Basic Information | |
---|---|
Family ID | F068753 |
Family Type | Metagenome |
Number of Sequences | 124 |
Average Sequence Length | 45 residues |
Representative Sequence | VWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.47 % |
% of genes near scaffold ends (potentially truncated) | 51.61 % |
% of genes from short scaffolds (< 2000 bps) | 48.39 % |
Associated GOLD sequencing projects | 84 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (89.516 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (16.129 % of family members) |
Environment Ontology (ENVO) | Unclassified (45.161 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.11% β-sheet: 33.33% Coil/Unstructured: 35.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF14550 | Peptidase_S78_2 | 1.61 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 89.52 % |
All Organisms | root | All Organisms | 10.48 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 16.13% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.32% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 12.90% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 5.65% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.65% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.84% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.03% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.03% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.42% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.42% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.42% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.61% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.61% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.61% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.61% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.61% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.81% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.81% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.81% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.81% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.81% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300002385 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300006005 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007094 | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027259 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027366 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 (SPAdes) | Environmental | Open in IMG/M |
3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12547J11936_10028185 | 3300000736 | Freshwater And Sediment | GQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
B570J14230_100223751 | 3300001282 | Freshwater | LVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
B570J29615_1082082 | 3300002385 | Freshwater | DGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
B570J29032_1097646421 | 3300002408 | Freshwater | VRSGQVWLELDGQLVEAVVNANQYQFVTRRNDRLTQLQLEVAVAYDNSIL* |
B570J29032_1098214771 | 3300002408 | Freshwater | VRSGQVWLELDGQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNSIL* |
B570J40625_1001645262 | 3300002835 | Freshwater | SGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAIAYKNNIL* |
Ga0068876_104198332 | 3300005527 | Freshwater Lake | LVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL* |
Ga0049081_101878492 | 3300005581 | Freshwater Lentic | LVEAVVNANQYQFVTRRNDRLTQLQLEVAVAYDNSIL* |
Ga0049081_102122901 | 3300005581 | Freshwater Lentic | LELDGQLVEAVVNANQYQFVTRRNDQLQQLQLEVAIAYKNNIL* |
Ga0073910_10134251 | 3300006005 | Sand | IEMVRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0075470_101298081 | 3300006030 | Aqueous | ELVRSGQVWLELDGQLVEAVVNANSYQFVTRRNDQLQQLQVEIAVAYKNNIL* |
Ga0075471_100564532 | 3300006641 | Aqueous | LVEAVVNANQYQFVTRRNDQLQQLQLEVAVAYKNNIL* |
Ga0075471_103801411 | 3300006641 | Aqueous | LDGQLVEAVVNANSYQFVTRRNDQLQQLQVEIAVAYKNNIL* |
Ga0070749_100696713 | 3300006802 | Aqueous | DGQLVEAVVNANQYQFVTRRNDQLQQLQLEVAVAYKNNIL* |
Ga0075459_10280452 | 3300006863 | Aqueous | GQVWLELDGQLVEAVVNANQYQFVTRRNDQLQQLQLEVAVAYKNNIL* |
Ga0075473_103072591 | 3300006875 | Aqueous | VWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0075473_104071422 | 3300006875 | Aqueous | ELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0075473_104446222 | 3300006875 | Aqueous | LVEAVVNANSYQFVTRRNDQLQQLQIEIAVAYKNNIL* |
Ga0075472_103335611 | 3300006917 | Aqueous | IELVRSGQVWLELDGQLVEAVVNANSYQFVTRRNDQLQQLQVEIAVAYKNNIL* |
Ga0102532_11839821 | 3300007094 | Freshwater Lake | LDGQLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL* |
Ga0070753_13260361 | 3300007346 | Aqueous | GQLMEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0075458_100377702 | 3300007363 | Aqueous | RSGQVWLELDGQLVEAVVNANQYQFVTRRNDQLQQLQIEIAVAYKNNIL* |
Ga0075458_100781542 | 3300007363 | Aqueous | QVWLELDGQLVEAVVNANQYQFVTRRNDQLQQLQLEVAVAYKNNIL* |
Ga0102875_11124871 | 3300007547 | Estuarine | ELGGQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNNIL* |
Ga0105746_13152541 | 3300007973 | Estuary Water | VWLELDGQLVEAIVHANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0114346_11939972 | 3300008113 | Freshwater, Plankton | GYVWLELGGQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNSIL* |
Ga0114351_13108961 | 3300008117 | Freshwater, Plankton | EMVRSGQVWLELDGQLVEAIVNVNTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0114363_10786042 | 3300008266 | Freshwater, Plankton | QVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0114363_10903782 | 3300008266 | Freshwater, Plankton | SGYVWLELGGTLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNNIL* |
Ga0114363_11044801 | 3300008266 | Freshwater, Plankton | LELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0114363_11081961 | 3300008266 | Freshwater, Plankton | MVRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0114363_11890882 | 3300008266 | Freshwater, Plankton | EMVRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0114880_10998272 | 3300008450 | Freshwater Lake | RSGYVWLELGGTLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNNIL* |
Ga0114973_107052292 | 3300009068 | Freshwater Lake | WLIEMVRSGQVWLELDGQLVEAMVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0105090_104655412 | 3300009075 | Freshwater Sediment | SGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0105091_107443171 | 3300009146 | Freshwater Sediment | VRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQIEVSLAYKNNIL* |
Ga0105104_101356311 | 3300009168 | Freshwater Sediment | QVWLELDGQLVEAIVNANTYQLTTRRNDRLTQLQIEVSLAYKNNIL* |
Ga0114974_102149042 | 3300009183 | Freshwater Lake | WLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0114974_104780502 | 3300009183 | Freshwater Lake | EAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
Ga0129333_116301242 | 3300010354 | Freshwater To Marine Saline Gradient | SEWLIELVRSGQVWLEIDSQLVEAVVNANQYQFVTRRNDQLQQLQIEIAVAYKNNIL* |
Ga0129336_100557922 | 3300010370 | Freshwater To Marine Saline Gradient | VEAVVNANQYQFVTRRNDRLTQLQLEVAVAYDNSIL* |
Ga0153800_10056772 | 3300011995 | Freshwater | VRSGQVWLELDGQLVEAVVNANSYQFVTRRNDQLQQLQIEIAVAYKNNIL* |
Ga0153799_10952182 | 3300012012 | Freshwater | WLELDGQLVEAVVNANSYQFVTRRNDQLQQLQIEIAVAYKNNIL* |
Ga0153801_10643001 | 3300012017 | Freshwater | EWLIELVRSGQVWLELDGQLVEAVVNANQYQFVTRRNDQLQQLQLEVAIAYKNNIL* |
Ga0157498_10421832 | 3300012666 | Freshwater, Surface Ice | SGYVWLELGGTLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL* |
Ga0164292_103308891 | 3300013005 | Freshwater | RSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL* |
(restricted) Ga0172374_11771161 | 3300013122 | Freshwater | SQVWLELDGDLVEAVVNANQYQFVTRRNDQLQQLQIEIALAYKNNIL* |
(restricted) Ga0172367_105824991 | 3300013126 | Freshwater | WLELDGDLVEAVVNANQYQFVTRRNDQLQQLQIEIALAYKNNIL* |
(restricted) Ga0172364_108126141 | 3300013129 | Sediment | ELDGTLVEAVVNANQYQFVTRRNDQLQQLQIEIAVAYKNNIL* |
(restricted) Ga0172363_110408982 | 3300013130 | Sediment | GQLEPLEAVVNANQYQFVTRRNDQLQQLQIEIALAYKNNIL* |
(restricted) Ga0172372_109415901 | 3300013132 | Freshwater | SQVWLELDGQLEPLEAVVNANQYQFVTRRNDQLQQLQIEIALAYKNNIL* |
(restricted) Ga0172372_109540061 | 3300013132 | Freshwater | QVWLELDGQLEPLEAVVNANQYQFVTRRNDQLQQLQIEIAVAYKNNIL* |
Ga0177922_101463972 | 3300013372 | Freshwater | IEMVRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAIAYKNNIL* |
Ga0177922_111577152 | 3300013372 | Freshwater | VEAVVNANSYQFVTRRNDQLQQLQIEIAVAYKNNIL* |
Ga0177922_112069141 | 3300013372 | Freshwater | GQVWLELDGQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNSIL* |
(restricted) Ga0172376_108007452 | 3300014720 | Freshwater | EAVVNANQYQFVTRRNDQLQQLQIEIALAYKNNIL* |
Ga0181350_11464661 | 3300017716 | Freshwater Lake | KGMNAWLIEMIRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0181349_10361112 | 3300017778 | Freshwater Lake | GQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAIAYKNNIL |
Ga0181348_12173241 | 3300017784 | Freshwater Lake | MVRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVA |
Ga0181355_11946462 | 3300017785 | Freshwater Lake | QLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL |
Ga0181563_105835512 | 3300018420 | Salt Marsh | ELDGQLVEAVVNANSYQFVTRRNDQLQQLQLEVAVAYKNNIL |
Ga0181359_11219962 | 3300019784 | Freshwater Lake | WLIEMVRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0194115_104367932 | 3300020183 | Freshwater Lake | LIELLRSSQVWLEIDGDLVEAVVNTNTYQFVTRRNDQLQQLQLEVAVAYKNNIL |
Ga0194121_105618921 | 3300020200 | Freshwater Lake | IELLRSSQVWLEIDGDLVEAVVNTNTYQFVTRRNDQLQQLQLEIAVAYKNNIL |
Ga0194132_105638712 | 3300020214 | Freshwater Lake | LVEAVVNTNTYQFVTRRNDQLQQLQLEIAVAYKNNIL |
Ga0208232_10054932 | 3300020527 | Freshwater | SAWLIEMIRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0208235_10070262 | 3300020530 | Freshwater | DGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0207941_10174112 | 3300020539 | Freshwater | RSGYVWLELNGQLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL |
Ga0208360_10437131 | 3300020551 | Freshwater | ELGGQLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL |
Ga0222713_106020061 | 3300021962 | Estuarine Water | ESEWLIELVRSGQVWLELDGQLVEAVVNANSYQFVTRRNDQLQQLQLEVAIAYKNNIL |
Ga0222713_106197282 | 3300021962 | Estuarine Water | YGQLVEAVVNANQYQFVTRRNDQLQQLQIEIAVAYKNNIL |
Ga0222712_101545622 | 3300021963 | Estuarine Water | QLVEAVVNANQYQFVTRRNDQLQQLQLEVAIAYKNNIL |
Ga0228703_10176422 | 3300022747 | Freshwater | IELVRSGQVWLELDGQLVEAVVNANSYQFVTRRNDQLQQLQLEVAIAYKNNIL |
Ga0208424_10026911 | 3300025445 | Aqueous | SGQVWLELDGQLVEAVVNANQYQFVTRRNDQLQQLQLEVAVAYKNNIL |
Ga0208424_10256931 | 3300025445 | Aqueous | LEIDGQLVEAVVNANQYQFVTRRNDQLQQLQIEIAVAYKNNIL |
Ga0208546_10478831 | 3300025585 | Aqueous | DGQLVEAVVNANQYQFVTRRNDQLQQLQLEVAVAYKNNIL |
Ga0208546_10822982 | 3300025585 | Aqueous | GQVWLELDGQLVEAVVNANSYQFVTRRNDQLQQLQVEIAVAYKNNIL |
Ga0208542_11843072 | 3300025818 | Aqueous | GQLVEAVVNANSYQFVTRRNDQLQQLQLEVAIAYKNNIL |
Ga0208005_12704731 | 3300025848 | Aqueous | LVEAVVNANSYQFVTRRNDQLQQLQIEIAVAYKNNIL |
Ga0208783_102532412 | 3300025872 | Aqueous | DGQLVEAVVNANSYQFVTRRNDQLQQLQVEIAVAYKNNIL |
Ga0208644_12285491 | 3300025889 | Aqueous | GQLVEAVVNANQYQFVTRRNDQLQQLQLEVAVAYKNNIL |
Ga0255065_10533022 | 3300027142 | Freshwater | DGQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNSIL |
Ga0208178_10525761 | 3300027259 | Estuarine | VWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0208556_10906422 | 3300027366 | Estuarine | MVRSGYVWLELGGQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNNIL |
Ga0255093_10714031 | 3300027492 | Freshwater | GQLVEAVVNANQYQFVTRRNDQLQQLQLEVAIAYKNNIL |
Ga0208974_11786481 | 3300027608 | Freshwater Lentic | GEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0209617_100172681 | 3300027720 | Freshwater And Sediment | GQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
(restricted) Ga0247833_12160381 | 3300027730 | Freshwater | GTLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL |
Ga0209593_100575041 | 3300027743 | Freshwater Sediment | EMVRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0209296_12686242 | 3300027759 | Freshwater Lake | GQVWLELDGQLVEAIVNSNTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0209598_101916741 | 3300027760 | Freshwater Lake | WLIEMVRSGQVWLELDGQLVEAMVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0209088_101235072 | 3300027763 | Freshwater Lake | LVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0209229_103647932 | 3300027805 | Freshwater And Sediment | QLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNSIL |
Ga0209990_100114531 | 3300027816 | Freshwater Lake | VEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNSIL |
(restricted) Ga0247837_10510502 | 3300027970 | Freshwater | LGGTLVEAVVNANQYQFVTRRNDRLTQLQLEVAVAYDNSIL |
Ga0209401_13312382 | 3300027971 | Freshwater Lake | VEAIVNSNTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0209391_103968741 | 3300027975 | Freshwater Sediment | QVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
(restricted) Ga0247831_12541161 | 3300028559 | Freshwater | GTLVEAVVNANQYQFVTRRNDRLTQLQLEVAVAYDNSIL |
Ga0315907_101020643 | 3300031758 | Freshwater | GQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNSIL |
Ga0315907_104616101 | 3300031758 | Freshwater | LDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0315907_108634181 | 3300031758 | Freshwater | YVWLELGGQLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNSIL |
Ga0315908_108188951 | 3300031786 | Freshwater | VEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNNIL |
Ga0315909_102826071 | 3300031857 | Freshwater | VRSGYVWLELGGQLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL |
Ga0315904_107897522 | 3300031951 | Freshwater | QLVEAVVNANQYQFVTRRNDRLTQLQLEVAVAYDNNIL |
Ga0315904_108138542 | 3300031951 | Freshwater | GQLVEAVVNANQYQFVTRRNDRLTQLQLEVAVAYDNSIL |
Ga0315904_111144211 | 3300031951 | Freshwater | SGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0315904_111965191 | 3300031951 | Freshwater | LVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNSIL |
Ga0315904_113128911 | 3300031951 | Freshwater | RSGYVWLELNGTLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL |
Ga0315901_110727822 | 3300031963 | Freshwater | VEAIVNANTYQFTTRRNDRLTQLQVEVAIAYKNNIL |
Ga0315901_112377821 | 3300031963 | Freshwater | LIEMVRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0315906_106352071 | 3300032050 | Freshwater | LELGGTLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNNIL |
Ga0315905_106551272 | 3300032092 | Freshwater | GGTLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNSIL |
Ga0315903_109361371 | 3300032116 | Freshwater | WLELNGTLVEAVVNANQYQFVTRRNDRLTQLQLEVAVAYDNSIL |
Ga0315903_110044151 | 3300032116 | Freshwater | IRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0334994_0116127_1360_1515 | 3300033993 | Freshwater | MVRSGQVWLELDGQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNSIL |
Ga0334995_0194233_1239_1394 | 3300034062 | Freshwater | MVRSGYVWLELGGQLVEAVVNANQYQFVTRRNDRLTQLQIEIAVAYDNSIL |
Ga0334995_0595244_2_154 | 3300034062 | Freshwater | VRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0334995_0775422_350_505 | 3300034062 | Freshwater | MVRSGYVWLELGGQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYENSIL |
Ga0335010_0424921_578_715 | 3300034092 | Freshwater | VWLELGGTLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNNIL |
Ga0335010_0530012_14_169 | 3300034092 | Freshwater | MVRSGQVWLELDGQLVEAIVNANTYQFTTRRNDRLTQLQIEVAVAYKNNIL |
Ga0335027_0367458_2_133 | 3300034101 | Freshwater | LELDGQLVEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
Ga0335027_0874071_2_118 | 3300034101 | Freshwater | TLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNNIL |
Ga0335053_0393534_2_142 | 3300034118 | Freshwater | YVWLELGGQLVEAVVNANQYQFVTRRNDRLTQLQIEVAVAYDNNIL |
Ga0335060_0092700_1720_1830 | 3300034122 | Freshwater | VEAIVNANTYQFTTRRNDRLTQLQVEVAVAYKNNIL |
⦗Top⦘ |