTGFLGQRTVRVKALQLALRTISAALVPPTHAFDGSLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272420_102309013300030517RockRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIELSSHRNCSAKQGLVLDTDF
Ga0272420_102501313300030517RockLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQFELSSHTNCSAKQGLVLDTDF
Ga0272420_102694013300030517RockSKLALLLTTGFLGQRTVRVKALQLALRTISAALVPPTHAFDGALGLPDRTASQIELSSHTNCSAEQGLVFS
Ga0272420_104017663300030517RockLGQRTVRVKALQLALRTISAALVPPTHAFDGLLGLPGRTASHIELSSHTNCFVKQGLVLDTDF
Ga0272420_105571713300030517RockRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIELASHTNCSAKQGLVLDTDF
Ga0272420_106792243300030517RockLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272420_106846523300030517RockVQQTCPLLTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPVRTASQIELSPHTNCSAKQGLVLDTDF
Ga0272420_106865413300030517RockTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQIELSPHTNCSAKQGLVLDTDF
Ga0272420_108219413300030517RockTGFLGQRTVRVKALQLALRTISAALVPPTHAFDGLLGLPGRTVSQIELSSHTNCSAKQGLVLDTDF
Ga0272436_100684513300030523RockGFLGQRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272436_100798913300030523RockLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASHIELSSHTNCSAKQGLVLDTDF
Ga0272436_100814913300030523RockQLALRTISAALVPPIHAFDSLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272436_100944113300030523RockQRTVRVKALQLALRTMSAALVPPIHAFDVLLGLPGRTASQIELSSHTNCSAKQGLVLDTD
Ga0272436_101615583300030523RockLTTGFLGQRTVRVKALQLALRTISAALVRPTHAFDGVLGLPDRTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272436_103137113300030523RockLLAYGFCLLLCSKLALLLTTGFLGQRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272436_104122313300030523RockMAFACCCAAKLALLLTTGFLGQRTVRVKALQLALRTTSAALVPPTHAFDGVLGLPGRTASQIELSSHTNCSAKQGLNL
Ga0272436_109956213300030523RockLTTGFLGQRTVRVKALQLALRTISAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272436_114104713300030523RockLRTISAALVPPTHAFDGVLGLPDRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272435_100386473300031447RockMAFACCCAAKLALLLTTGFLGQRTVRVKALQLALRTTSAALVPPTHAFDGVLGLPGRTASQIELSSHTNCSAKQGLNLDTDF
Ga0272435_100410013300031447RockQRTVRVKALQLALRTISAALVPPTHAFDGVLGLPGRTASQIELSSHTNCSAKQGLVLDTD
Ga0272435_101098913300031447RockTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGHTASQIELSSHTNCSAKQGLVLDTDF
Ga0272435_101466853300031447RockISAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLNSDGHV
Ga0272435_102191033300031447RockICPLLTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASHIELSSHTNCSAKQGLVLDTDF
Ga0272435_102702853300031447RockLGHRTVRVKALQLALRPISAALVQPIHAFDGLLGLPGRTASQIELSSHTNCSAKQGLALDTDF
Ga0272435_102725843300031447RockTCPLLTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGSLGLPGRTASQIELSSHTNCSAKQGLVLDPDF
Ga0272435_103328713300031447RockVRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272435_103915913300031447RockTVRVKALQLALRTISAALVTPTHAFDGVLGLPDCTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272435_104485113300031447RockGFLGQRTVRVKALQLALRTISAALVPPTHAFDGLLGLPGRTVSQIELSSHTNCSAKQGLVLDTDF
Ga0272435_106949223300031447RockTCPLLTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPVRTASQIELSPHTNCSAKQGLVLDTDF
Ga0272435_112933913300031447RockRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQIDLSSHMNCSAKQGLVLDTDF
Ga0272435_114827413300031447RockQRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIEPSSHTNCSAKQGLVLDTD
Ga0272438_101023513300031448RockQRTVRVKALQLALRTISAALVPPTHAFDGSLGLPGRTASQIEQSSHTNCSAKQGLVLDTD
Ga0272438_104088773300031448RockFLGQRTVRVKALQLALRMMSAALVPPIHAFDGLLGLPGRTASQIELSSHTNCSAKQGLILDTDF
Ga0272438_104097313300031448RockVKALQLALRPISAALVQPIHAFDGLLGLPGRTASQIELSSHTNCSAKQGLALDTDF
Ga0272438_104715753300031448RockISAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272438_107485613300031448RockQTCPLLTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGSLGLPGRTASQIELSSHTNCSAKQGLVLDPDF
Ga0272438_109568723300031448RockKALQLALRTISAALVPPTHAFDGLLGLPGRTASQIELSSHTNSSANQGLLLDTDF
Ga0272438_119704833300031448RockVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272438_123821423300031448RockQRTVRVKALQLALRTISAALVPPIHAFDSLLGLPGRTASQIELSSHTNCSAKQGLVLDTD
Ga0272438_125059723300031448RockGFLGQRTVRVKALQLALRTISAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272429_100513213300031449RockLALRTISAALVTPTHAFDGVLGLPERTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272429_1012887153300031449RockTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGSLGLPGRTASQIELSSHTNCSAKQGLVLDPDF
Ga0272429_1016461113300031449RockALLLTTGFLGQRTVRVKALQLALRTISAALVRPTHAFDGVLGLPDRTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272429_1017073103300031449RockALLLTTDFLGQRTVRVKALQLALRTLSAALVPPTHAFDGVLGPPDRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272429_103827373300031449RockRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIELASHTNCSAKQGLVLDTDF
Ga0272429_104655113300031449RockLTTGFLGQRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDCTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272429_106326813300031449RockGQRTVRVKALQLALRTISAVLVPPTHAFDGLLDLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272429_115365213300031449RockTGFLGQRTVRVKALQLALRTISAALVPPTYAFGGVLGLPDRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272429_117490413300031449RockLRTTSAALVPPTHAFDGVLGLPGRTASQIELSSHTNCSAKQGLNLDTDF
Ga0272433_1017981613300031450RockTCPLLTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRAASQIELSSHTNCSAKQGLVLDTDF
Ga0272433_1019894323300031450RockRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGHTASQIELSSHTNCSAKQGLVLDTDF
Ga0272433_1043502113300031450RockTTGFLGQRTVRVKALQLALRTISAALVPPAHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272433_1045070123300031450RockKALQLALRTISAALVPPTHAFDGLLRLPGRTASQTELSSHVNCSAKPGLVLDTDF
Ga0272426_103075943300031451RockLLCSKLALLLTTGFLGQRTVRVKALQLALRTISAALVRPTHAFDGVLGLPDRTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272426_104319313300031451RockTISAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272426_104973213300031451RockALRTISAALVTPTHAFDGVLGLPDRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272426_115970223300031451RockKALQLALRTISAALVPPIHAFDGLLGLPGRTASHIELSSHTNCSAKQGLVLDTDF
Ga0272422_118267223300031452RockTVRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIEPSSHTNCSAKQGLVLDADF
Ga0272425_1008918123300031453RockTTGFLGQRTVRVKALQLALRPISAALVQPIHAFDGLLGLPGRTASQIELSSHTNCSAKQGLALDTDF
Ga0272425_102706863300031453RockLLTTGFLGQRTVRVKALQLALRTIFAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272425_106651443300031453RockVKALQLALRTISAALVPPTHAFDGLLGLPGRTVSQIELSSHTNCSAKQGLVLDTDF
Ga0272425_108332723300031453RockFLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272425_108452733300031453RockVQQTCPLLTTGFLGQRTVRVKALQLALRTTSAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSANQGLVLDTDF
Ga0272425_124522423300031453RockSCPLLITGFLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQFELSSHTNCSAKQGLVLDTDF
Ga0272430_1005247283300031460RockKALQLALRTISAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSAKQELVLDTDF
Ga0272430_101035213300031460RockLTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGSLGLPGRTASQIELSSHTNCSAKQGLVLDPDF
Ga0272430_102191693300031460RockQTCPLLTTGFLGQRTVRVKALQLALRTISAALVPPTHAFDGSLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272430_1025430113300031460RockLRTISAALVPPIHVFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272430_105814613300031460RockQRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDCTAGQIELSSHTNCSAKQGLVLDTD
Ga0272430_113401233300031460RockTCPLLTTGFLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQIELSSHTNCSANQGLVLDTDF
Ga0272430_119083213300031460RockLLCSKLALLLTTGFLGQRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272432_1010632123300031470RockTGFLGQRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDCTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272432_103082763300031470RockKALQLALRTIFAALVPPTHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272432_103852813300031470RockSKLALLLTTGFLGQRTVRVKALQLALRTISAALVPPTYAFGGVLGLPDRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272432_107414713300031470RockLTTDFLGQRTVRVKALQLALRTLSAASVPPTHAFDGVLGLAGRTASQIELSSYTNCSAKQALVLDTDF
Ga0272432_107957313300031470RockLRTISAALVPPIHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272432_123061313300031470RockQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGHTASQIELSSHTNCSAKQGLVLDTD
Ga0272439_101977413300031471RockTTGFLGHRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDCTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272439_103207653300031471RockLGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGHTASQIELSSHTNCSAKQGLVLDTDF
Ga0272439_104657813300031471RockSSKLGPLLTTDFLGQRTVRVKALQLALRTISAATVPSTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDFLTTTVGKWLS
Ga0272439_105542533300031471RockRLLHSSKLGPLLTTDFLGQRTVRVKALQLALRTISAATVPPTHAFDGVLGLPDRTASHIELSSHTNCCAKQGLVLDTDF
Ga0272439_106656053300031471RockLALRTISAALVTPTHAFDGVLGLPDRTAGQIELASHTNCSAKQGLVLDTDF
Ga0272439_106814223300031471RockVRVKALQLALRTISAALVPPIHAFDGLLGLPGRAASQIELSSHTNCSAKQGLVLDTDF
Ga0272439_107371553300031471RockLTTDFLGQRTVRVKALQLALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272439_110192813300031471RockLQLALRTISAATVPPTHAFDGVLGLPDRTASQAELSSHTNCCAKQGLVLDTDF
Ga0272439_112004013300031471RockALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272439_112414033300031471RockVRVKALQLALRTISAALVRPTHAFDGVLGLPDRTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272439_116459713300031471RockKALQLALRTISAATVPPTHAFDGVIGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272439_117815423300031471RockLLTTDFLGQRTVRVKALQLVLRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272439_118844823300031471RockYGFCLLHSSKLGPLLTTDFLGQRTVRVKTLQLALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272439_123569813300031471RockCPLLTTGFLGQRTVRVKALQLALRTMSAALVPPTHAFDDLLGLPGRTASHIELSSHTNCSAKQGLVLDTDF
Ga0272439_134577623300031471RockQRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIELSSHTNCSAKQGLVLDTD
Ga0272434_102556563300031473RockPLLTTGFLGQRTVRVKALQLALRTMSAALVPPTHAFDDLLGLPGRTASHIELSSHTNCSAKQGLVLDTDF
Ga0272434_102889883300031473RockLALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272434_102991383300031473RockLRTISAALVTPTHAFDGVLGLPDRTAGQIELSSHRNCSAKQGLVLDTDF
Ga0272434_103908783300031473RockGPLLTTDFLGQRTVRVKALQLALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272434_105013263300031473RockRTVRVKALQLALRTISAALVTPTHAFDGVLGLPDCTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272434_106761113300031473RockMAFACCCAAKLALLLTTGFLGQRTVRVKALQLALRTTSAALVPPTHAFDGLLGLPGRTASQIELS
Ga0272434_107254453300031473RockQRTVRVKALQLALRTISAALVPPMHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTD
Ga0272434_109329553300031473RockTVRVKALQLALRTISAATVPPTHAFDGVLGLPDRTASQVELSLHTNCCAKQGLVLDTDF
Ga0272434_112730733300031473RockQLALRTISAATVPPTHAFDGVLGLPERTASQVELSSHTNCCAKQGLVLDTDF
Ga0272434_113050313300031473RockRTVRVKALQLALRTISAALVPPTHAFDGSLGLPGRTASQIEQSSHTNCSAKQGLVLDTDF
Ga0272434_115574013300031473RockPLLTTDFLGQRTVRVKALQLALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCCAKQELVLDTNF
Ga0272434_115951213300031473RockQLALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCCAEQGLVLDTDF
Ga0272434_116024213300031473RockALQLALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCYAKQGLVLDTDF
Ga0272434_126271513300031473RockTTDFLGQRTVRVKALQLALRTISAATVPPTHAFDGVIGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272434_136909113300031473RockTVRVKALQLALRTISAALVPPIHAFDGLLGLPGHTASQIELSSHTNCSAKQGLVLDTDF
Ga0272434_140092323300031473RockLRTISAATVPPTHAFDTVLSLPDRTASQVELSSHTNCCAKQGLVLDKDF
Ga0272421_106415913300031909RockQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQIDLSSHMNCSAKQGLVLDTD
Ga0272421_110467323300031909RockFLGQRTVRVKALQLALRTISAALVPPIHAFDSLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272421_112672313300031909RockVKALQLALRTISAALVPPTHAFDGLLGLPGRTASQIELSSHKNCSAKQGLVLDTDF
Ga0272424_100270913300032162RockKLGPLLTTDFLGQRTVRVKALQLALRTISAATVPPTHAFDGVIGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272424_100383913300032162RockGFCLLHSSKLGPLLTTDFLGQRTVRVKALQLALRTISAATVPSTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDFLTTTVGKWLS
Ga0272424_1005673283300032162RockLHSSKLGPLLTTDFLGQRTVRVKALQLALRTISAATVPPTHAYDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272424_1007371233300032162RockGFCLLHSSKLGPLLTTDFLGQRTVRVKALQLALRTISAATVPRTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272424_1009720193300032162RockLGQRTVRVKALQLALRTISAATVPPTHAFDGVLGLPDRTASQIELSSHTNCCAKQGLVLDTDF
Ga0272424_110394813300032162RockLQLALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCYAKQGLVLDTDF
Ga0272424_110419213300032162RockVKALQLALRTISAATVPPTHAFDGVLGLPDRTASQVELSSHTNCCAKQGLVLDTDF
Ga0272431_1005284753300033181RockGQRTVRVKALQLALRTISAALVPPIHAFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272431_1017922433300033181RockYGFCLLLCSKLALLLTTGFLGQRTVRVKALQLALRTISAALVPPTHAFDGVLGLPGRTASQIELSSHTNCSAKQGLVLDTDF
Ga0272431_1017966033300033181RockRVKALQLALRTISAALVTPTHAFDGVLGLPDRTAGQIELSSHTNCSAKQGLVLDTDF
Ga0272431_1042906813300033181RockRVKALQLALRTISAALVPPIHVFDGLLGLPGRTASQIELSSHTNCSAKQGLVLDTDF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.