NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068375

Metagenome / Metatranscriptome Family F068375

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068375
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 46 residues
Representative Sequence MTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER
Number of Associated Samples 96
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 81.45 %
% of genes near scaffold ends (potentially truncated) 15.32 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (50.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(62.903 % of family members)
Environment Ontology (ENVO) Unclassified
(81.452 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(67.742 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.67%    β-sheet: 0.00%    Coil/Unstructured: 41.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms50.00 %
UnclassifiedrootN/A50.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005330|Ga0070690_101333723Not Available576Open in IMG/M
3300005335|Ga0070666_10648150Not Available772Open in IMG/M
3300005335|Ga0070666_10924034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300005347|Ga0070668_101484197Not Available619Open in IMG/M
3300005355|Ga0070671_100726291Not Available862Open in IMG/M
3300005365|Ga0070688_100754922Not Available757Open in IMG/M
3300005367|Ga0070667_100363340Not Available1312Open in IMG/M
3300005367|Ga0070667_101823258Not Available572Open in IMG/M
3300005445|Ga0070708_101387677Not Available655Open in IMG/M
3300005466|Ga0070685_11080174Not Available605Open in IMG/M
3300005467|Ga0070706_100437493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1217Open in IMG/M
3300005841|Ga0068863_101238112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum752Open in IMG/M
3300005843|Ga0068860_101168732All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum789Open in IMG/M
3300009177|Ga0105248_10813851Not Available1054Open in IMG/M
3300009553|Ga0105249_11329532Not Available790Open in IMG/M
3300009972|Ga0105137_101709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum849Open in IMG/M
3300009972|Ga0105137_104205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum669Open in IMG/M
3300009975|Ga0105129_102223All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum942Open in IMG/M
3300009980|Ga0105135_105265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum851Open in IMG/M
3300009980|Ga0105135_110827Not Available701Open in IMG/M
3300009981|Ga0105133_101724All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1117Open in IMG/M
3300009992|Ga0105120_1023649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum693Open in IMG/M
3300009992|Ga0105120_1025406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum677Open in IMG/M
3300009993|Ga0105028_117381Not Available771Open in IMG/M
3300009994|Ga0105126_1017465Not Available754Open in IMG/M
3300009994|Ga0105126_1027247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300009994|Ga0105126_1033446Not Available612Open in IMG/M
3300009995|Ga0105139_1068789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum654Open in IMG/M
3300009995|Ga0105139_1108193Not Available537Open in IMG/M
3300010397|Ga0134124_11141779Not Available797Open in IMG/M
3300010399|Ga0134127_11138966Not Available845Open in IMG/M
3300010400|Ga0134122_13242707Not Available510Open in IMG/M
3300010401|Ga0134121_11101915All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum787Open in IMG/M
3300010403|Ga0134123_10715636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum981Open in IMG/M
3300014326|Ga0157380_11904738Not Available655Open in IMG/M
3300015270|Ga0182183_1078536Not Available536Open in IMG/M
3300015273|Ga0182102_1004359All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum920Open in IMG/M
3300015278|Ga0182099_1008392Not Available897Open in IMG/M
3300015280|Ga0182100_1026687Not Available777Open in IMG/M
3300015280|Ga0182100_1058956Not Available605Open in IMG/M
3300015280|Ga0182100_1062579All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum593Open in IMG/M
3300015284|Ga0182101_1028385Not Available760Open in IMG/M
3300015284|Ga0182101_1087129All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum528Open in IMG/M
3300015293|Ga0182103_1073405Not Available566Open in IMG/M
3300015301|Ga0182184_1059248Not Available605Open in IMG/M
3300015306|Ga0182180_1030840All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum752Open in IMG/M
3300015309|Ga0182098_1086583Not Available579Open in IMG/M
3300015310|Ga0182162_1102458Not Available550Open in IMG/M
3300015311|Ga0182182_1116772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300015312|Ga0182168_1040688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum786Open in IMG/M
3300015313|Ga0182164_1066343Not Available664Open in IMG/M
3300015315|Ga0182120_1139060Not Available503Open in IMG/M
3300015316|Ga0182121_1103834All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum579Open in IMG/M
3300015317|Ga0182136_1044347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum770Open in IMG/M
3300015319|Ga0182130_1036255Not Available802Open in IMG/M
3300015319|Ga0182130_1056764All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum692Open in IMG/M
3300015320|Ga0182165_1012449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1185Open in IMG/M
3300015320|Ga0182165_1068268Not Available679Open in IMG/M
3300015324|Ga0182134_1067707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum679Open in IMG/M
3300015324|Ga0182134_1143831Not Available508Open in IMG/M
3300015325|Ga0182148_1019697All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum995Open in IMG/M
3300015327|Ga0182114_1124799Not Available562Open in IMG/M
3300015328|Ga0182153_1034406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum862Open in IMG/M
3300015329|Ga0182135_1023729Not Available982Open in IMG/M
3300015329|Ga0182135_1050273Not Available769Open in IMG/M
3300015329|Ga0182135_1078119Not Available657Open in IMG/M
3300015330|Ga0182152_1108742Not Available580Open in IMG/M
3300015332|Ga0182117_1141027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum546Open in IMG/M
3300015333|Ga0182147_1072469All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300015333|Ga0182147_1151212Not Available528Open in IMG/M
3300015336|Ga0182150_1076715Not Available683Open in IMG/M
3300015337|Ga0182151_1083304Not Available662Open in IMG/M
3300015340|Ga0182133_1186411All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300015349|Ga0182185_1073378All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum946Open in IMG/M
3300015349|Ga0182185_1106077All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum811Open in IMG/M
3300015350|Ga0182163_1253945Not Available551Open in IMG/M
3300015353|Ga0182179_1309015Not Available515Open in IMG/M
3300015354|Ga0182167_1139555All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum894Open in IMG/M
3300015354|Ga0182167_1204921Not Available721Open in IMG/M
3300015354|Ga0182167_1215101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum700Open in IMG/M
3300015354|Ga0182167_1357948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum509Open in IMG/M
3300017412|Ga0182199_1085771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum704Open in IMG/M
3300017412|Ga0182199_1149449Not Available570Open in IMG/M
3300017414|Ga0182195_1094444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum706Open in IMG/M
3300017422|Ga0182201_1100255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum573Open in IMG/M
3300017432|Ga0182196_1035297All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum833Open in IMG/M
3300017432|Ga0182196_1051501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum737Open in IMG/M
3300017432|Ga0182196_1061750Not Available694Open in IMG/M
3300017439|Ga0182200_1080815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300017440|Ga0182214_1046346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum867Open in IMG/M
3300017440|Ga0182214_1096156Not Available628Open in IMG/M
3300017447|Ga0182215_1126441All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum581Open in IMG/M
3300017693|Ga0182216_1201702Not Available524Open in IMG/M
3300017694|Ga0182211_1058768Not Available884Open in IMG/M
3300017694|Ga0182211_1070457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum808Open in IMG/M
3300020031|Ga0182119_101281All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum829Open in IMG/M
3300025931|Ga0207644_11749797Not Available520Open in IMG/M
3300026035|Ga0207703_10706827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum959Open in IMG/M
3300028049|Ga0268322_1021638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum693Open in IMG/M
3300028051|Ga0268344_1007939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum721Open in IMG/M
3300028055|Ga0268338_1010376Not Available784Open in IMG/M
3300028055|Ga0268338_1032141Not Available560Open in IMG/M
3300028058|Ga0268332_1073364Not Available517Open in IMG/M
3300028153|Ga0268320_1011365Not Available672Open in IMG/M
3300028472|Ga0268315_1003675Not Available910Open in IMG/M
3300028525|Ga0268305_102146All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum861Open in IMG/M
3300028529|Ga0268311_1002664All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1039Open in IMG/M
3300032464|Ga0214492_1108861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300032465|Ga0214493_1064699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum869Open in IMG/M
3300032466|Ga0214503_1043160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1330Open in IMG/M
3300032466|Ga0214503_1175660Not Available668Open in IMG/M
3300032469|Ga0214491_1162494Not Available516Open in IMG/M
3300032490|Ga0214495_1068087Not Available830Open in IMG/M
3300032502|Ga0214490_1060567All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum863Open in IMG/M
3300032514|Ga0214502_1233150Not Available703Open in IMG/M
3300032551|Ga0321339_1098948Not Available665Open in IMG/M
3300032589|Ga0214500_1086860All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum885Open in IMG/M
3300032625|Ga0214501_1037520All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1477Open in IMG/M
3300032699|Ga0214494_1074594All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300032791|Ga0314748_1033942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1068Open in IMG/M
3300032915|Ga0314749_1092578All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum651Open in IMG/M
3300033526|Ga0314761_1080436All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum724Open in IMG/M
3300033530|Ga0314760_1125306Not Available631Open in IMG/M
3300033540|Ga0314764_1020493All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1061Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere62.90%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated11.29%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere7.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere5.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.03%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009993Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020031Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028051Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028153Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028472Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028525Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032502Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032915Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033540Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070690_10133372313300005330Switchgrass RhizosphereMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0070666_1064815023300005335Switchgrass RhizosphereMTKSEEIMLQVDIKDKEGVVHGFWMVQSTKDVLDRGKESHQEVTRER*
Ga0070666_1092403423300005335Switchgrass RhizosphereMTQSEEIMLQVDNKDKEGVVHRYWMVQSIKDVLDRGKKLRQEVTRER*
Ga0070668_10148419713300005347Switchgrass RhizosphereMTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER*
Ga0070671_10072629123300005355Switchgrass RhizosphereMTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER*
Ga0070688_10075492213300005365Switchgrass RhizosphereMLQVDIKGKEGVVHMIWAVQSIQDVLDRSKELHQEATREN*
Ga0070667_10036334013300005367Switchgrass RhizosphereMTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER*
Ga0070667_10182325813300005367Switchgrass RhizosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTR
Ga0070708_10138767713300005445Corn, Switchgrass And Miscanthus RhizosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR*
Ga0070685_1108017413300005466Switchgrass RhizosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER*
Ga0070706_10043749323300005467Corn, Switchgrass And Miscanthus RhizosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0068863_10123811223300005841Switchgrass RhizosphereMTQSEEIILQVDNKDKEEVVHGFWTVQSIKDVLDRGKESHQEVTRER*
Ga0068860_10116873213300005843Switchgrass RhizosphereMTQSEEVILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR*
Ga0105248_1081385123300009177Switchgrass RhizosphereMTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQKVTRER*
Ga0105249_1132953223300009553Switchgrass RhizosphereMTQSEEVILNVDNKVKEGVVHGFWMVQSIKDVLDRGKELHQEVTRER*
Ga0105137_10170933300009972Switchgrass AssociatedMTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0105137_10420523300009972Switchgrass AssociatedMTQSEEVILQVDNKDKEGLVHGFWMVQSIKNVLDRGKKLRQEVTRER*
Ga0105129_10222313300009975Switchgrass AssociatedKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0105135_10526523300009980Switchgrass AssociatedMTQSEKIMLQVHNKDKEGAVHGFWMVQSIKDVLDRGKKLRQEVTRKR*
Ga0105135_11082723300009980Switchgrass AssociatedMTQSEEVILQVDNKDKEGVVHGFWTVQTIKDVLDRGKESHQEVTRER*
Ga0105133_10172413300009981Switchgrass AssociatedMTQIEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0105120_102364923300009992Switchgrass AssociatedMTQSEEIILQVDNKDKEGVVHGFWKVQSIKDVLNRGKESHQEVTIER*
Ga0105120_102540623300009992Switchgrass AssociatedMTQSEKIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER*
Ga0105028_11738113300009993Switchgrass AssociatedMTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTRER*
Ga0105126_101746523300009994Switchgrass AssociatedMTQSEEIMLQVDNKDKEGVVHRFWMVQSIKDVLDRGKKLRQEVTRER*
Ga0105126_102724723300009994Switchgrass AssociatedMTQTEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTRER*
Ga0105126_103344623300009994Switchgrass AssociatedMTQSEEIMLQVDNKVKEGVVHGFWTVQSIKYVLDRGKKLRQEVTRER*
Ga0105139_106878913300009995Switchgrass AssociatedMTQSGEIMLQVDIKGKEGVVHMIWAVQSIKDVLYRGKKLRQEVTRER*
Ga0105139_110819313300009995Switchgrass AssociatedMTQSEEVILQVENKDNEGVVHGFWMVQNIKDVLDRGKESHQKVTRER*
Ga0134124_1114177913300010397Terrestrial SoilMTQSEEVILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0134127_1113896623300010399Terrestrial SoilMGQSEEIMLPVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0134122_1324270713300010400Terrestrial SoilMTQSEEIILHVDNKDKEGVVHGFWTVQSIKDVLDRGKKL
Ga0134121_1110191523300010401Terrestrial SoilMTQSEEIMLQVDNKDKEGVVHEFWMVQSIKDVLDRGKKLLQEVTRER*
Ga0134123_1071563623300010403Terrestrial SoilMTQSEEIILHVDNKDKEGVVHGFWTVQSIKDVLDRGKKLHQGVTRKRGSEGGPGTP*
Ga0157380_1190473823300014326Switchgrass RhizosphereMTQSEEVILQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER*
Ga0182183_107853623300015270Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKESYQEVTRER*
Ga0182102_100435923300015273Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGIWTVQSTKYELDRSNEFHQEATRERRSGGGPEMP*
Ga0182099_100839223300015278Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVIRER*
Ga0182100_102668723300015280Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKESHQEVTRER*
Ga0182100_105895623300015280Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHGVWTVQSIKDELDRGKESHQEVTRER*
Ga0182100_106257923300015280Switchgrass PhyllosphereMTQSEETMLQVDNMDKEGVVHGFWTEQSIKDVLDRGKKLR*
Ga0182101_102838513300015284Switchgrass PhyllosphereMTQSEEIMLQVDMKYKGVVHEFWMVQSTKDVQDKGKELHQEATSER*
Ga0182101_108712913300015284Switchgrass PhyllosphereEIMLQVDIKDKEGVVHEFWTVQSIKDILDRGKKLRQEVTRER*
Ga0182103_107340513300015293Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKL
Ga0182184_105924823300015301Switchgrass PhyllosphereMTHSEEAILQVDNKDKEGVVQRFWMVKSIKDVLDRGKESHQEVTRER*
Ga0182180_103084023300015306Switchgrass PhyllosphereMTQSEEVILQVDIKDKEGVVHRFWTVQSIKDVLDRGKESHQEVIRER*
Ga0182098_108658323300015309Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTRER*
Ga0182162_110245823300015310Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTREI*
Ga0182182_111677213300015311Switchgrass PhyllosphereMIQSEEIMLQVDIKDKEGVVHRFWTAQITKDVLDRGKESHQEVTRER*
Ga0182168_104068813300015312Switchgrass PhyllosphereMTQSEEIILQVDNNNKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER*
Ga0182164_106634313300015313Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHSFWMVQSIKDVLDRGKKSHPEVTRER*
Ga0182120_113906013300015315Switchgrass PhyllosphereMTQSEEIMLQVDIKDKEGVLHGFWTVQSTKDVLDRGKESHQEATRERRSGGGPGEL*
Ga0182121_110383423300015316Switchgrass PhyllosphereMTQSKEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER*
Ga0182136_104434723300015317Switchgrass PhyllosphereMTQSEEIILQVDNKDKGGVVHGFWMGQSIKDVLDRGKESHKEVTRER*
Ga0182130_103625513300015319Switchgrass PhyllosphereMTQSEEEILQVENKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRKR*
Ga0182130_105676413300015319Switchgrass PhyllosphereMTQSGEIILQVDYKDKEGVVHRIWTVQSTKDELDRSNEFHQEATRERRSGGGPEMP*
Ga0182165_101244933300015320Switchgrass PhyllosphereMTQSEKIMLQVDNKDKEGMVHGFWTVQSIKDVLDRGKKLRQEVTRKR*
Ga0182165_106826813300015320Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVYGFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0182134_106770723300015324Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLCQEVTRER*
Ga0182134_114383113300015324Switchgrass PhyllosphereMTQSEEIMLQVDNKGKEGVVHGFWMMQSIKDVLDRGNKLRQEVTRER*
Ga0182148_101969713300015325Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKESHQKVTRERSSRGGPGTP*
Ga0182114_112479913300015327Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGVVHSFWMVQSIKDVLDRGKKSHPEVTRER*
Ga0182153_103440613300015328Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKKLHQEVTRER*
Ga0182135_102372913300015329Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKKLLQEVTRER*
Ga0182135_105027333300015329Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHEFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0182135_107811923300015329Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTRQR*
Ga0182152_110874213300015330Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLR*
Ga0182117_114102723300015332Switchgrass PhyllosphereDNKDKEGVVHGFWIVQSIKDVLDRGKKLRREVTRKR*
Ga0182147_107246923300015333Switchgrass PhyllosphereLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER*
Ga0182147_115121213300015333Switchgrass PhyllosphereMTQSEEIILQVDIKDKEGVVYGFWTVQSTKDVLDRGKESHQEVTRERRSGGGPGTP*
Ga0182150_107671523300015336Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGMVHGFWMVQSIKNVLDRGKESHQEVTR*
Ga0182151_108330423300015337Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHGLWTVQSIKDVLYRGKKLRQEVTRER*
Ga0182133_118641113300015340Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHGFWMVKSIKDVLDRGKKLRQEVTRER*
Ga0182185_107337823300015349Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQRIKDVLDRGKKLCQEVTRKR*
Ga0182185_110607723300015349Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGMVHGFWMVQSIKNVLDRGKESHQEVTREI*
Ga0182163_125394523300015350Switchgrass PhyllosphereMTQNDEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR*
Ga0182179_130901513300015353Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHGFWTVQNIKDVLDRGKKLRQEVTRER
Ga0182167_113955513300015354Switchgrass PhyllosphereQVDNKDKEGVVHRFWTVQSIKDVLDRGKESHQEVTRER*
Ga0182167_120492113300015354Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGMVHGFWMVQSIKDVLDRGKESHQEVTRE
Ga0182167_121510113300015354Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDALDRGQKLRQEVTRER*
Ga0182167_135794813300015354Switchgrass PhyllosphereMTQSEEIMLQVDIKDKEGVVHGFWTAQSTKDVLDRGKESHQEVTRERRSGGGPGTP*
Ga0182199_108577133300017412Switchgrass PhyllosphereLQVDNKDKEGVVHGFWTVQIIKDVLDRDKKSHQEVTRER
Ga0182199_114944913300017412Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGMVHGFWTMQSIKDVLDRGKESHQKVTRER
Ga0182195_109444423300017414Switchgrass PhyllosphereMTQSEEIMLQVDIKNKEGVVHGFWTVQSTKDVLDRGKELHQEATRER
Ga0182201_110025513300017422Switchgrass PhyllosphereVDNKDKEGVVHGLWTVQSIKDVLYRGKKLRQEVTRER
Ga0182196_103529723300017432Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQKVTRER
Ga0182196_105150113300017432Switchgrass PhyllosphereMTQSEEIILQVDNKEKEGVVHRFWMVQSIKDVLDRGKKLRQEVTRER
Ga0182196_106175023300017432Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRKR
Ga0182200_108081513300017439Switchgrass PhyllosphereMTQSVRVILEVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER
Ga0182214_104634613300017440Switchgrass PhyllosphereMTQSEEIMLQVDIKGKEGVVHRIWMVQSMKDVLDRSKQLHQQATREN
Ga0182214_109615623300017440Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGVVHGFWTVQSIKDVLDRGKES
Ga0182215_112644123300017447Switchgrass PhyllosphereNKDKEGVVHGFWTVQSIKDVLDRGKKLHQEVTRER
Ga0182216_120170213300017693Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKSHPEVTRER
Ga0182211_105876823300017694Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGGVHGFWTVQSIKDVLDRGKKLRQEVTRER
Ga0182211_107045723300017694Switchgrass PhyllosphereMTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER
Ga0182119_10128123300020031Switchgrass PhyllosphereMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR
Ga0207644_1174979713300025931Switchgrass RhizosphereMTQSEEIMLQVDNKDKEGVVHRFWMVQRTKYVLDRGKKLHQEVTRER
Ga0207703_1070682723300026035Switchgrass RhizosphereMTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER
Ga0268322_102163823300028049PhyllosphereMTQSEEVILQVDNKDKEGMVHGFWMVQSIKNVLDRGKESHQEVTREI
Ga0268344_100793913300028051PhyllosphereMTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER
Ga0268338_101037623300028055PhyllosphereMTQSEEIILQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRKR
Ga0268338_103214113300028055PhyllosphereMTQSEEIILEVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER
Ga0268332_107336413300028058PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTVKSIKDVLDRGKKLRQEVTRER
Ga0268320_101136513300028153PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDGGKKLRQEVTRKR
Ga0268315_100367513300028472PhyllosphereMTQSEEVILQVDNKDKEGVVHGFWMVQSIKDVLDRGKESHQEVTR
Ga0268305_10214623300028525PhyllosphereMTQSEEIILQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER
Ga0268311_100266423300028529PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLCQEVARER
Ga0214492_110886113300032464Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER
Ga0214493_106469933300032465Switchgrass PhyllosphereMLQVDNKDKEGVVHGFWMVESIKDVLDRGKKLRQEVTRER
Ga0214503_104316023300032466Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHRFWMVQSIKYVLDRGKKLRQEVTRER
Ga0214503_117566013300032466Switchgrass PhyllosphereMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKESHQEVTRER
Ga0214491_116249423300032469Switchgrass PhyllosphereMTQSEETMLQVDNMDKEGVVHGFWTEQSIKDVLDRGKKLRQEVPRER
Ga0214495_106808713300032490Switchgrass PhyllosphereMTQSGEIMLQVDIKGKEGVVHMIWVVQSIQDVLDRSKSLHQEATREN
Ga0214490_106056723300032502Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVTRER
Ga0214502_123315013300032514Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVQGFWTVQSIKDVLDRGKKLRQEVPRER
Ga0321339_109894823300032551Switchgrass PhyllosphereMTQSEEVILQVDNKDKEGVVHGFWTEQSIKDVLDRGKKLR
Ga0214500_108686023300032589Switchgrass PhyllosphereMLQVDNKDKEGVVHGFWTAQSIKELLDRGKKLRQEVTRER
Ga0214501_103752023300032625Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWMVQSIKDVLDRGKKLRQEVPRER
Ga0214494_107459413300032699Switchgrass PhyllosphereMTQSKEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVTRER
Ga0314748_103394223300032791Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKYVLDRVKKLRQEVTRER
Ga0314749_109257823300032915Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTAQSIKELLDRGKKLRQEVTRER
Ga0314761_108043623300033526Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTAQRIKDVLDRGKKLRQKVTRER
Ga0314760_112530623300033530Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGWVHGFWTVQSIKDVLDRGKKLRQEVTRER
Ga0314764_102049323300033540Switchgrass PhyllosphereMTQSEEIMLQVDNKDKEGVVHGFWTVQSIKDVLDRGKKLRQEVPRER

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.