Basic Information | |
---|---|
Family ID | F068581 |
Family Type | Metagenome |
Number of Sequences | 124 |
Average Sequence Length | 43 residues |
Representative Sequence | MKLDLSIQEINIILASLGRMPYEAVFELVEKIRSQAKEQSEAK |
Number of Associated Samples | 61 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 75.81 % |
% of genes near scaffold ends (potentially truncated) | 15.32 % |
% of genes from short scaffolds (< 2000 bps) | 72.58 % |
Associated GOLD sequencing projects | 54 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (39.516 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (40.323 % of family members) |
Environment Ontology (ENVO) | Unclassified (85.484 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (87.097 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF13884 | Peptidase_S74 | 60.16 |
PF07728 | AAA_5 | 0.81 |
PF13385 | Laminin_G_3 | 0.81 |
PF09374 | PG_binding_3 | 0.81 |
PF13578 | Methyltransf_24 | 0.81 |
PF01075 | Glyco_transf_9 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.48 % |
Unclassified | root | N/A | 39.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003277|JGI25908J49247_10044623 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300003393|JGI25909J50240_1080617 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 652 | Open in IMG/M |
3300005940|Ga0073913_10009516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
3300006805|Ga0075464_10056108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium | 2186 | Open in IMG/M |
3300007734|Ga0104986_1451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15163 | Open in IMG/M |
3300007735|Ga0104988_10893 | Not Available | 36680 | Open in IMG/M |
3300009068|Ga0114973_10003173 | Not Available | 11695 | Open in IMG/M |
3300009068|Ga0114973_10016355 | Not Available | 4670 | Open in IMG/M |
3300009068|Ga0114973_10307560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
3300009152|Ga0114980_10001273 | All Organisms → cellular organisms → Bacteria | 18061 | Open in IMG/M |
3300009152|Ga0114980_10041568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2810 | Open in IMG/M |
3300009154|Ga0114963_10092594 | All Organisms → Viruses → Predicted Viral | 1855 | Open in IMG/M |
3300009155|Ga0114968_10012131 | Not Available | 6155 | Open in IMG/M |
3300009155|Ga0114968_10234733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
3300009159|Ga0114978_10675822 | Not Available | 591 | Open in IMG/M |
3300009159|Ga0114978_10694434 | Not Available | 581 | Open in IMG/M |
3300009160|Ga0114981_10482498 | Not Available | 664 | Open in IMG/M |
3300009183|Ga0114974_10405645 | Not Available | 779 | Open in IMG/M |
3300009184|Ga0114976_10603164 | Not Available | 557 | Open in IMG/M |
3300009684|Ga0114958_10059308 | All Organisms → Viruses | 2034 | Open in IMG/M |
3300009809|Ga0105089_1083117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300010157|Ga0114964_10503840 | Not Available | 569 | Open in IMG/M |
3300010354|Ga0129333_10192807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1855 | Open in IMG/M |
3300010354|Ga0129333_10635707 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 923 | Open in IMG/M |
3300010354|Ga0129333_10674431 | All Organisms → Viruses | 891 | Open in IMG/M |
3300010354|Ga0129333_11036863 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 688 | Open in IMG/M |
3300010370|Ga0129336_10200009 | Not Available | 1137 | Open in IMG/M |
3300010885|Ga0133913_12205002 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
3300010885|Ga0133913_13108934 | Not Available | 1102 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1083181 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1244 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10238699 | Not Available | 1113 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10622991 | Not Available | 674 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10209635 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10288122 | Not Available | 1064 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10364384 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10286686 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10586178 | Not Available | 613 | Open in IMG/M |
3300014819|Ga0119954_1012319 | Not Available | 1886 | Open in IMG/M |
3300014819|Ga0119954_1017218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1504 | Open in IMG/M |
3300017723|Ga0181362_1086488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300017736|Ga0181365_1023267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1561 | Open in IMG/M |
3300017736|Ga0181365_1045891 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
3300017736|Ga0181365_1064746 | Not Available | 905 | Open in IMG/M |
3300017761|Ga0181356_1070199 | Not Available | 1177 | Open in IMG/M |
3300017761|Ga0181356_1079996 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
3300017774|Ga0181358_1161251 | Not Available | 758 | Open in IMG/M |
3300017777|Ga0181357_1273856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300017778|Ga0181349_1070728 | All Organisms → Viruses → Predicted Viral | 1339 | Open in IMG/M |
3300017778|Ga0181349_1169730 | All Organisms → Viruses | 772 | Open in IMG/M |
3300017785|Ga0181355_1140609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 978 | Open in IMG/M |
3300017788|Ga0169931_10033507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → Marinomonas | 5990 | Open in IMG/M |
3300017788|Ga0169931_10179413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1844 | Open in IMG/M |
3300017788|Ga0169931_10493723 | Not Available | 866 | Open in IMG/M |
3300018790|Ga0187842_1000289 | Not Available | 26395 | Open in IMG/M |
3300019784|Ga0181359_1006914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 3825 | Open in IMG/M |
3300019784|Ga0181359_1042754 | Not Available | 1755 | Open in IMG/M |
3300019784|Ga0181359_1043392 | Not Available | 1741 | Open in IMG/M |
3300019784|Ga0181359_1063909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
3300019784|Ga0181359_1088590 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
3300019784|Ga0181359_1088836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1148 | Open in IMG/M |
3300019784|Ga0181359_1148158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300019784|Ga0181359_1165590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300019784|Ga0181359_1231350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300020183|Ga0194115_10120560 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1421 | Open in IMG/M |
3300020183|Ga0194115_10127683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1364 | Open in IMG/M |
3300020197|Ga0194128_10393374 | Not Available | 662 | Open in IMG/M |
3300021424|Ga0194117_10041968 | All Organisms → cellular organisms → Bacteria | 2722 | Open in IMG/M |
3300022752|Ga0214917_10005180 | All Organisms → cellular organisms → Bacteria | 14058 | Open in IMG/M |
3300022752|Ga0214917_10006484 | Not Available | 12120 | Open in IMG/M |
3300022752|Ga0214917_10014956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6774 | Open in IMG/M |
3300022752|Ga0214917_10018971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5737 | Open in IMG/M |
3300022752|Ga0214917_10028737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4242 | Open in IMG/M |
3300022752|Ga0214917_10070736 | Not Available | 2195 | Open in IMG/M |
3300022752|Ga0214917_10106360 | Not Available | 1615 | Open in IMG/M |
3300022752|Ga0214917_10152791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1217 | Open in IMG/M |
3300022752|Ga0214917_10171291 | All Organisms → Viruses | 1114 | Open in IMG/M |
3300022752|Ga0214917_10208939 | All Organisms → Viruses | 954 | Open in IMG/M |
3300022752|Ga0214917_10220380 | Not Available | 913 | Open in IMG/M |
3300022752|Ga0214917_10286436 | Not Available | 742 | Open in IMG/M |
3300023174|Ga0214921_10026185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5925 | Open in IMG/M |
3300023174|Ga0214921_10026185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5925 | Open in IMG/M |
3300023174|Ga0214921_10056188 | Not Available | 3388 | Open in IMG/M |
3300023174|Ga0214921_10142746 | Not Available | 1651 | Open in IMG/M |
3300023174|Ga0214921_10156496 | Not Available | 1530 | Open in IMG/M |
3300023174|Ga0214921_10274141 | All Organisms → Viruses | 965 | Open in IMG/M |
3300023179|Ga0214923_10016980 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 6788 | Open in IMG/M |
3300023179|Ga0214923_10020809 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 5862 | Open in IMG/M |
3300023179|Ga0214923_10027577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4827 | Open in IMG/M |
3300023179|Ga0214923_10044437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3475 | Open in IMG/M |
3300023179|Ga0214923_10059093 | Not Available | 2847 | Open in IMG/M |
3300023179|Ga0214923_10083441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2235 | Open in IMG/M |
3300023179|Ga0214923_10133704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1588 | Open in IMG/M |
3300023179|Ga0214923_10160547 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1387 | Open in IMG/M |
3300023179|Ga0214923_10180084 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
3300023179|Ga0214923_10312912 | All Organisms → Viruses | 847 | Open in IMG/M |
3300023179|Ga0214923_10331614 | Not Available | 811 | Open in IMG/M |
3300023179|Ga0214923_10380731 | Not Available | 731 | Open in IMG/M |
3300023179|Ga0214923_10385032 | Not Available | 725 | Open in IMG/M |
3300023179|Ga0214923_10399638 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 705 | Open in IMG/M |
3300023179|Ga0214923_10405969 | Not Available | 697 | Open in IMG/M |
3300023179|Ga0214923_10467378 | Not Available | 628 | Open in IMG/M |
3300023179|Ga0214923_10477387 | Not Available | 618 | Open in IMG/M |
3300023184|Ga0214919_10031280 | Not Available | 5543 | Open in IMG/M |
3300025896|Ga0208916_10073135 | Not Available | 1428 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1182363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1244531 | Not Available | 677 | Open in IMG/M |
3300027736|Ga0209190_1018827 | All Organisms → Viruses → Predicted Viral | 3910 | Open in IMG/M |
3300027741|Ga0209085_1076664 | All Organisms → Viruses → Predicted Viral | 1506 | Open in IMG/M |
3300027759|Ga0209296_1009798 | Not Available | 5801 | Open in IMG/M |
3300027760|Ga0209598_10142925 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300027763|Ga0209088_10175351 | Not Available | 931 | Open in IMG/M |
3300027798|Ga0209353_10075032 | Not Available | 1537 | Open in IMG/M |
3300027971|Ga0209401_1010264 | Not Available | 5228 | Open in IMG/M |
3300027971|Ga0209401_1274092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
3300027973|Ga0209298_10000058 | Not Available | 66080 | Open in IMG/M |
3300027973|Ga0209298_10030461 | All Organisms → cellular organisms → Bacteria | 2618 | Open in IMG/M |
(restricted) 3300028569|Ga0247843_1287044 | Not Available | 573 | Open in IMG/M |
3300031539|Ga0307380_10564142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia cepacia | 987 | Open in IMG/M |
3300031565|Ga0307379_11100973 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300031578|Ga0307376_10217956 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
3300031578|Ga0307376_10515797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia cepacia | 771 | Open in IMG/M |
3300031673|Ga0307377_10499222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia cepacia complex → Burkholderia cepacia | 886 | Open in IMG/M |
3300031707|Ga0315291_10756493 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300033979|Ga0334978_0077242 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 40.32% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 20.97% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 18.55% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.03% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.03% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 4.03% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.23% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.61% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.61% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.81% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25908J49247_100446231 | 3300003277 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELVDKIRSQAKEQSEAK* |
JGI25909J50240_10806172 | 3300003393 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELVEKIRGQAKEQSEAK* |
Ga0073913_100095163 | 3300005940 | Sand | MKLDLNISEINTILACLSRAPYEAVFELVEKIRSQAKEQSEAK* |
Ga0075464_100561083 | 3300006805 | Aqueous | MKLDFSIQEINLILASLGRMPYEAVFALIEKIQAQAKDQSESK* |
Ga0104986_14519 | 3300007734 | Freshwater | MKLDLSVNEINTILACLGRAPYEAVFELVEKIRSQAKEQSEAK* |
Ga0104988_1089320 | 3300007735 | Freshwater | MKLDLNINEINTILACLGRAPYEAVFELVEKIRSQAKEQSEAK* |
Ga0114973_1000317310 | 3300009068 | Freshwater Lake | MKLDLSIQEINIILASLGRMPYEAVFGVIEKIQEQAKEESGAKQ* |
Ga0114973_100163552 | 3300009068 | Freshwater Lake | MKLDLSIQEVNTILACLGRAPYEAVFELVEKIRNQAKEQTEAK* |
Ga0114973_103075602 | 3300009068 | Freshwater Lake | MKLNLSINEVNAILACLGRAPYEAVFELVEKIRSQAKEQSEAK* |
Ga0114980_100012737 | 3300009152 | Freshwater Lake | MKLDLSIQEVNTILACLGRAPYEAVFELVDKIRSQAKEQSEAK* |
Ga0114980_100415684 | 3300009152 | Freshwater Lake | MKLDLSIQEINTILASLGRMPYEAVFGVIEKIQEQAKEESGTKQ* |
Ga0114963_100925942 | 3300009154 | Freshwater Lake | MKLDLSINEVNTILACLGRAPYEAVFELVEKIRNQAKQQSEAK* |
Ga0114968_100121312 | 3300009155 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELIEKIRNQAKEQSEAK* |
Ga0114968_102347332 | 3300009155 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELVEKIRSQAKEQSEAK* |
Ga0114978_106758222 | 3300009159 | Freshwater Lake | MKLDLSINEINTILACLGRAPYEAVFELVEKIRSQAKEQSEAK* |
Ga0114978_106944341 | 3300009159 | Freshwater Lake | PRTLSQSNRTGGRMKLDLSIQEINIILASLGRMPYEAVFELVEKIRNQAKEQSEAK* |
Ga0114981_104824982 | 3300009160 | Freshwater Lake | MKLDLSIQEINIILACLGRAPYEAVFDLVEKIRSQAKEQSEAK* |
Ga0114974_104056452 | 3300009183 | Freshwater Lake | MKLDLSIQEANIILASLGRMPYEAVFELVEKIRNQAKEQSEAK* |
Ga0114976_106031642 | 3300009184 | Freshwater Lake | MKLDLSIQEINIILASLGRMPYEAVFELVEKIRNQAKEQSEAK* |
Ga0114958_100593083 | 3300009684 | Freshwater Lake | MKLDLSIQEINIILASLGRMPYEAVFELVEKIRSQAKEQSEAK* |
Ga0105089_10831172 | 3300009809 | Groundwater Sand | MKLDLSIQEVNTILACLGRAPYEAVFELVEKIRSQAKEQSEAK* |
Ga0114964_105038401 | 3300010157 | Freshwater Lake | TGGRMKLDLSIQEINIILASLGRMPYEAVFELVKKIRSQAKEQSEAK* |
Ga0129333_101928073 | 3300010354 | Freshwater To Marine Saline Gradient | MKLDLSIQEINLILASLGRMPYEAVFGLIEKIQAQAKEQSEAK* |
Ga0129333_106357072 | 3300010354 | Freshwater To Marine Saline Gradient | LKLDLSIQEINLILASLGRMPYEAVFALVEKIQAQAKEQSEAK* |
Ga0129333_106744312 | 3300010354 | Freshwater To Marine Saline Gradient | VKLDLSIQEINLILASLGRMPYEAVFGLIEKIQAQAKEQSEAK* |
Ga0129333_110368632 | 3300010354 | Freshwater To Marine Saline Gradient | LKLDLSIQEINLILASLGKLPYEVVFGLIEKIQAQAKEQSEAK* |
Ga0129336_102000092 | 3300010370 | Freshwater To Marine Saline Gradient | LKLDLSIQEINLILASLGRMPYEAVFALIEKIQAQAKEQSEAK* |
Ga0133913_122050022 | 3300010885 | Freshwater Lake | MKIELSLAEANTILACLGRAPYEAVFELVEKIRSQAKEQSEAK* |
Ga0133913_131089342 | 3300010885 | Freshwater Lake | MKLDLSIQEVNIILACLGRAPYEAVFELIEKIRSQAKEQSEAK* |
(restricted) Ga0172374_10831812 | 3300013122 | Freshwater | MKLDLSIAEINLILGSLGRMPYEAVFGLVEKIQAQAKEQAEGK* |
(restricted) Ga0172367_102386993 | 3300013126 | Freshwater | MKLDLSIAEINLILGSLGRMPYEAVFALVEKIQAQAKEQAEGK* |
(restricted) Ga0172364_106229913 | 3300013129 | Sediment | MKLDLSIAEINLILGSLGRMPYEAVFALVEKIQAQAKEQAEGRTP* |
(restricted) Ga0172373_102096353 | 3300013131 | Freshwater | MKLDLSIAEINLILGSLGRMPYEAVFGLVEKIQTQAKEQVEEK* |
(restricted) Ga0172373_102881222 | 3300013131 | Freshwater | MKLDLTIADINLILGSLGRMPYEAVFGLVEKIQTQAKEQVDKKED* |
(restricted) Ga0172373_103643842 | 3300013131 | Freshwater | MKLDLTIAEINLILGSLGRMPYEAVFGLVEKIQAQAKEQAEGK* |
(restricted) Ga0172372_102866863 | 3300013132 | Freshwater | MKLDLFIAEINLILGSLGRMPYEAVFGLVEKIQAQAKEQAEGK* |
(restricted) Ga0172376_105861782 | 3300014720 | Freshwater | MKLDLTIAEINLILGSLGRMPYEAVFGLVEKIQAQAKDQAEGK* |
Ga0119954_10123193 | 3300014819 | Freshwater | LKLDLSIQEINLILASLGRMPYEAVFGLVEKIQAQAKEQSEAK* |
Ga0119954_10172182 | 3300014819 | Freshwater | LKLDLSIQEINLILASLGRMPYEAVFELVEKIRNQAKEQSESK* |
Ga0181362_10864882 | 3300017723 | Freshwater Lake | MKLDLSIQEVNTILACLGRAPYEAVFELVEKIRGQAKEQSEAK |
Ga0181365_10232671 | 3300017736 | Freshwater Lake | MKFDLSIQEVNTILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
Ga0181365_10458912 | 3300017736 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELIEKIRSQAIF |
Ga0181365_10647462 | 3300017736 | Freshwater Lake | MKLNLSINEINTILACLGRAPYEAVFDLVEKIRSQAKEQSEDK |
Ga0181356_10701992 | 3300017761 | Freshwater Lake | MKLDLSINEINTILACLGRAPYEAVFDLVEKIRSQAKEQSEDK |
Ga0181356_10799962 | 3300017761 | Freshwater Lake | MKLDLSIQEVNTILACLGRAPYEAVFGLVEKISNQAKEQSEAK |
Ga0181358_11612511 | 3300017774 | Freshwater Lake | MKLDLNINEVNAILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
Ga0181357_12738562 | 3300017777 | Freshwater Lake | MKLDLSINEVNAILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
Ga0181349_10707282 | 3300017778 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFDLVEKIRSQAKEQFEDK |
Ga0181349_11697302 | 3300017778 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELVDKIRSQANPLPRSEEH |
Ga0181355_11406092 | 3300017785 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELVEKIRGQAKEQSE |
Ga0169931_100335072 | 3300017788 | Freshwater | VKLDLTIADINLILGSLGRMPYEAVFGLVEKIQTQAKEQVEEK |
Ga0169931_101794132 | 3300017788 | Freshwater | MKLDLSISEINLILGSLGRMPYEAVFALVEKIQAQAKEQAEGK |
Ga0169931_104937232 | 3300017788 | Freshwater | VKFEFSIQEINLILGSLGRMPYEAVFALVEKIQAQAKEQAEGK |
Ga0187842_100028910 | 3300018790 | Freshwater | MKLDLSVSEINTILASLGRMPYEAVFVVIEKIQEQAKEESGTKQ |
Ga0181359_10069148 | 3300019784 | Freshwater Lake | MKLDLSVNEINTILACLGRAPYEAVFGLVEKISNQAKEQSEAK |
Ga0181359_10427542 | 3300019784 | Freshwater Lake | MKLDLSIQEVNTILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
Ga0181359_10433922 | 3300019784 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFDLVEKIRSQAKEQSEDK |
Ga0181359_10639092 | 3300019784 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELVEKIRGQAKEQSEAK |
Ga0181359_10885901 | 3300019784 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
Ga0181359_10888362 | 3300019784 | Freshwater Lake | MKLDLSIQEVNTILACLGRAPYEAVFELVEKIRSQA |
Ga0181359_11481581 | 3300019784 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFKLVEKIRSQAK |
Ga0181359_11655902 | 3300019784 | Freshwater Lake | MKLDLSIQEINAILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
Ga0181359_12313501 | 3300019784 | Freshwater Lake | MKLDLFIQEVNTILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
Ga0194115_101205602 | 3300020183 | Freshwater Lake | MKLDLTIAEINLLLGSLGRMPYEAVFGLVEKIQAQAKDQAEGK |
Ga0194115_101276831 | 3300020183 | Freshwater Lake | MKLDLTIAEINLILGSLGRMPYEAVFGLVEKIQAQAKEQAEGK |
Ga0194128_103933742 | 3300020197 | Freshwater Lake | LVAAASRPLEMKFDLSISEINLILGSLGRMPYEAVFALIEKIQAQAKEQAEGK |
Ga0194117_100419683 | 3300021424 | Freshwater Lake | MKFDLSISEINLILGSLGRMPYEAVFALIEKIQAQAKEQAEGK |
Ga0214917_100051808 | 3300022752 | Freshwater | LKLDISIQENNLILASLGRMPYESVFGVIEKIQAQAKEQSEAK |
Ga0214917_1000648411 | 3300022752 | Freshwater | MKLDLSIQEINIILASLGRMPYEAVFSVIEKIQTQAKEQPEAK |
Ga0214917_100149566 | 3300022752 | Freshwater | LKLELSVQEINLILASLGRMPYESVFGVIEKIQAQAKEQSEAK |
Ga0214917_100189716 | 3300022752 | Freshwater | MKLDLSIQEINIILASLGRMPYEAVFELVEEIRNQAKEQSESK |
Ga0214917_100287374 | 3300022752 | Freshwater | MKLDLSIQEVNTILACLGRAPYEAVFELVEKIRNQAKEQSESK |
Ga0214917_100707361 | 3300022752 | Freshwater | QEINIILASLGRMPYEAVFELVEKIRSQAKEQSEAK |
Ga0214917_101063601 | 3300022752 | Freshwater | QEINIILASLGRMPYEAVFELVEEIRNQAKEQSESK |
Ga0214917_101527913 | 3300022752 | Freshwater | MKLDLSIQEVNIILASLGRMPYEAVFELVEKIRNQAKEQSEAK |
Ga0214917_101712912 | 3300022752 | Freshwater | MKLDLSIQEINIILASLGRMPYEAVFELVEKIRNQAKEQSEAK |
Ga0214917_102089392 | 3300022752 | Freshwater | LKLDLSIQEINLILASLGRMPYESVFVLVEKIRNQAKEQSESK |
Ga0214917_102203802 | 3300022752 | Freshwater | MKLDLSIQEINIILASLGRMPYEAVFELVEKIRSQAKEQSEAK |
Ga0214917_102864362 | 3300022752 | Freshwater | MKLDLSIQEINIILASLGRMPYEAVFEIIENIRNQAKEQSESK |
Ga0214921_100261852 | 3300023174 | Freshwater | MKFDLSVNEINTIMASLGKMPYESVFAVIEKIREQATSQVEQEKENK |
Ga0214921_100261854 | 3300023174 | Freshwater | MKLDLSIQEVNIILASLGRMPYEAVFELVEKIRNQAKEQVQSKE |
Ga0214921_100561883 | 3300023174 | Freshwater | MKLDLSIQEVNAILACLGRAPYEAVFELVEKIRRQAKEQSEAK |
Ga0214921_101427462 | 3300023174 | Freshwater | MKLDLSIQEINIILASLGRMPYEAVFELVEKIRNQAKEQVQSKE |
Ga0214921_101564961 | 3300023174 | Freshwater | KLDLSIQEINIILASLGRMPYEAVFELVEKIRSQAKEQSEAK |
Ga0214921_102741412 | 3300023174 | Freshwater | MKLDLSIQEVNTILACLGRAPYEAVFELVEKIRNQAKEQSEAK |
Ga0214923_100169805 | 3300023179 | Freshwater | MKLDLSIQEINLILASLGRMPYEAVFGLVEKIQAQAKEQSEAK |
Ga0214923_100208097 | 3300023179 | Freshwater | RLGGRLKLDLSIQEINLILASLGRMPYESVFGLVEKIQAQAKEQSEAK |
Ga0214923_1002757710 | 3300023179 | Freshwater | LKLELSVQEINLILASLGRMPYEAVFGLVEKIQAQAKEQSEAK |
Ga0214923_100444373 | 3300023179 | Freshwater | MKLDLSIQEINIILASLGRMPYEAVFELVEKIRSQAKEQSESK |
Ga0214923_100590932 | 3300023179 | Freshwater | LKLDLSIQEINLILASLGRMPYEAVFALIEKIQTQAKEQSEAK |
Ga0214923_100834413 | 3300023179 | Freshwater | LKLDLSIQEINLILASLGRMPYEAVFELVEKIRNQAKEQSESK |
Ga0214923_101337042 | 3300023179 | Freshwater | MKLDLSIQEINLILASLGRMPYESVFALVEKIQAQAKDQPEAK |
Ga0214923_101605472 | 3300023179 | Freshwater | MKLDLSIQEINLILASLGRMPYESVFGVIEKIQAQAKEQSEAK |
Ga0214923_101800841 | 3300023179 | Freshwater | LKFDLSIQEINLILASLGRMPYEAVFGLIEKIQAQAKEQSEAK |
Ga0214923_103129122 | 3300023179 | Freshwater | LKLDLSIQEINLILASLGRMPYESVFGVIEKIQAQAKEQSEAK |
Ga0214923_103316142 | 3300023179 | Freshwater | MKFEFLAQEINLILASLGRMPYEAVFGLVEKIQAQAKEQSEAK |
Ga0214923_103807312 | 3300023179 | Freshwater | LKLDLSIQEINLILASLGRMPYESVFGVIEKIQAQAKGQSEAK |
Ga0214923_103850322 | 3300023179 | Freshwater | LRLDLSIQEINLILASLGRMPYEAVFGLVEKIQAQAKEQSEAK |
Ga0214923_103996381 | 3300023179 | Freshwater | LKLDLSIQEINLILASLGRMPYESVFGLVEKIQAQAK |
Ga0214923_104059691 | 3300023179 | Freshwater | MKLDLSIQEINIILASLGRMPYEAVFELVEKIRNQAKEQSETK |
Ga0214923_104673782 | 3300023179 | Freshwater | IQEINIILASLGRMPYESVFGLVEKIQAQAKEQSEAK |
Ga0214923_104773872 | 3300023179 | Freshwater | LKLDLSIQEINLILASLGRMPYESVFGLVEKIQAQAKEQSEAK |
Ga0214919_100312802 | 3300023184 | Freshwater | MKLDLSIQEVNTIMASLGRVPYESVFAVIEKIREQATSQVEQEKENK |
Ga0208916_100731352 | 3300025896 | Aqueous | MKLDFSIQEINLILASLGRMPYEAVFALIEKIQAQAKDQSESK |
(restricted) Ga0247836_11823632 | 3300027728 | Freshwater | MKLELNISEINTILACLGRAPYEAVFELVEKIRGQAKEQSEAK |
(restricted) Ga0247836_12445312 | 3300027728 | Freshwater | MKLDLNINEINTILACLGRAPYEAVFELVEKIRGQAKEQSEAK |
Ga0209190_10188273 | 3300027736 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELIEKIRNQAKEQSEAK |
Ga0209085_10766643 | 3300027741 | Freshwater Lake | MKLDLSINEVNTILACLGRAPYEAVFELVEKIRNQAKQQSEAK |
Ga0209296_10097987 | 3300027759 | Freshwater Lake | MKLDLSIQEANIILASLGRMPYEAVFELVEKIRNQAKEQSEAK |
Ga0209598_101429252 | 3300027760 | Freshwater Lake | MKLDLSIQEINIILASLGRMPYEAVFGVIEKIQEQAKEESGAKQ |
Ga0209088_101753512 | 3300027763 | Freshwater Lake | MKLDLSINEINTILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
Ga0209353_100750322 | 3300027798 | Freshwater Lake | MKLDLSIQEVNAILACLGRAPYEAVFELVDKIRSQAKEQSEAK |
Ga0209401_10102645 | 3300027971 | Freshwater Lake | MKLDLSIQEVNTILACLGRAPYEAVFELVEKIRNQAKEQTEAK |
Ga0209401_12740922 | 3300027971 | Freshwater Lake | MKLNLSINEVNAILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
Ga0209298_100000588 | 3300027973 | Freshwater Lake | MKLDLSIQEVNTILACLGRAPYEAVFELVDKIRSQAKEQSEAK |
Ga0209298_100304612 | 3300027973 | Freshwater Lake | MKLDLSIQEINTILASLGRMPYEAVFGVIEKIQEQAKEESGTKQ |
(restricted) Ga0247843_12870441 | 3300028569 | Freshwater | MKLDLNINEINTILACLGRAPYEAVFELVEKIRGQAKE |
Ga0307380_105641422 | 3300031539 | Soil | MKLDLSIQEVNTILACLGRAPYEAVFELIEKIRSQAKEQSEAK |
Ga0307379_111009732 | 3300031565 | Soil | MKLDLNINEVNTILACLGRAPYEAVFELIEKIRSQAKEQSEAK |
Ga0307376_102179562 | 3300031578 | Soil | MKLDLSIQEVNAILACLGRAPYEAVFELIEKIRSQAKEQSEAK |
Ga0307376_105157972 | 3300031578 | Soil | MKLDLSIQEVNTILVCLGRAPYEAVFELIEKIRSQ |
Ga0307377_104992221 | 3300031673 | Soil | MKLDLNINEVNAILACLGRAPYEAVFELIEKIRSQAKEQSE |
Ga0315291_107564932 | 3300031707 | Sediment | MKLELSIQEINAILACLGRAPYEAVFELVEKIRGQAKEQSEAK |
Ga0334978_0077242_775_906 | 3300033979 | Freshwater | MKLDLNISEINTILACLGRAPYEAVFELVEKIRSQAKEQSEAK |
⦗Top⦘ |