Metagenome / Metatranscriptome Family F068385

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F068385
Family Type	Metagenome / Metatranscriptome
Number of Sequences	124
Average Sequence Length	42 residues
Representative Sequence	MISLVSYEMKETPQFKTIMRAKDSISKIKDLSSLKCHKEMKDTFS
Number of Associated Samples	85
Number of Associated Scaffolds	124

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	41.13 %
% of genes near scaffold ends (potentially truncated)	86.29 %
% of genes from short scaffolds (< 2000 bps)	95.97 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (87.097 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (79.032 % of family members)
Environment Ontology (ENVO)	Unclassified (91.129 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (70.968 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 56.16% β-sheet: 0.00% Coil/Unstructured: 43.84%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 124 Family Scaffolds
PF00931	NB-ARC	0.81

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
All Organisms	root	All Organisms	12.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
cellular organisms	root	All Organisms → cellular organisms	12.10 %
Viruses	superkingdom	All Organisms → Viruses	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	12.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	12.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	12.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	12.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	12.10 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	11.29 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	9.68 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	9.68 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	9.68 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	9.68 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	6.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	6.45 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	4.84 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.81 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	0.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	87.10 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	4.84 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	0.81 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.81 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005335\|Ga0070666_10469113	Not Available	910	Open in IMG/M
3300005347\|Ga0070668_101870761	Not Available	552	Open in IMG/M
3300005440\|Ga0070705_101806305	Not Available	518	Open in IMG/M
3300005615\|Ga0070702_101401055	Not Available	571	Open in IMG/M
3300005617\|Ga0068859_102127038	Not Available	619	Open in IMG/M
3300005841\|Ga0068863_102419962	Not Available	535	Open in IMG/M
3300009092\|Ga0105250_10388690	Not Available	617	Open in IMG/M
3300009975\|Ga0105129_108662	Not Available	658	Open in IMG/M
3300009981\|Ga0105133_113813	Not Available	650	Open in IMG/M
3300009989\|Ga0105131_132603	Not Available	561	Open in IMG/M
3300009989\|Ga0105131_139094	Not Available	526	Open in IMG/M
3300009990\|Ga0105132_113945	Not Available	722	Open in IMG/M
3300009992\|Ga0105120_1051041	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	524	Open in IMG/M
3300009995\|Ga0105139_1054076	Not Available	713	Open in IMG/M
3300010274\|Ga0134100_1064682	Not Available	666	Open in IMG/M
3300010371\|Ga0134125_12419934	Not Available	571	Open in IMG/M
3300010396\|Ga0134126_12060803	Not Available	623	Open in IMG/M
3300010399\|Ga0134127_11672080	Not Available	711	Open in IMG/M
3300015270\|Ga0182183_1008510	Not Available	1009	Open in IMG/M
3300015270\|Ga0182183_1064324	Not Available	572	Open in IMG/M
3300015273\|Ga0182102_1040165	Not Available	526	Open in IMG/M
3300015278\|Ga0182099_1037990	Not Available	608	Open in IMG/M
3300015280\|Ga0182100_1024707	Not Available	795	Open in IMG/M
3300015280\|Ga0182100_1029614	Not Available	753	Open in IMG/M
3300015284\|Ga0182101_1078004	Not Available	550	Open in IMG/M
3300015290\|Ga0182105_1010463	Not Available	1050	Open in IMG/M
3300015290\|Ga0182105_1049634	Not Available	660	Open in IMG/M
3300015290\|Ga0182105_1055058	Not Available	638	Open in IMG/M
3300015290\|Ga0182105_1066811	Not Available	598	Open in IMG/M
3300015297\|Ga0182104_1051225	Not Available	680	Open in IMG/M
3300015301\|Ga0182184_1024708	Not Available	803	Open in IMG/M
3300015301\|Ga0182184_1028194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	771	Open in IMG/M
3300015309\|Ga0182098_1110285	Not Available	531	Open in IMG/M
3300015310\|Ga0182162_1049897	Not Available	711	Open in IMG/M
3300015312\|Ga0182168_1053502	Not Available	716	Open in IMG/M
3300015316\|Ga0182121_1112687	Not Available	560	Open in IMG/M
3300015317\|Ga0182136_1011853	Not Available	1158	Open in IMG/M
3300015319\|Ga0182130_1069186	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	647	Open in IMG/M
3300015319\|Ga0182130_1071502	Not Available	640	Open in IMG/M
3300015320\|Ga0182165_1050168	Not Available	757	Open in IMG/M
3300015320\|Ga0182165_1090012	Not Available	612	Open in IMG/M
3300015320\|Ga0182165_1146499	Not Available	503	Open in IMG/M
3300015325\|Ga0182148_1054320	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	724	Open in IMG/M
3300015325\|Ga0182148_1066278	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	676	Open in IMG/M
3300015325\|Ga0182148_1084492	Not Available	620	Open in IMG/M
3300015326\|Ga0182166_1088374	Not Available	608	Open in IMG/M
3300015330\|Ga0182152_1006274	Not Available	1461	Open in IMG/M
3300015330\|Ga0182152_1127318	Not Available	545	Open in IMG/M
3300015331\|Ga0182131_1088436	Not Available	631	Open in IMG/M
3300015332\|Ga0182117_1074095	Not Available	711	Open in IMG/M
3300015332\|Ga0182117_1117739	Not Available	589	Open in IMG/M
3300015333\|Ga0182147_1071562	Not Available	712	Open in IMG/M
3300015333\|Ga0182147_1108002	Not Available	607	Open in IMG/M
3300015335\|Ga0182116_1018205	Not Available	1180	Open in IMG/M
3300015335\|Ga0182116_1027906	Not Available	1031	Open in IMG/M
3300015335\|Ga0182116_1156724	Not Available	535	Open in IMG/M
3300015338\|Ga0182137_1035210	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	952	Open in IMG/M
3300015339\|Ga0182149_1074077	Not Available	711	Open in IMG/M
3300015340\|Ga0182133_1028551	Not Available	1046	Open in IMG/M
3300015340\|Ga0182133_1067845	Not Available	773	Open in IMG/M
3300015340\|Ga0182133_1109058	Not Available	642	Open in IMG/M
3300015340\|Ga0182133_1188328	Not Available	506	Open in IMG/M
3300015340\|Ga0182133_1188638	Not Available	506	Open in IMG/M
3300015348\|Ga0182115_1291814	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	515	Open in IMG/M
3300015349\|Ga0182185_1001703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	2978	Open in IMG/M
3300015349\|Ga0182185_1016273	Not Available	1609	Open in IMG/M
3300015349\|Ga0182185_1285935	Not Available	504	Open in IMG/M
3300015350\|Ga0182163_1035013	Not Available	1345	Open in IMG/M
3300015350\|Ga0182163_1035528	Not Available	1338	Open in IMG/M
3300015350\|Ga0182163_1077318	Not Available	984	Open in IMG/M
3300015350\|Ga0182163_1132459	Not Available	770	Open in IMG/M
3300015350\|Ga0182163_1210940	Not Available	609	Open in IMG/M
3300015353\|Ga0182179_1137640	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	755	Open in IMG/M
3300015353\|Ga0182179_1272073	Not Available	548	Open in IMG/M
3300015354\|Ga0182167_1250528	Not Available	638	Open in IMG/M
3300015354\|Ga0182167_1281183	Not Available	594	Open in IMG/M
3300015354\|Ga0182167_1288467	Not Available	585	Open in IMG/M
3300017408\|Ga0182197_1070591	Not Available	672	Open in IMG/M
3300017408\|Ga0182197_1106042	Not Available	577	Open in IMG/M
3300017412\|Ga0182199_1058196	Not Available	809	Open in IMG/M
3300017414\|Ga0182195_1016657	Not Available	1259	Open in IMG/M
3300017414\|Ga0182195_1051168	Not Available	879	Open in IMG/M
3300017421\|Ga0182213_1252671	Not Available	505	Open in IMG/M
3300017432\|Ga0182196_1067944	Not Available	671	Open in IMG/M
3300017445\|Ga0182198_1149342	Not Available	568	Open in IMG/M
3300017691\|Ga0182212_1092306	Not Available	677	Open in IMG/M
3300017693\|Ga0182216_1003538	Not Available	2246	Open in IMG/M
3300017693\|Ga0182216_1095121	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	707	Open in IMG/M
3300017693\|Ga0182216_1184922	Not Available	544	Open in IMG/M
3300017694\|Ga0182211_1116781	Not Available	628	Open in IMG/M
3300017694\|Ga0182211_1153169	Not Available	549	Open in IMG/M
3300022466\|Ga0213504_101381	Not Available	945	Open in IMG/M
3300026088\|Ga0207641_12211498	Not Available	550	Open in IMG/M
3300028049\|Ga0268322_1052191	Not Available	518	Open in IMG/M
3300028054\|Ga0268306_1017047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	636	Open in IMG/M
3300028056\|Ga0268330_1001776	All Organisms → Viruses → Predicted Viral	1545	Open in IMG/M
3300028144\|Ga0268345_1017228	Not Available	594	Open in IMG/M
3300028475\|Ga0268327_1008366	Not Available	714	Open in IMG/M
3300028475\|Ga0268327_1019038	Not Available	563	Open in IMG/M
3300028475\|Ga0268327_1023898	Not Available	526	Open in IMG/M
3300032464\|Ga0214492_1000214	Not Available	4581	Open in IMG/M
3300032465\|Ga0214493_1028673	Not Available	1252	Open in IMG/M
3300032466\|Ga0214503_1043281	Not Available	1328	Open in IMG/M
3300032467\|Ga0214488_1061971	Not Available	829	Open in IMG/M
3300032468\|Ga0214482_1047630	Not Available	829	Open in IMG/M
3300032502\|Ga0214490_1023799	Not Available	1296	Open in IMG/M
3300032502\|Ga0214490_1115076	Not Available	612	Open in IMG/M
3300032625\|Ga0214501_1236766	Not Available	579	Open in IMG/M
3300032697\|Ga0214499_1240929	Not Available	558	Open in IMG/M
3300032760\|Ga0314754_1002425	Not Available	2237	Open in IMG/M
3300032792\|Ga0314744_1000489	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	3986	Open in IMG/M
3300032812\|Ga0314745_1018507	Not Available	1397	Open in IMG/M
3300032825\|Ga0314724_105998	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1202	Open in IMG/M
3300032843\|Ga0314736_1049526	Not Available	538	Open in IMG/M
3300032844\|Ga0314743_1053337	Not Available	945	Open in IMG/M
3300032844\|Ga0314743_1150744	Not Available	511	Open in IMG/M
3300032889\|Ga0314751_1097820	Not Available	591	Open in IMG/M
3300032890\|Ga0314747_1064565	Not Available	526	Open in IMG/M
3300032913\|Ga0314739_1097394	Not Available	538	Open in IMG/M
3300032915\|Ga0314749_1094765	Not Available	642	Open in IMG/M
3300032934\|Ga0314741_1037211	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1105	Open in IMG/M
3300032976\|Ga0314752_1036605	Not Available	934	Open in IMG/M
3300033526\|Ga0314761_1032971	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1114	Open in IMG/M
3300033533\|Ga0314770_1216762	Not Available	600	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	95.16%
Environmental	Environmental	4.03%
Engineered	Engineered	0.81%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	95.16%
Terrestrial	Environmental → Terrestrial	4.03%
Bioreactor	Engineered → Bioreactor	0.81%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	84.68%
Unclassified	Host-Associated → Plants → Unclassified	5.65%
Soil	Environmental → Terrestrial → Soil	4.03%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.42%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.42%
Unclassified	Engineered → Bioreactor → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	84.68%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	5.65%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.42%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.42%
Loam	Environmental → Terrestrial → Soil → Loam	1.61%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.81%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	84.68%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	5.65%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	2.42%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.81%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	79.03%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	5.65%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	5.65%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.42%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010274	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 11_42_5_180_A3 metaG	Engineered	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300022466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12SEP2016_LR1 MT pilot (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028144	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028475	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300032464	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032468	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032760	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032825	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032843	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032844	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032889	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032890	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032913	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032976	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033533	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070666_104691131	3300005335	Switchgrass Rhizosphere	MIRLVSYEMNETPQFETIMHAKDSISKIKDISSLKCHKEMKDTFS*
Ga0070668_1018707612	3300005347	Switchgrass Rhizosphere	TGLVSYEIKETPQFETIMRTKDSIKIKDLSSLKCHKEMKDTFS
Ga0070705_1018063052	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	MISLVSYEMKETPQFKTIMRAKDSISKIKDLSSLKCHKEMKDTFS*
Ga0070702_1014010551	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MIDLVPYEMKETPQFVTITRAKDSISKIKDLSSLKCHKEMKDTFR*
Ga0068859_1021270381	3300005617	Switchgrass Rhizosphere	MINLVSYEMRKETPQFGTTMRAKDSISKIKELSSLKCHKEMKDT*
Ga0068863_1024199622	3300005841	Switchgrass Rhizosphere	MIGLVSYEMKETPQFETIMRAKDSIKIKDLSSLKCH
Ga0105250_103886901	3300009092	Switchgrass Rhizosphere	YEINETPQFETIMRAKDSISKIKDFSSLMCHKEMKDTFS*
Ga0105129_1086621	3300009975	Switchgrass Associated	PQFGTTMRAKDSILKIKNLSSLKCHKEMKDTFS
Ga0105133_1138131	3300009981	Switchgrass Associated	INETPQFETIMRAKDSISKIKDLSSLMYHKEMKDTFS*
Ga0105131_1326031	3300009989	Switchgrass Associated	LVSYEIKETPQFKTIMRANDSIPKINDLSSLKCHKEMNDTFS*
Ga0105131_1390942	3300009989	Switchgrass Associated	KETFQFETIMRAKNSISKIKDFSSLKCHKEMKDTFS*
Ga0105132_1139451	3300009990	Switchgrass Associated	LMISLVSYEMKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDTFS*
Ga0105120_10510412	3300009992	Switchgrass Associated	MIDLVPYEM*KETPQFGTIMRAKDSISKIKDLSSLKCHK
Ga0105139_10540761	3300009995	Switchgrass Associated	EINETPQFETIMRAKDSITKIKDISSLKCHKEMKDTFS*
Ga0134100_10646821	3300010274	Switchgrass Degrading	IKETPQFETIMRTKDSIKIKDLSSLKCHKEMKDTLFS*
Ga0134125_124199341	3300010371	Terrestrial Soil	MKETSQFKTIKRAKDSLSKIKDLSSVKCHKEMKDTFS
Ga0134126_120608031	3300010396	Terrestrial Soil	YEIKETPQFETIMRVKDSISKIKDLSSLKCHKEMKDTSFS
Ga0134127_116720801	3300010399	Terrestrial Soil	MIRLVSYEINETPQFETIMRAKDSISKVKDISSLMCHKEMKDTFS*
Ga0182183_10085102	3300015270	Switchgrass Phyllosphere	EKLMIDLVPYEMKETPQFGTIMRANDSISKIKDLSSLKCHKEMKDTFS*
Ga0182183_10643241	3300015270	Switchgrass Phyllosphere	GIKETPQFETNMGVKDTFSKIKDSSSLKCHKEMKDTFS*
Ga0182102_10401651	3300015273	Switchgrass Phyllosphere	LMINLVSYEMKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDTFS*
Ga0182099_10379901	3300015278	Switchgrass Phyllosphere	SYEIKETPQFKTIMRAKDSIPKIKDLSSLKCHKEMKGTFS*
Ga0182100_10247072	3300015280	Switchgrass Phyllosphere	MIVLVTYEIKETPQFETIMRDKDSFSKIKDLSSLKCHKEMKDTFSSGFIVFSS
Ga0182100_10296141	3300015280	Switchgrass Phyllosphere	ETPQFGTTMRAKDSISKIKDLSSLKCHKEMKDTFS
Ga0182101_10780041	3300015284	Switchgrass Phyllosphere	MIGLVSYEMKETPKFETIMHAKDSISKIKDLSSLKCHKEMNDTFS*
Ga0182105_10104633	3300015290	Switchgrass Phyllosphere	MIGLVSYEMKETPKFETIMRAKDSISKIKDLSSLKCHKEMNDTFS*
Ga0182105_10496342	3300015290	Switchgrass Phyllosphere	MFGLVTYEI*KETPQVETIMRAKNSFLKIKDHSSLKCHKEM
Ga0182105_10550581	3300015290	Switchgrass Phyllosphere	EKSMIGLVSYKIKETPQFEPIMRAMHSISKIKDISSLKCHKEMKDT
Ga0182105_10668111	3300015290	Switchgrass Phyllosphere	ENSMTGLVSYEIKETPQFETIMRTKDSIKIKDLSSLKCHKEMKDTFS
Ga0182104_10512251	3300015297	Switchgrass Phyllosphere	MIVLVTYEIKETPQFETIMCDKDSFSKIKDLSSLKCHKEMNDTFSSGFIVFS
Ga0182184_10247081	3300015301	Switchgrass Phyllosphere	KLMIKLVSYEMKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDTFS*
Ga0182184_10281942	3300015301	Switchgrass Phyllosphere	MIILVSYEMRKETPQFGTIMRAKDSILKIKDLSSLKCHKEM
Ga0182098_11102852	3300015309	Switchgrass Phyllosphere	MIRIVSYEI*KETPQFKTIMHANDSIPKIKDLSSLKCHKEMKD
Ga0182162_10498971	3300015310	Switchgrass Phyllosphere	VSYEIKETPQFKTIMRAKDSIPNIKNFSSLKCHKEMKDTFS*
Ga0182168_10535021	3300015312	Switchgrass Phyllosphere	MIKLVSYEMKETPQFGKTMRAKDSILKIKDLSSLKCHKEMKDTIRLSFIDLS*
Ga0182121_11126871	3300015316	Switchgrass Phyllosphere	EKSMIGLVSYEMKETPQFETIMRAKDSISKIKDLSSLKYHKEMKDTFS*
Ga0182136_10118532	3300015317	Switchgrass Phyllosphere	EIWKETPQFETNMRVKDTFSKIKDSSSLKCHGEMKDT*
Ga0182130_10691861	3300015319	Switchgrass Phyllosphere	MINLVSYEM*KETPQFGTIMRAKDSISKIKDLSSLKYHK
Ga0182130_10715021	3300015319	Switchgrass Phyllosphere	ETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDTFS
Ga0182165_10501682	3300015320	Switchgrass Phyllosphere	HMKCERRPPQFGTTMRAKDSILKIKDLSSLKCHKEMKDT*
Ga0182165_10900121	3300015320	Switchgrass Phyllosphere	IIRLVSYEINETPQFETILRAKGSILKIKDLSSLKCHKDEGHLI
Ga0182165_11464991	3300015320	Switchgrass Phyllosphere	MIGLVSYKI*KETPQFEPIMRAMHSISKIKDISSLKCHKE
Ga0182148_10543201	3300015325	Switchgrass Phyllosphere	MINLVSYEM*KETPQFGTIMRAKDSISKIKDLSSLKC
Ga0182148_10662781	3300015325	Switchgrass Phyllosphere	MIGLVSYEM*KETPQFETIMRAKDSISKIKDLSSL
Ga0182148_10844921	3300015325	Switchgrass Phyllosphere	TPQFKTIMRAKDSIPNIKDISSLKCHKEMKDTFS
Ga0182166_10883742	3300015326	Switchgrass Phyllosphere	NETPQFETIMRAKNSISKIKNLSSLMYHKEMKDTFSYVL*
Ga0182152_10062741	3300015330	Switchgrass Phyllosphere	MIRLVSYEMKETPQFETIMRAKDSISHIKDLSSLKCHKEMNDTF
Ga0182152_11273181	3300015330	Switchgrass Phyllosphere	MKETSQFKTIMHAKDSLSKIKDLSSVKCHKEMKGTF
Ga0182131_10884362	3300015331	Switchgrass Phyllosphere	MIGLVSYEM*KETPQFETIMRANELISKIKDLSSL
Ga0182117_10740952	3300015332	Switchgrass Phyllosphere	MFGLVTYEI*KETPQFETIMRAKDSFLKIKDLSSLKCHKE
Ga0182117_11177391	3300015332	Switchgrass Phyllosphere	MNGLVSYEM*KETPQFGTTMHAKDSILKIKDLSSLKC
Ga0182147_10715622	3300015333	Switchgrass Phyllosphere	LVSYEMKETPQFGTTMRAKDSISKIKDLSSLKCHKEMKDTFS*
Ga0182147_11080021	3300015333	Switchgrass Phyllosphere	MIRLVSYEINETPQFETIMRAKNSISKIKDLSSLMYHKETKDTF
Ga0182116_10182051	3300015335	Switchgrass Phyllosphere	IIIGLVTYEIKETPQFETNMRAQNSFSKIKDLSSL
Ga0182116_10279061	3300015335	Switchgrass Phyllosphere	YEMKETSQFKTIMRAKDSLSKIKDLSSVKCHKEMKDTFSSL
Ga0182116_11567242	3300015335	Switchgrass Phyllosphere	LVSYEMKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDTFS*
Ga0182137_10352102	3300015338	Switchgrass Phyllosphere	MINLVSYEMRKETSQFVTTMRAKDSILKVKDLSSLKCHK
Ga0182149_10740771	3300015339	Switchgrass Phyllosphere	VKIDPLIRNNMHAKDSISKIKDLSSLKCHKEMKDT*
Ga0182133_10285511	3300015340	Switchgrass Phyllosphere	MIRLVSYEM*KETPQFGTTMCAKDSILKIKDLSSLK
Ga0182133_10678451	3300015340	Switchgrass Phyllosphere	MFGLVTYEIKETTQFETIMRAKDSFLKIKDISSLKCHKEMKDTFS
Ga0182133_11090581	3300015340	Switchgrass Phyllosphere	EIKETPQFETIMRTKDSIKIKDLSSLKCHKEMKDTCS
Ga0182133_11883281	3300015340	Switchgrass Phyllosphere	EIKETPQFKTIMRAKDSILKIKDLSSLNCHKEMNDTFS*
Ga0182133_11886381	3300015340	Switchgrass Phyllosphere	MKETPQFKRANDSFKIKDPSSVKCHKEMNDTFS
Ga0182115_12918141	3300015348	Switchgrass Phyllosphere	MVSLVSYEMSKETPPFGTNMRAKNSILKVKDFSSLKCHKEMKDT*
Ga0182185_10017034	3300015349	Switchgrass Phyllosphere	MISLVSFEMKETPQFETIMRANDSISKIKDISSLKCHKEMKDTARIYSF*
Ga0182185_10162732	3300015349	Switchgrass Phyllosphere	MFGLVTYEI*KETPQFETIMRTKDSFLKIKDLSNFKCHKE
Ga0182185_12859351	3300015349	Switchgrass Phyllosphere	MINLVSYEM*KETPQFGTIMRAKDSISKIKDLSSLKCHKKM
Ga0182163_10350131	3300015350	Switchgrass Phyllosphere	MISLVSYEM*KETPQFGTTMRAKDSILKIKDLSSLKCHKEM
Ga0182163_10355281	3300015350	Switchgrass Phyllosphere	MIKLVSYEM*KETPQFGTTMRAKDSISKIKDLSSLKCHKEM
Ga0182163_10773181	3300015350	Switchgrass Phyllosphere	VTYEMKETPQFSMNRRATYLILKIKDLSSIECHNEMKDAFSSGFSSF*
Ga0182163_11324591	3300015350	Switchgrass Phyllosphere	KKSMIGLVAYEIKETPQFETIMRAKNSFSKVKDLSSLKCHKEMKDTFS*
Ga0182163_12109401	3300015350	Switchgrass Phyllosphere	MFGLVTYEIKETTQFETIMRAKDSFLKIKDISSLKCHKEMKDTFS*
Ga0182179_11376401	3300015353	Switchgrass Phyllosphere	MINLVSYEMKETPQFGTIMRAKDSISKIKDLSSLKYHKKMKDTF
Ga0182179_12720731	3300015353	Switchgrass Phyllosphere	MIGLVPYEM*KETPQFVTITRAKDSISKIKDLSSLKCHKEMKD
Ga0182167_12505281	3300015354	Switchgrass Phyllosphere	MIRLVSYEI*NETPQFETIMRGKDSVSKIKDLSSLMCHK
Ga0182167_12811831	3300015354	Switchgrass Phyllosphere	MFGLVTYEIKETPQFETIMRAKDSFLKIKDLSSLKYHKEMKDTWFS
Ga0182167_12884671	3300015354	Switchgrass Phyllosphere	MISLVSYEM*KETPQFGTTMRAKDSILKIKDLSSLKCHKE
Ga0182197_10705911	3300017408	Switchgrass Phyllosphere	IXKETPQFKTIMRAKDSIPKITDLSSLKCHKEMKDTXFS
Ga0182197_11060421	3300017408	Switchgrass Phyllosphere	MKCEKRPIKFVTITRAKDSISKIKDLSSLKCHKEMKD
Ga0182199_10581961	3300017412	Switchgrass Phyllosphere	MIGLVTYEIXKETPQFETIMRAKDSFLKIKDLSSLKYHKEMKDTXFS
Ga0182195_10166571	3300017414	Switchgrass Phyllosphere	MVSLVSYEMSKETPQFGTNMRAKNSILKVKDLSSLKCH
Ga0182195_10511681	3300017414	Switchgrass Phyllosphere	MIGLVPYEMXKETPQFVTITRAKDSISKIKDLSSLKCHKEMKD
Ga0182213_12526711	3300017421	Switchgrass Phyllosphere	MNGLVSYEMXKETPQFGTTMRAKDSISKIKDLSSLK
Ga0182196_10679442	3300017432	Switchgrass Phyllosphere	MINLVSYEMRIETPQFGTIMRAKDSISKIKDLSSLKCH
Ga0182198_11493421	3300017445	Switchgrass Phyllosphere	HEIXKENPQFETIMRAKDSFSKIKDISSLKCHKEMKDTXFS
Ga0182212_10923061	3300017691	Switchgrass Phyllosphere	EMXKETPQFGITMRAKDSILNIKELSSLKCHKEMKDTXFS
Ga0182216_10035384	3300017693	Switchgrass Phyllosphere	MFGLVTYEIXKDTPQFETIMRAKDSFLKIKDLSSLKCHKEMKDTXFS
Ga0182216_10951211	3300017693	Switchgrass Phyllosphere	MISLVSYKMXKETPQFKTTMRAKDSILKIKDLSSLKCHKEMK
Ga0182216_11849221	3300017693	Switchgrass Phyllosphere	MIILVSYEMXKETPQFGTIMRAKDSISKIKDLSSLKCH
Ga0182211_11167811	3300017694	Switchgrass Phyllosphere	VFEGKLMVNLVSYEMXKETLQFKTTMRAKGSISKIKDLSSLKCHKEMKDTXFS
Ga0182211_11531691	3300017694	Switchgrass Phyllosphere	MIRLFSYEIXKDTPQFETIMRAKDSFLKIKDLSSLKC
Ga0213504_1013812	3300022466	Switchgrass Phyllosphere	EKLMINLVSYEMRKETHQFGTTMRAKDSILKVKDLSSLKCHKEMKDTXFR
Ga0207641_122114981	3300026088	Switchgrass Rhizosphere	ILVSHEMQKETPQFGTSMRAKDSILKVKDLSSLKCHKEMKDT
Ga0268322_10521911	3300028049	Phyllosphere	MINLVPYEMXKETPQFGTIMRAKDSISKIKDLSSLKC
Ga0268306_10170471	3300028054	Phyllosphere	MIRLVSYEIXNETPQFETIMRANDSISKIKDLSSLMCHKEMKD
Ga0268330_10017761	3300028056	Phyllosphere	MXKETPQFRTTMRAKDSISKIKDLSRLKCHKEMKG
Ga0268345_10172281	3300028144	Phyllosphere	EMXKETPQFGTTMRANDSILKIKDLSCLKCHKEMKDTXFS
Ga0268327_10083661	3300028475	Phyllosphere	LSLVXNVKGDPSIQTIMRAKDSFLKIKDIFSVKCHKEMKDTXFS
Ga0268327_10190381	3300028475	Phyllosphere	EMXKETPQFGTIMRAKDSISKIKDLSSLKCHKEMKDT
Ga0268327_10238981	3300028475	Phyllosphere	MISLVSYEMXKETPQFKTIMRAKDSISKIKDLSSLRYHKEM
Ga0214492_10002141	3300032464	Switchgrass Phyllosphere	MIRLVSYEIXNETPQFETIMRAKDLISKIKDLSSLKCHKEMKDT
Ga0214493_10286733	3300032465	Switchgrass Phyllosphere	MIGLVSYEMXKETPQFESIMRDKDLISKIKDLSSLKCHKEMKDTXFS
Ga0214503_10432811	3300032466	Switchgrass Phyllosphere	MISLVSYEIXKETPQFKIIMHVKDSFSMIKDLSSLKCHKVM
Ga0214488_10619712	3300032467	Switchgrass Phyllosphere	MIRLISYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKETKDTXFS
Ga0214482_10476301	3300032468	Switchgrass Phyllosphere	MKYEIXKETPQFKSNMHVKDSISKIKDLSSLKCNKEMKDT
Ga0214490_10237991	3300032502	Switchgrass Phyllosphere	MKCEKETPQFVTTMRAKDSISKIKDLSSLKCYKEMKDT
Ga0214490_11150761	3300032502	Switchgrass Phyllosphere	LVSYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDTXFS
Ga0214501_12367661	3300032625	Switchgrass Phyllosphere	EIXKETPQFETIMRTKDSIXKIKDLSSLKCHKEMKDTXLS
Ga0214499_12409291	3300032697	Switchgrass Phyllosphere	EKSIIRLVSYEIXNETPQFETILRAKGSILKIKDLSSLKCHKDEGHLI
Ga0314754_10024252	3300032760	Switchgrass Phyllosphere	MISLVSYEIXKETPQFKIIMHVKDSFSMIKDLSSLKCHKVMKD
Ga0314744_10004894	3300032792	Switchgrass Phyllosphere	MINLVSYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKD
Ga0314745_10185071	3300032812	Switchgrass Phyllosphere	MIRLVSYEIXNETPQFETIMRAKDLISKIKDISSLKCHKEMKDT
Ga0314724_1059981	3300032825	Switchgrass Phyllosphere	MISLVSYEIXKETPQFKIIMHVKDSFSMIKDLSSL
Ga0314736_10495261	3300032843	Switchgrass Phyllosphere	MIRLVSYEIXNETPQFETIMRAKDLISKIKDLSSLKCHK
Ga0314743_10533371	3300032844	Switchgrass Phyllosphere	INLVSYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKDTXFS
Ga0314743_11507441	3300032844	Switchgrass Phyllosphere	INLVSYEMXKETPQFGTTMRAKDSILKIKDLSSLKCHKEMKNTXFS
Ga0314751_10978201	3300032889	Switchgrass Phyllosphere	MIKLVSYEMRKETPQFGTTMRAKDSILKIKDLSSLK
Ga0314747_10645651	3300032890	Switchgrass Phyllosphere	MIRLVSYEIXNETPQFETIMRAKDLISKIKDLSSLK
Ga0314739_10973942	3300032913	Switchgrass Phyllosphere	LIXNEIXNETPQFETIMRAKDSISKIKDLSSLKCHKEMKDT
Ga0314749_10947652	3300032915	Switchgrass Phyllosphere	GLVSYEISKETPQFEAIMRAKDSIXKIKDLSSLKCHKEMKYTXFS
Ga0314741_10372111	3300032934	Switchgrass Phyllosphere	MIRLVSYEIXNETPQFETIMRAKDLILKIKDISSLKCHKEMKDTXLS
Ga0314752_10366053	3300032976	Switchgrass Phyllosphere	LVSYEIXKETPQFKIIMHVKDSFSMIKDLSSLKCHKVMKDTXFS
Ga0314761_10329712	3300033526	Switchgrass Phyllosphere	MIRLVSYEIXNETPQFETIMHDKDLISKIKDLSSLKCHKEMKD
Ga0314770_12167621	3300033533	Switchgrass Phyllosphere	MISLVSYEIXKETPQFKIIMHVKDSFSMIKDLSSLKCHKVMKDT

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F068385

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences