NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068507

Metagenome / Metatranscriptome Family F068507

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068507
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 53 residues
Representative Sequence VPRVGYLWFGFLVLVGGLGVVVAALVLAELGWWVDWVAFEGLAAAASCGCSCS
Number of Associated Samples 81
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 66.13 %
% of genes near scaffold ends (potentially truncated) 26.61 %
% of genes from short scaffolds (< 2000 bps) 97.58 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (71.774 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(66.936 % of family members)
Environment Ontology (ENVO) Unclassified
(82.258 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(75.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 60.49%    β-sheet: 0.00%    Coil/Unstructured: 39.51%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF13650Asp_protease_2 2.42
PF03732Retrotrans_gag 1.61



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.19 %
UnclassifiedrootN/A25.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005331|Ga0070670_102263669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300005617|Ga0068859_100428868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1418Open in IMG/M
3300005617|Ga0068859_102835919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300005617|Ga0068859_103114486All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300005841|Ga0068863_100816465Not Available930Open in IMG/M
3300005841|Ga0068863_101874131Not Available609Open in IMG/M
3300005842|Ga0068858_102253370All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300005843|Ga0068860_102779256All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum507Open in IMG/M
3300006931|Ga0097620_100363471All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1542Open in IMG/M
3300009101|Ga0105247_11622143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300009973|Ga0105136_105161All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum723Open in IMG/M
3300009980|Ga0105135_101583Not Available1163Open in IMG/M
3300009980|Ga0105135_122909All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum559Open in IMG/M
3300009981|Ga0105133_117626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis608Open in IMG/M
3300009989|Ga0105131_115605Not Available705Open in IMG/M
3300009990|Ga0105132_104156All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum992Open in IMG/M
3300009995|Ga0105139_1000998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2197Open in IMG/M
3300009995|Ga0105139_1082530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum607Open in IMG/M
3300009995|Ga0105139_1093509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
3300010371|Ga0134125_12623717Not Available548Open in IMG/M
3300010396|Ga0134126_12792251All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300010397|Ga0134124_12190856Not Available592Open in IMG/M
3300010399|Ga0134127_12568127Not Available589Open in IMG/M
3300010400|Ga0134122_10179728Not Available1741Open in IMG/M
3300010400|Ga0134122_12079191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum608Open in IMG/M
3300010401|Ga0134121_11963792All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum616Open in IMG/M
3300010403|Ga0134123_12071268All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum629Open in IMG/M
3300010403|Ga0134123_12412904Not Available591Open in IMG/M
3300014325|Ga0163163_11323422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis782Open in IMG/M
3300014326|Ga0157380_11881199Not Available659Open in IMG/M
3300015270|Ga0182183_1030922Not Available714Open in IMG/M
3300015273|Ga0182102_1031815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum561Open in IMG/M
3300015273|Ga0182102_1036666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015278|Ga0182099_1026641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum668Open in IMG/M
3300015284|Ga0182101_1062045Not Available595Open in IMG/M
3300015284|Ga0182101_1098254All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300015290|Ga0182105_1024060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum826Open in IMG/M
3300015290|Ga0182105_1062872All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum610Open in IMG/M
3300015290|Ga0182105_1069988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum588Open in IMG/M
3300015290|Ga0182105_1106788Not Available503Open in IMG/M
3300015293|Ga0182103_1033771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum719Open in IMG/M
3300015293|Ga0182103_1052779Not Available629Open in IMG/M
3300015293|Ga0182103_1089745All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300015297|Ga0182104_1093103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300015297|Ga0182104_1106459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300015297|Ga0182104_1120078All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300015310|Ga0182162_1105425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015311|Ga0182182_1108127All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum526Open in IMG/M
3300015312|Ga0182168_1071434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum646Open in IMG/M
3300015313|Ga0182164_1039542All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum792Open in IMG/M
3300015313|Ga0182164_1063037All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum676Open in IMG/M
3300015316|Ga0182121_1061406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum710Open in IMG/M
3300015318|Ga0182181_1062356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300015318|Ga0182181_1092438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis545Open in IMG/M
3300015319|Ga0182130_1101724All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum564Open in IMG/M
3300015319|Ga0182130_1107400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum552Open in IMG/M
3300015324|Ga0182134_1127155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum535Open in IMG/M
3300015325|Ga0182148_1050539Not Available741Open in IMG/M
3300015326|Ga0182166_1054455All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor721Open in IMG/M
3300015327|Ga0182114_1114466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300015328|Ga0182153_1096466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum603Open in IMG/M
3300015328|Ga0182153_1128362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum539Open in IMG/M
3300015331|Ga0182131_1080113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum655Open in IMG/M
3300015331|Ga0182131_1113747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum572Open in IMG/M
3300015332|Ga0182117_1150367Not Available530Open in IMG/M
3300015333|Ga0182147_1012765Not Available1245Open in IMG/M
3300015333|Ga0182147_1104572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
3300015335|Ga0182116_1028155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1028Open in IMG/M
3300015335|Ga0182116_1176514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum504Open in IMG/M
3300015337|Ga0182151_1040585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum854Open in IMG/M
3300015337|Ga0182151_1165581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum503Open in IMG/M
3300015338|Ga0182137_1127494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum584Open in IMG/M
3300015340|Ga0182133_1001428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2383Open in IMG/M
3300015340|Ga0182133_1120690Not Available616Open in IMG/M
3300015340|Ga0182133_1130302All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum596Open in IMG/M
3300015349|Ga0182185_1275608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300015352|Ga0182169_1136390Not Available797Open in IMG/M
3300015352|Ga0182169_1272476Not Available548Open in IMG/M
3300015353|Ga0182179_1105993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum845Open in IMG/M
3300015353|Ga0182179_1254701All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300015354|Ga0182167_1111721Not Available1003Open in IMG/M
3300015354|Ga0182167_1225108All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum682Open in IMG/M
3300015354|Ga0182167_1336759All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300017412|Ga0182199_1063349All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum786Open in IMG/M
3300017414|Ga0182195_1032133Not Available1027Open in IMG/M
3300017414|Ga0182195_1067338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum799Open in IMG/M
3300017414|Ga0182195_1140756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum606Open in IMG/M
3300017414|Ga0182195_1144746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum599Open in IMG/M
3300017414|Ga0182195_1201558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300017421|Ga0182213_1210356All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300017421|Ga0182213_1215193All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum548Open in IMG/M
3300017421|Ga0182213_1230227All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300017421|Ga0182213_1235875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300017435|Ga0182194_1040795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis821Open in IMG/M
3300017435|Ga0182194_1155141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300017439|Ga0182200_1069342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum680Open in IMG/M
3300017439|Ga0182200_1071457All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum673Open in IMG/M
3300017440|Ga0182214_1045013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum879Open in IMG/M
3300017445|Ga0182198_1175404All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300017447|Ga0182215_1132767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Robertmurraya → Robertmurraya kyonggiensis568Open in IMG/M
3300017447|Ga0182215_1156903Not Available527Open in IMG/M
3300017693|Ga0182216_1188130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300017693|Ga0182216_1212511Not Available513Open in IMG/M
3300017694|Ga0182211_1074122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300028049|Ga0268322_1004141All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1094Open in IMG/M
3300028051|Ga0268344_1011235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum653Open in IMG/M
3300028062|Ga0268342_1045847Not Available500Open in IMG/M
3300028064|Ga0268340_1058346Not Available584Open in IMG/M
3300028141|Ga0268326_1006799Not Available626Open in IMG/M
3300028148|Ga0268354_1013887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum656Open in IMG/M
3300028152|Ga0268336_1002853Not Available991Open in IMG/M
3300028155|Ga0268349_1048598All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300028381|Ga0268264_12679025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300028467|Ga0268333_1010179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300028473|Ga0268319_1016572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum568Open in IMG/M
3300032465|Ga0214493_1068679Not Available843Open in IMG/M
3300032467|Ga0214488_1029957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1159Open in IMG/M
3300032591|Ga0214484_1040892Not Available973Open in IMG/M
3300032625|Ga0214501_1219023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300032625|Ga0214501_1270456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300032699|Ga0214494_1020357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1212Open in IMG/M
3300032934|Ga0314741_1039946Not Available1071Open in IMG/M
3300033526|Ga0314761_1000631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum3870Open in IMG/M
3300033532|Ga0314767_1201385Not Available501Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere66.94%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere8.06%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil7.26%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere7.26%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated7.26%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028051Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028062Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028141Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028148Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028152Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028155Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028467Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028473Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032934Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070670_10226366923300005331Switchgrass RhizosphereMVVPWVGYLWFGFLALVGGLGVGVTALVLAELEWWVDLVVFE
Ga0068859_10042886823300005617Switchgrass RhizosphereMVVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFALEGLAAAANCDCSCN*
Ga0068859_10283591913300005617Switchgrass RhizosphereVPRVGYLWFGFLVLVGGLGVVVAALVLAELGWWADWVVLEGLVAAASCGCS*
Ga0068859_10311448613300005617Switchgrass RhizosphereVPRVGHLWFGFLVLVGGLGVVVAALVLVELGWWVDWVVFAGLAAAASCGCSCS*
Ga0068863_10081646513300005841Switchgrass RhizosphereMVVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFAFEGLAAAAN
Ga0068863_10187413113300005841Switchgrass RhizosphereVMPRVGYLWFGFLVLVGELGVAVAAPEWVELGLWVEWFALEGLAAAANCDCSCS*
Ga0068858_10225337013300005842Switchgrass RhizosphereVPWVGYLWFGFLALVGELGVEVAAPEWVELGLWFEWVAFVGLAAAANCDCSCS*
Ga0068860_10277925613300005843Switchgrass RhizosphereVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFALEGLAAAANCDCSCN*
Ga0097620_10036347133300006931Switchgrass RhizosphereVPRVGYLRFGFLVLVGGLGVVVAALELVELGWWVEWFAFEGLAVAANFDCSCS*
Ga0105247_1162214313300009101Switchgrass RhizosphereVPRVGYLWFGFLVLVGELGVVVGAPEWVEHGLWVEWFALEGLPAAANCDCSCSLTWVGGMLV*
Ga0105136_10516113300009973Switchgrass AssociatedVPRVGYLWFGFLVLVGELGVVVAAPKWVELGLRVEWVAFEGLAAAANCDCSYS*
Ga0105135_10158313300009980Switchgrass AssociatedMVVLWVGYLWFGFLALVGELGVEVAAPEWVELGLWFEWVAFVGLAAAANCDCSCS*
Ga0105135_12290913300009980Switchgrass AssociatedMVVPRIGYLLFGFLVLVGELGVVVAAPEWVELGLWVEWFALEGLVAAANCDCGC
Ga0105133_11762613300009981Switchgrass AssociatedVPRVGYLWFGFLVLVGGLGVVVAALVLVELGWWVDWVVFDGLAAAAS
Ga0105131_11560513300009989Switchgrass AssociatedVPLAGYLWLGFLVLVGGLGVVVAALVLAELGWWVDWVVFDGLAAAASCGCS*
Ga0105132_10415613300009990Switchgrass AssociatedVPRVGHLWFGFLVLVVGLGVVVAALVLVELGWWVDWVVFAGLAAATSCGCSCS*
Ga0105139_100099823300009995Switchgrass AssociatedMVVPWVGYLWFGFLALVGELGVEVAAPEWVELGLWFEWVAFVGLAAAANCDCSCS*
Ga0105139_108253023300009995Switchgrass AssociatedVPRVGYLWFGFLVLVGGLEVVVAVVLVELGWWVDWVVFEGLAAAASCGYSCS*
Ga0105139_109350913300009995Switchgrass AssociatedVPRVGCLWFGFLVSVGWLGVVVVALGFVELGWWVDWVASEGLAAAASCGSCS*
Ga0134125_1262371723300010371Terrestrial SoilGFLVLVGELGVVVAAPEWVELGLWAEWFALEGLAAAVNCDCSCS*
Ga0134126_1279225123300010396Terrestrial SoilVLRVGHLWFGFLVLVGGLGVVVAALVLVELVWWVDWVVFEGLAAASSCGCSCN*
Ga0134124_1219085623300010397Terrestrial SoilMVVPWVGYLWFGFLALVGELGVEVAAPEWVELGLWFEWVAFVGLAAAANCDC
Ga0134127_1256812713300010399Terrestrial SoilRSVVLRVGYLWFGILVLVCGLGVVGAAFVLAELGWRVDWVVFGGLAATASYGCSCS*
Ga0134122_1017972843300010400Terrestrial SoilVGYLWFDFLVLVGELGVVVAAPEWGEAGLWVEWLAFEGLAAAANCDCSCS*
Ga0134122_1207919113300010400Terrestrial SoilMVVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFAFEGLAAAANCDYSCS*
Ga0134121_1196379213300010401Terrestrial SoilVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFAFEGLAATANCDCSCSLTWVGAMLV*
Ga0134123_1207126813300010403Terrestrial SoilVPRVGYLWFGFLVLVGGLGVVVAALVLVGLEWWVDWVVFAGLVAAASCSCS*
Ga0134123_1241290413300010403Terrestrial SoilRRMVMPRVGYLWFGFLVLVGELGVAVAAPEWVELGLWVGWFALEGLAAAASCDCSCS*
Ga0163163_1132342213300014325Switchgrass RhizosphereMVVPWVGYLRFGFLVLVGGLGVVVAALELVELGWWVEWFAFEGLAAAANCDC
Ga0157380_1188119923300014326Switchgrass RhizosphereMVVPRVGYLRFGFLVLVGGLGVVVAALELVELGCWVEWFAFEGLAATANCDC
Ga0182183_103092223300015270Switchgrass PhyllosphereYLWFGFLVLVGGLGVVVAALVLAELGWRVDWVVFGVLAATASCGCSCS*
Ga0182102_103181513300015273Switchgrass PhyllosphereVPRVGYLWFDFLVLAGGLEVVVAALVLAELGWWVDWVVFGGLAATASCGCSCS*
Ga0182102_103666613300015273Switchgrass PhyllosphereMVVPRVGYLWFGFLVLVGELGVAVAAPEWVELVLWAGCFAFEGLAAA
Ga0182099_102664113300015278Switchgrass PhyllosphereVPWVGYLWFGFLALVGELGVEVAVPEWVELGLWFEWVAFVGLAAAANCDCSCS*
Ga0182101_106204513300015284Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVEVVALVLAELEWWVDSVVFEGLAAAASWGCSCS*
Ga0182101_109825423300015284Switchgrass PhyllosphereMVVPRVGYSWFGFLVLVGELGVVVAALVLVDLGWWVDWVVFDGLAVAASCGCS*
Ga0182105_102406013300015290Switchgrass PhyllosphereVPRVGHLWFGFLVLVVGLGVVVAALVLVELGWWVDWAVFAGLAAAANCGCSCS*
Ga0182105_106287223300015290Switchgrass PhyllosphereMVVPRVAYLRFGFLVLVGGLGVVVAALELVELGWWVEWFAFEGLVAAANCDYSCS*
Ga0182105_106998813300015290Switchgrass PhyllosphereVLLVGYLWFGFLVLVGELGVAVAAPEWVELGLWVGWFALEGLAAAASCDCSCS*
Ga0182105_110678813300015290Switchgrass PhyllosphereGEPPEMWLGFLVLLGGLGVVVAALVFAELEWWVDWIAFEGLATAASCGCSCS*
Ga0182103_103377113300015293Switchgrass PhyllosphereMITPKVGSAAGCYLWFGFLVLVGGLGVGVTALAIAELEWWVDLVGFEGLAAAVSWGRSCS
Ga0182103_105277913300015293Switchgrass PhyllosphereRVGYLRFGFLVLVGGLGVVVAALELVELGWWVEWFAFEGLAAAANCDCSCS*
Ga0182103_108974523300015293Switchgrass PhyllosphereVLRVGYLWFGFLVLVGVLGVVVAALVLIELGWWVDWVVFEGLAAAASWGCSCS*
Ga0182104_109310313300015297Switchgrass PhyllosphereVSQVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFALEGLAA
Ga0182104_110645923300015297Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVVVAALVLVELGWWVDWVVFEGLAAAANCGYSCS*
Ga0182104_112007813300015297Switchgrass PhyllosphereVSWVGYLWFGFLVLVGGLGVWVTALAIAELEWWVDLVGFESLAAAASWGCSCSRMWAGGMFG*
Ga0182162_110542523300015310Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVVVAALVLAELGWRVDWVVFGGLAAAASCGCSCS*
Ga0182182_110812713300015311Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVVVAALVLVELGWWVDWVVFDGLAAAASCGCS*
Ga0182168_107143423300015312Switchgrass PhyllosphereMVVPRVGYLRFGFLVLVGGLGVVVAALELVELGWWVEWFAFEGLAAAANCDCSCS*
Ga0182164_103954213300015313Switchgrass PhyllosphereMGMIIPKVAVPRVGHLWFDFLVLVGGLGVVVAALVLVELGWWVDWVVFAGLAAAASCGCSCS*
Ga0182164_106303723300015313Switchgrass PhyllosphereVPRVGYLWFGFLVLVGELGVAVAALEWIELGLWVGWFALEGLAAAASCDCSCS*
Ga0182121_106140623300015316Switchgrass PhyllosphereVPWVGYLWFGFLVLVGGLGVWVTALAIAELEWWVDLVGFEGLAAAAS*
Ga0182181_106235613300015318Switchgrass PhyllosphereMPRVGYLWFGFLALVGGLGVGVTALVLAELEWWVDSVAFEGLAVTASWGCSCS*
Ga0182181_109243813300015318Switchgrass PhyllosphereVPRVGYLWFGFLVLVGDLGVVVAAPEWVELGLWVERFAFDGLAAAANCDCSCS*
Ga0182130_110172413300015319Switchgrass PhyllosphereMVVLLVGYLWFGFLVLVGELGVAVAAPEWVELGLWVGWFALEGLAAAASCDCSCS*
Ga0182130_110740023300015319Switchgrass PhyllosphereVPRDGELWIGFLVLVGGLGVVVTALVLAELGWRVDWVVFGGLAAAASCGCSCSLTWVGGMLG*
Ga0182134_112715523300015324Switchgrass PhyllosphereMPRVGYLWFGFLVSVGWLGVVVVALGFVELGWWVDWVASEGLATAASCGSCS*
Ga0182148_105053923300015325Switchgrass PhyllosphereVSRVGYLWFGFLVLVGGFGVVVAAIVLAELGWWVDWVVFGGLAATASCGCSCS*
Ga0182166_105445513300015326Switchgrass PhyllosphereMPRVGYLWFGFLVLVGELGVAVADPEWVELGLLVGWFALEGLAAAASCDCSCS*
Ga0182114_111446613300015327Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVVVAALVLVERGWWVEWVVFDGLAAAASCGCS*
Ga0182153_109646613300015328Switchgrass PhyllosphereMPRVGYLWFGFLALVGGLGVGVTALVLAELEWWVDSVVFEGLAAAASWGCSCS*
Ga0182153_112836213300015328Switchgrass PhyllosphereVPRAGCLWFGFLVSVGWLGVVVVGLGFVELGWWVDWVASEGLAAAASCGSCS*
Ga0182131_108011313300015331Switchgrass PhyllosphereVPRVGYLLFGFLVLVGGLGVVVAALELVELRWWVEWFAFEGLAAAANCDCSCS*
Ga0182131_111374723300015331Switchgrass PhyllosphereVPRVGHLWFVFFFVLVGGLGVVAAALVLVELGWWVDWVVFEGLAAAANCGYSCS*
Ga0182117_115036713300015332Switchgrass PhyllosphereVPRVGYLWFGFLVMVGGLGVVVAALVLVELGWWVDWVVFESLAAVASCDCSCS*
Ga0182147_101276523300015333Switchgrass PhyllosphereFGFLVLVGKLGVVVAAPGWVELGWWVEWFAFEGLAATADCDCSCS*
Ga0182147_110457223300015333Switchgrass PhyllosphereLIVPRVGYLWFGFLVLVGGLGVVVAALVLVELRWWVDWVVFVVKEAM*
Ga0182116_102815523300015335Switchgrass PhyllosphereVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFVFEGLAAASNCDCSCN*
Ga0182116_117651423300015335Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVVVAALVLAELGWWVDWVAFEGLAAAASCGCSCS*
Ga0182151_104058523300015337Switchgrass PhyllosphereVPRVGYLWFGFLALVGGLGVGITALVLAELEWWVDSVVFEGLAATASWGCSFSCM*
Ga0182151_116558113300015337Switchgrass PhyllosphereVPRVGYLWFDFLVLVGGSGVGVVALVLAEPGWCVAWVVFEGLAGAASWGCSCN*
Ga0182137_112749423300015338Switchgrass PhyllosphereVPRVGYLRFGFLVLVGGLGVVVAALELVELGWWVEWFAFVSLAVAANCDCSCS*
Ga0182133_100142833300015340Switchgrass PhyllosphereVSRVGYLWFGFFVLVGGLGVVVAAPEWVELGWWVEWFAFEGLAATADCDCSCS*
Ga0182133_112069023300015340Switchgrass PhyllosphereVPRVGYLRFGFLVLVGGLVVVVAALELVEIGWWVEWFVFKVLAAAANCDCSCS*
Ga0182133_113030223300015340Switchgrass PhyllosphereVPRVGCLWFGFLVSVGWLGVVVVALGFVELGWRVDWVASEGLAAAASCGSCS*
Ga0182185_127560823300015349Switchgrass PhyllosphereMPRVGYLWFGFLVVVGGLGVVVAALVLAELEWWVDWIAFEGLATTASCGCSCS*
Ga0182169_113639013300015352Switchgrass PhyllosphereWVGYLWFGFLALVGELGVEVAAPEWVELGLWFEWVAFVGLAAAANCDCSCS*
Ga0182169_127247613300015352Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVVVAALVLVELGWWVDWVVFEGLAAAASCGCSCN*
Ga0182179_110599313300015353Switchgrass PhyllosphereVPWVGYLWFGFLVLVGGLGVWVTALAIAELEWWVDLVGFESLAAAASWGCSCSRMWAGGMFG*
Ga0182179_125470113300015353Switchgrass PhyllosphereVPWVGYLWFGFLALVGELGVEVAAPEWVDLGLWFEWVAFVGLAAAANCDCSCS*
Ga0182167_111172133300015354Switchgrass PhyllosphereVPRVGYLWFGFLVWVGGLGVEVVALVLAELEWWVDSVVFEGLAVTASWGCSFSCM*
Ga0182167_122510813300015354Switchgrass PhyllosphereVPRVGCLCFGFLVLVGELGVVVAAPEWVELGLWFEWLAFEGLATAANCDCSYS*
Ga0182167_133675923300015354Switchgrass PhyllosphereVPRVGYLRFGFLVLVGGVGVVVASLKLVELGWWVEWFAFEGLAAAANCDCSCN*
Ga0182199_106334913300017412Switchgrass PhyllosphereVPRVGYLWFGFLVLVGELGVAVAAPEWVELVLWFGCFALEGLAAAASCDCSCS
Ga0182195_103213323300017414Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVEVVALVLAELEWWVDSVVFEGLAATASWGCSFSCM
Ga0182195_106733823300017414Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVVVAALVLAELGWCVDWVAFEGLAAAASCGCSCS
Ga0182195_114075613300017414Switchgrass PhyllosphereVPRAGCLWFGFLVSVGWLGVVVVGLGFVELGWWVDWVASEGLAAAASCGSCS
Ga0182195_114474613300017414Switchgrass PhyllosphereVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFAFEGLAAAANC
Ga0182195_120155813300017414Switchgrass PhyllosphereVLLVGYLWFGFLVLVGELGVAVAAPEWVELGLWVGWFALEGLAAAASCDCSCS
Ga0182213_121035613300017421Switchgrass PhyllosphereVPRVGHLWFGFLVLVGGLGVVVAALVLVELGWWVDWVVFAGLATAASCGCSCS
Ga0182213_121519323300017421Switchgrass PhyllosphereVPRVGYLWFGFLVLVGVLGVVVAALVLVELGWWVDWVVFEGLAAAASCGCSCS
Ga0182213_123022713300017421Switchgrass PhyllosphereVPRVGYLWFGFLVLVGELGVEVAALEWVELGLWVEWFAFVSLAAAANCDCSCS
Ga0182213_123587523300017421Switchgrass PhyllosphereVPWVGYLWFGFLVLVGGLGVVVAALVLAELGWWVDWVVFEGLAAATSCGCSCS
Ga0182194_104079523300017435Switchgrass PhyllosphereVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFAFEGLAAAANCDCSCS
Ga0182194_115514123300017435Switchgrass PhyllosphereVPRVGYLWFGFLVLVDGLGVVVAALVLVELGWWVDWVVFDGLAAAASCGCS
Ga0182200_106934213300017439Switchgrass PhyllosphereMPRVGYLWFGFLVLVGGLGVVVAALVLVELGWWVDWVVFAGLAAAASCGCSCS
Ga0182200_107145723300017439Switchgrass PhyllosphereVPRVGHLWFGFLVLVGGLGVVVAALVLAELGWWVDWVVFESLAAAASCGCSCS
Ga0182214_104501323300017440Switchgrass PhyllosphereVPRVGYLWFGFLVLVGELGVVVVAPDWIDLGLWVEWFAFEGLAAAANCDCSCS
Ga0182198_117540413300017445Switchgrass PhyllosphereVPQVGYLWFGFLVLEGGLGVGVTALAIAELEWWVDLVGFEGLAATASWGCSFSCM
Ga0182215_113276713300017447Switchgrass PhyllosphereMIIPKVGMPRVGYLWFGFLVSVGWLGVVVVALGFVELGWWVDWVASEGLAAAASCGSCS
Ga0182215_115690313300017447Switchgrass PhyllosphereMVVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFAFEGLAATANCDCSCS
Ga0182216_118813013300017693Switchgrass PhyllosphereVPRVGCLWFGFLVSVGWLGVVVVALGFVELGWRVDWVASEGLAAAASCGSCS
Ga0182216_121251113300017693Switchgrass PhyllosphereRRLVVPRVGYLWFGFLVLVGGLGVVVAALVLVELVWWVDWVVFEGLAAASSCGCSCN
Ga0182211_107412223300017694Switchgrass PhyllosphereVPRVGYLWFGFLVLVGELGVAVAAPEWVELVLWVGCFVLEGLAAAASCDCSCS
Ga0268322_100414133300028049PhyllosphereVPRVGHLWFGFLVLVGGLGVVVAALVLVELGWWVDWVVFAGLAAAASCGCSCS
Ga0268344_101123513300028051PhyllosphereVPRVGYLWFGFLVLVGGLGVVVAALVLVELGWWVDWVVFAGLAAAASCGCSCS
Ga0268342_104584713300028062PhyllosphereYLWFDFLVLVGELGVVVAAPEWVELGLWVEWFAFEGLAAAANCDCSCS
Ga0268340_105834613300028064PhyllosphereWVGYLRFGFLVLVGGLGVVVAVLELVELGWWVEWFAFVGLAVAANCDCSCS
Ga0268326_100679913300028141PhyllospherePRVGYLWFGFLVLEGGLGLVVAALVLVELGWWVDWVVFDGLAAAASCGCS
Ga0268354_101388723300028148PhyllosphereVPRVGYLWFGFLVLVGELGVAVAAPEWVELGLWVEWFALEGLAAA
Ga0268336_100285323300028152PhyllosphereMVVPRVGYLWFDFLVLVGELGVVVAAPEWVELGLWVEWFAFEGLAAAANCDCSC
Ga0268349_104859813300028155PhyllosphereVPRVGYLWFGFLVLVGGLGVEVVALVLAELEWWVDSVVFEGLAATAS
Ga0268264_1267902513300028381Switchgrass RhizosphereVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWFAFEGLAAAANFACSCS
Ga0268333_101017913300028467PhyllosphereVPRVGYLWFGFLVLVGELGVVVAAPEWVELGLWVEWLAFEGLAAAANCDCSCS
Ga0268319_101657213300028473PhyllosphereVPRVGYLRFGFLVLVGGLGVVVAALELVELGWWVEWFAFEGLAAAANCDCSCS
Ga0214493_106867923300032465Switchgrass PhyllosphereVVPRVGYFWVGVLVLVGGLGVLVAGLVLVERGWWVEWVVFDGLAAAASCDCSCN
Ga0214488_102995723300032467Switchgrass PhyllosphereVPRVGCLWFGFLVLVAELGVAVAAPEWVELGLWVGWFDLEGLATAASYDCSCS
Ga0214484_104089223300032591Switchgrass PhyllosphereGYLWFGFLVLVGELGVVVAVPEWVELGLWVECFAFEGLAAAAN
Ga0214501_121902313300032625Switchgrass PhyllosphereVPRVGYLWFGFLVLVGVLGVVVAALVLVVLGWWVDWVVFAGLAAAASCGCSCS
Ga0214501_127045613300032625Switchgrass PhyllosphereVPRVGYLCFGFLVLVGELGVVVAAPEWVELGLWFEWLAFEGLAVAANCDCSCS
Ga0214494_102035723300032699Switchgrass PhyllosphereVPWVGYLWFGFLALVGELGVEVAAPEWVELGLWFEWVAFVGLATAANCDCSCS
Ga0314741_103994623300032934Switchgrass PhyllosphereYLRFGFLVLVGGLGVVVAALELVELGWWVEWFAFEGLAAAANCDCSCS
Ga0314761_100063163300033526Switchgrass PhyllosphereVPRVGYLWFGFLVLVGGLGVLVAALVLAEFGWWVDWVAFEDLAAAASCGCGCS
Ga0314767_120138513300033532Switchgrass PhyllosphereLRVGCLWFDFLILVGGLGVVVTALAMVELEWWVDWVGFEGLAAAANCDCSCS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.