NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068791

Metagenome / Metatranscriptome Family F068791

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068791
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 44 residues
Representative Sequence VDDNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS
Number of Associated Samples 89
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.39 %
% of genes near scaffold ends (potentially truncated) 24.19 %
% of genes from short scaffolds (< 2000 bps) 76.61 %
Associated GOLD sequencing projects 79
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.194 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil
(23.387 % of family members)
Environment Ontology (ENVO) Unclassified
(44.355 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.613 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 39.71%    β-sheet: 0.00%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF07885Ion_trans_2 36.29
PF00116COX2 23.39
PF00115COX1 12.10
PF01435Peptidase_M48 3.23
PF00211Guanylate_cyc 1.61
PF00497SBP_bac_3 0.81
PF13458Peripla_BP_6 0.81
PF00873ACR_tran 0.81
PF03737RraA-like 0.81
PF04909Amidohydro_2 0.81
PF04392ABC_sub_bind 0.81
PF17158MASE4 0.81
PF04280Tim44 0.81
PF03264Cytochrom_NNT 0.81
PF04831Popeye 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 23.39
COG4263Nitrous oxide reductaseInorganic ion transport and metabolism [P] 23.39
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.61
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 0.81
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.81
COG3005Tetraheme cytochrome c subunit NapC of nitrate or TMAO reductaseEnergy production and conversion [C] 0.81
COG4395Predicted lipid-binding transport protein, Tim44 familyLipid transport and metabolism [I] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.19 %
UnclassifiedrootN/A0.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0936134All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium820Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14492293All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium581Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101242856All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium697Open in IMG/M
3300004114|Ga0062593_100299938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus1368Open in IMG/M
3300004267|Ga0066396_10048398All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300004268|Ga0066398_10010196All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300004281|Ga0066397_10071816All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300004281|Ga0066397_10103415All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium600Open in IMG/M
3300004479|Ga0062595_102050335All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium554Open in IMG/M
3300004633|Ga0066395_10020671All Organisms → cellular organisms → Bacteria2613Open in IMG/M
3300004633|Ga0066395_10741655All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium586Open in IMG/M
3300004633|Ga0066395_10800430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus566Open in IMG/M
3300005166|Ga0066674_10218692All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300005172|Ga0066683_10227997All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1153Open in IMG/M
3300005177|Ga0066690_10049117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2563Open in IMG/M
3300005180|Ga0066685_10001422All Organisms → cellular organisms → Bacteria → Proteobacteria10331Open in IMG/M
3300005180|Ga0066685_10055015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus2565Open in IMG/M
3300005186|Ga0066676_10159926All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1422Open in IMG/M
3300005330|Ga0070690_101666896All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300005332|Ga0066388_100085137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3556Open in IMG/M
3300005332|Ga0066388_100377393All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2064Open in IMG/M
3300005332|Ga0066388_100410674All Organisms → cellular organisms → Bacteria1998Open in IMG/M
3300005332|Ga0066388_103734899All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300005347|Ga0070668_100591055All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300005546|Ga0070696_100845538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus756Open in IMG/M
3300005563|Ga0068855_102345284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus533Open in IMG/M
3300005713|Ga0066905_100055483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2455Open in IMG/M
3300005713|Ga0066905_100547686All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300005713|Ga0066905_100660794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi892Open in IMG/M
3300005713|Ga0066905_100785203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Sphaerobacteridae → Sphaerobacterales → Sphaerobacterineae → Sphaerobacteraceae → Sphaerobacter → Sphaerobacter thermophilus825Open in IMG/M
3300005713|Ga0066905_101098119All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300005713|Ga0066905_102018694All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium535Open in IMG/M
3300005764|Ga0066903_100068267All Organisms → cellular organisms → Bacteria4520Open in IMG/M
3300005764|Ga0066903_100332185All Organisms → cellular organisms → Bacteria2439Open in IMG/M
3300005764|Ga0066903_100336300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2427Open in IMG/M
3300005764|Ga0066903_102847277All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300005764|Ga0066903_107417302All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300006049|Ga0075417_10014108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3055Open in IMG/M
3300006049|Ga0075417_10115402All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1229Open in IMG/M
3300006058|Ga0075432_10313204All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300006606|Ga0074062_11657930All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300006797|Ga0066659_10019613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3840Open in IMG/M
3300006844|Ga0075428_100001674All Organisms → cellular organisms → Bacteria → Proteobacteria23616Open in IMG/M
3300006846|Ga0075430_101146957All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium640Open in IMG/M
3300006854|Ga0075425_101710707All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium707Open in IMG/M
3300006871|Ga0075434_100110867All Organisms → cellular organisms → Bacteria2754Open in IMG/M
3300007076|Ga0075435_101949428All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium516Open in IMG/M
3300007255|Ga0099791_10295949All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium771Open in IMG/M
3300009147|Ga0114129_10040047All Organisms → cellular organisms → Bacteria6609Open in IMG/M
3300009147|Ga0114129_10292870All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300009162|Ga0075423_10069760All Organisms → cellular organisms → Bacteria3647Open in IMG/M
3300009553|Ga0105249_11054662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi882Open in IMG/M
3300009792|Ga0126374_10125185All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1511Open in IMG/M
3300009814|Ga0105082_1100551All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium545Open in IMG/M
3300010043|Ga0126380_10257152All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1213Open in IMG/M
3300010043|Ga0126380_11211523All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium651Open in IMG/M
3300010047|Ga0126382_10778383All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300010359|Ga0126376_10440950All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1187Open in IMG/M
3300010360|Ga0126372_10388432All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1268Open in IMG/M
3300010362|Ga0126377_13100743All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium537Open in IMG/M
3300010362|Ga0126377_13590294All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium502Open in IMG/M
3300010366|Ga0126379_11112666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi896Open in IMG/M
3300010366|Ga0126379_11754903All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium725Open in IMG/M
3300012205|Ga0137362_10036188All Organisms → cellular organisms → Bacteria3946Open in IMG/M
3300012582|Ga0137358_11016994All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium535Open in IMG/M
3300012685|Ga0137397_10076453All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2429Open in IMG/M
3300012918|Ga0137396_10710804All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium741Open in IMG/M
3300012922|Ga0137394_10540964All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium988Open in IMG/M
3300012944|Ga0137410_10091597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp.2239Open in IMG/M
3300012948|Ga0126375_10141721All Organisms → cellular organisms → Bacteria → Proteobacteria1501Open in IMG/M
3300012971|Ga0126369_10242053All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1769Open in IMG/M
3300014326|Ga0157380_13044773All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium534Open in IMG/M
3300015053|Ga0137405_1233914All Organisms → cellular organisms → Bacteria3016Open in IMG/M
3300015371|Ga0132258_10302832All Organisms → cellular organisms → Bacteria3932Open in IMG/M
3300015371|Ga0132258_13313995All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300015372|Ga0132256_100834239All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1038Open in IMG/M
3300015372|Ga0132256_103916929Not Available501Open in IMG/M
3300015374|Ga0132255_101014447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales1245Open in IMG/M
3300015374|Ga0132255_101175900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales1155Open in IMG/M
3300018064|Ga0187773_10066988All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1695Open in IMG/M
3300018431|Ga0066655_10017469All Organisms → cellular organisms → Bacteria3273Open in IMG/M
3300018433|Ga0066667_10000764All Organisms → cellular organisms → Bacteria11364Open in IMG/M
3300020170|Ga0179594_10039393All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1552Open in IMG/M
3300025923|Ga0207681_10170326All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1650Open in IMG/M
3300025942|Ga0207689_11666695All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium529Open in IMG/M
3300025972|Ga0207668_10646571All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300026324|Ga0209470_1085452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales1438Open in IMG/M
3300026329|Ga0209375_1136432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → Roseiflexus castenholzii1057Open in IMG/M
3300026342|Ga0209057_1111002All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1064Open in IMG/M
3300026497|Ga0257164_1084344All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium539Open in IMG/M
3300026536|Ga0209058_1296233All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium557Open in IMG/M
3300026537|Ga0209157_1305423All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium582Open in IMG/M
3300027527|Ga0209684_1054452All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300027646|Ga0209466_1004268All Organisms → cellular organisms → Bacteria2983Open in IMG/M
3300027654|Ga0209799_1011723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales1884Open in IMG/M
3300027655|Ga0209388_1159694All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium635Open in IMG/M
3300027873|Ga0209814_10049878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-11747Open in IMG/M
3300027874|Ga0209465_10024443All Organisms → cellular organisms → Bacteria2805Open in IMG/M
3300027874|Ga0209465_10158364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales1125Open in IMG/M
3300027874|Ga0209465_10530925All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300027874|Ga0209465_10670977All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300027909|Ga0209382_10000783All Organisms → cellular organisms → Bacteria51538Open in IMG/M
3300028592|Ga0247822_10740232All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium797Open in IMG/M
3300030336|Ga0247826_11193061All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium610Open in IMG/M
3300031198|Ga0307500_10048048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales1022Open in IMG/M
3300031543|Ga0318516_10110601All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1559Open in IMG/M
3300031561|Ga0318528_10491590All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300031716|Ga0310813_11432840All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium641Open in IMG/M
3300031720|Ga0307469_10041669All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2796Open in IMG/M
3300031720|Ga0307469_10112322All Organisms → cellular organisms → Bacteria1947Open in IMG/M
3300031720|Ga0307469_10377189All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1201Open in IMG/M
3300031720|Ga0307469_10613269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales974Open in IMG/M
3300031720|Ga0307469_10634029All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium960Open in IMG/M
3300031740|Ga0307468_100179118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales1404Open in IMG/M
3300031820|Ga0307473_10183864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales1225Open in IMG/M
3300031820|Ga0307473_11517366All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium508Open in IMG/M
3300031832|Ga0318499_10030623All Organisms → cellular organisms → Bacteria1938Open in IMG/M
3300032052|Ga0318506_10168892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales961Open in IMG/M
3300032180|Ga0307471_100060037All Organisms → cellular organisms → Bacteria3204Open in IMG/M
3300032180|Ga0307471_100470256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales1400Open in IMG/M
3300032180|Ga0307471_101439729All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium848Open in IMG/M
3300032180|Ga0307471_101700068All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium785Open in IMG/M
3300032205|Ga0307472_101910092All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium592Open in IMG/M
3300034150|Ga0364933_139241All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium625Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil23.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.10%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil10.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.03%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.23%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.61%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.81%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300004281Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026342Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027646Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_093613412228664022SoilVDDPVHDDEPKPWGALLFILIYLLVLAVFWTNTYLRIWRS
ICChiseqgaiiFebDRAFT_1449229313300000363SoilRARRRPTVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
INPhiseqgaiiFebDRAFT_10124285623300000364SoilVDDPVHDDEPKPWGALLFILIYLLVLAVFWTNTYLRIWRS*
Ga0062593_10029993823300004114SoilVDENPSDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0066396_1004839823300004267Tropical Forest SoilVDDNAHDDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS*
Ga0066398_1001019633300004268Tropical Forest SoilMEAPVDDNAHHEEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066397_1007181623300004281Tropical Forest SoilVDDNVHGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066397_1010341523300004281Tropical Forest SoilVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0062595_10205033523300004479SoilVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066395_1002067133300004633Tropical Forest SoilVNENGNDDEPRPRGALILITIYLAVLAAFWLNTYLRIWRS*
Ga0066395_1074165523300004633Tropical Forest SoilVIELAESGRRSTVGDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066395_1080043023300004633Tropical Forest SoilGRRPTVDDKVNGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066674_1021869233300005166SoilVDDPAHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS*
Ga0066683_1022799733300005172SoilVDDPAYDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS*
Ga0066690_1004911733300005177SoilVDEKPSDDEPRPRGALLLIMIYLAVMAAFWLNTYLRIWRS*
Ga0066685_1000142223300005180SoilMVNENQSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS*
Ga0066685_1005501533300005180SoilVTVDEKPSDDEPRPRGALLLIMIYLAVMAAFWLNTYLRIWRS*
Ga0066676_1015992623300005186SoilVDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS*
Ga0070690_10166689623300005330Switchgrass RhizosphereVDENASDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0066388_10008513733300005332Tropical Forest SoilVDDKVNGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066388_10037739333300005332Tropical Forest SoilLAEPGRRSTVGDPMRDDEPRPWGALIFILIYLLVLAAFWTNTYLRIWRS*
Ga0066388_10041067433300005332Tropical Forest SoilVIELAEPGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066388_10373489923300005332Tropical Forest SoilMDDDSRPDDPQPRGALLLILIYLMILLGFWLNTYLRIWRS*
Ga0070668_10059105523300005347Switchgrass RhizosphereVDDPVHDDEPKPWGALLLILSYLLVLAVFWTNTYLRIWRS*
Ga0070696_10084553823300005546Corn, Switchgrass And Miscanthus RhizosphereMDESSRDEEPRPRGALVFILIYLAVLAGFWLNTYLRIWRS*
Ga0068855_10234528423300005563Corn RhizosphereEGRATVDENPSDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0066905_10005548323300005713Tropical Forest SoilMDDPAHDNEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066905_10054768623300005713Tropical Forest SoilLAESGRRSTVGDPGHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066905_10066079433300005713Tropical Forest SoilSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066905_10078520323300005713Tropical Forest SoilVDNNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066905_10109811923300005713Tropical Forest SoilVSENGNDDEPRPRGALILITIYLAVLAAFWLNTYLRIWRS*
Ga0066905_10201869423300005713Tropical Forest SoilMNEPAHDDEQQPRGALLLILIYLAVLAAFWINTYLRIWRS*
Ga0066903_10006826743300005764Tropical Forest SoilVGDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066903_10033218523300005764Tropical Forest SoilMMDHNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066903_10033630033300005764Tropical Forest SoilVDDNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0066903_10284727733300005764Tropical Forest SoilLAESGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0066903_10741730213300005764Tropical Forest SoilVSENGNDDEPRPRGALILITIYLAVLAAFWLNTYLSLEEL
Ga0075417_1001410813300006049Populus RhizosphereVNAHDDEPQPRGALLLILIYLVVLAAFWINTYLRIWRS*
Ga0075417_1011540233300006049Populus RhizosphereVDDPAHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075432_1031320423300006058Populus RhizosphereLAEPGRRSTVDDPAHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0074062_1165793023300006606SoilVDENSSDDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS*
Ga0066659_1001961323300006797SoilVDEKPSDDEPRPRGALLLIMIYLAVLAAFWLNTYLRIWRS*
Ga0075428_100001674163300006844Populus RhizosphereVDDDTYEPEPRPRGALVLILIYLVILAAFWINTYLRLWRS*
Ga0075430_10114695723300006846Populus RhizosphereDKVARARRRPTVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075425_10171070723300006854Populus RhizosphereLAEPGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075434_10011086743300006871Populus RhizosphereVDDPVHADEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075435_10194942813300007076Populus RhizosphereVGRSAGRRLAVSDDTHDDEPRPRGALVLIMIYLAVLAAFWLNTYLRIWRS*
Ga0099791_1029594923300007255Vadose Zone SoilVDENPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS*
Ga0114129_1004004743300009147Populus RhizosphereMVRTAVPQRRRPTVNAHDDEPQPRGALLLILIYLVVLAAFWINTYLRIWRS*
Ga0114129_1029287033300009147Populus RhizosphereVIELAEPGRRSTVDDPAHDDEPRQWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0075423_1006976033300009162Populus RhizosphereVIELAEPGRRSTVDDPAHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0105249_1105466233300009553Switchgrass RhizosphereKVARARRRPTVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0126374_1012518513300009792Tropical Forest SoilPVAISLFGDQREGGPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS*
Ga0105082_110055123300009814Groundwater SandVDGNAHDDEPRPWGALLLILIYLLVLAVFWVNTYLRVWRS*
Ga0126380_1025715223300010043Tropical Forest SoilVDDNAHGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0126380_1121152323300010043Tropical Forest SoilVDNNAHDNEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0126382_1077838323300010047Tropical Forest SoilVDEPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0126376_1044095013300010359Tropical Forest SoilVDDNAHGDEPRPRGALVLIMIYLLGLAAFWLNTYLRIWRS*
Ga0126372_1038843233300010360Tropical Forest SoilVNDNGNDDEPRPRGALVLIMIYLVVLAAFWLNTYLRIWRS*
Ga0126377_1310074323300010362Tropical Forest SoilVNEPANDDEPQPRGALLLILIYLAVLAAFWLNTYLRIWRS*
Ga0126377_1359029413300010362Tropical Forest SoilASMDDHAHDNEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS*
Ga0126379_1111266633300010366Tropical Forest SoilRARGKVEVIELAEPGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0126379_1175490323300010366Tropical Forest SoilVAISLFGDQREGGPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS*
Ga0137362_1003618843300012205Vadose Zone SoilMDHDANDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0137358_1101699423300012582Vadose Zone SoilVDDPVHDDEPRPWGALLFILIYLYVLAGFWTTTYLRIWRS*
Ga0137397_1007645333300012685Vadose Zone SoilVDENANGDEPRPRGALVLIMIYLTVLAAFWLNTYLRIWRS*
Ga0137396_1071080413300012918Vadose Zone SoilVDDPVHDDEPRPWGALLFILVYLFVLAVVWTNSYLRIWSG*
Ga0137394_1054096423300012922Vadose Zone SoilVDENPSDGEPRPRGALLLIMIYLVVLAAFWLNTYMRI
Ga0137410_1009159713300012944Vadose Zone SoilRRTTVDDPVHDDEPRPWGALLFILIYLFVLAVFWTNTYLRIWRS*
Ga0126375_1014172113300012948Tropical Forest SoilVNENGHDDEPRPRGALVLIMIYLFVLAAFWLNTYLRIWRS*
Ga0126369_1024205323300012971Tropical Forest SoilVAISLIGDQREGGPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS*
Ga0157380_1304477313300014326Switchgrass RhizosphereVDENPTDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS*
Ga0137405_123391443300015053Vadose Zone SoilVDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWR
Ga0132258_1030283233300015371Arabidopsis RhizosphereVDENSNNDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS*
Ga0132258_1331399523300015371Arabidopsis RhizosphereMDDDSGHDEPQPRGALLFILIYLMILLGFWLNTYLRIWRS*
Ga0132256_10083423923300015372Arabidopsis RhizosphereMDDDSRNGEEPQPRGALLRILIYLVILLGFWLNTYLRIWRS*
Ga0132256_10391692923300015372Arabidopsis RhizosphereVDDDSRDDEPRPRGALVLILIYLSILTAFWLNTYLRIWRS*
Ga0132255_10101444713300015374Arabidopsis RhizosphereVDDTVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS*
Ga0132255_10117590013300015374Arabidopsis RhizospherePSPGVKETDMDDDNRNGEEPQPRGALLLILIYLVILLGFWLNTYLRIWRS*
Ga0187773_1006698833300018064Tropical PeatlandVSDDTHDDEPRPLGALVLIVIYLAVLAAFWLNTYLRIWRS
Ga0066655_1001746933300018431Grasslands SoilMVNENQSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0066667_1000076483300018433Grasslands SoilVDEKPSDDEPRPRGALLLIMIYLAVMAAFWLNTYLRIWRS
Ga0179594_1003939323300020170Vadose Zone SoilVDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0207681_1017032633300025923Switchgrass RhizosphereVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0207689_1166669523300025942Miscanthus RhizosphereSFKPGRRAAVDENPTDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS
Ga0207668_1064657123300025972Switchgrass RhizosphereVDDPVHDDEPKPWGALLLILSYLLVLAVFWTNTYLRIWRS
Ga0209470_108545213300026324SoilGRRTTVDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0209375_113643213300026329SoilDPRRVTVDEKPSDDEPRPRGALLLIMIYLAVMAAFWLNTYLRIWRS
Ga0209057_111100243300026342SoilMVNENQSDDEPRPRGALLLIMIYLVVLAAFWLNTYL
Ga0257164_108434423300026497SoilVDENANGDEPRPRGALLLIMIYLLVLAAFWLNTYLRIWRS
Ga0209058_129623313300026536SoilPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0209157_130542313300026537SoilVDDPAHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0209684_105445223300027527Tropical Forest SoilVDDNAHDDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS
Ga0209466_100426813300027646Tropical Forest SoilNPISETRGTLVEWRSAGRRPTVDDNAHGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWR
Ga0209799_101172333300027654Tropical Forest SoilMEAPVDDNAHHEEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS
Ga0209388_115969423300027655Vadose Zone SoilVDENPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0209814_1004987813300027873Populus RhizosphereMVRTAVPQRRRPTVNAHDDEPQPRGALLLILIYLVVLAAFWINTYLRIWRS
Ga0209465_1002444323300027874Tropical Forest SoilVDDKVNGDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS
Ga0209465_1015836413300027874Tropical Forest SoilDACGRGRQSAGRGTIVSENGNDDEPRPRGALILITIYLAVLAAFWLNTYLRIWRS
Ga0209465_1053092523300027874Tropical Forest SoilVDDNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRIWRS
Ga0209465_1067097723300027874Tropical Forest SoilVIELAESGRRSTVGDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0209382_10000783183300027909Populus RhizosphereVDDDTYEPEPRPRGALVLILIYLVILAAFWINTYLRLWRS
Ga0247822_1074023213300028592SoilSDRRVLEGFRQPSRGPTVDDDSRDDEPRPRGALLLILIYLAILTAFWLNTYLRIWRS
Ga0247826_1119306123300030336SoilVDDPLHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0307500_1004804813300031198SoilKGQRREHGDQPMDDDGHDEEPQPRGALLFILIYLAALLAFWLNTYLRIWRS
Ga0318516_1011060123300031543SoilVAVSLIDDQREGGPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS
Ga0318528_1049159023300031561SoilVAVSLIGDQREGVPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS
Ga0310813_1143284023300031716SoilVDENSSDDEPRPRGALILIMIYLLVLAAFWLNTYLRIWRS
Ga0307469_1004166943300031720Hardwood Forest SoilVDEKPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0307469_1011232233300031720Hardwood Forest SoilVDDPVHADEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0307469_1037718933300031720Hardwood Forest SoilMIDENPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0307469_1061326933300031720Hardwood Forest SoilWEATDPDRVARARRRPTVDDPVHDDEPKPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0307469_1063402923300031720Hardwood Forest SoilVGDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0307468_10017911833300031740Hardwood Forest SoilRWILVEFPEPGRRSTVDDPVHDDEPRPWGALLFILIYLLVLAVFWTNTYLRIWRS
Ga0307473_1018386433300031820Hardwood Forest SoilVNENDDEPRPRGALVLIMIYLCVLAAFWLNTYLRIWRS
Ga0307473_1151736623300031820Hardwood Forest SoilRPTVDENSNDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS
Ga0318499_1003062333300031832SoilVDDNAHDDEPRPRGALVLIMIYLLVLAAFWLNTYLRLWRS
Ga0318506_1016889233300032052SoilAVSLIGDQREGVPAVNDDANGDEPRPRGALILILIYLAVLAAFWLNTYLRIWRS
Ga0307471_10006003743300032180Hardwood Forest SoilMDENGNGNEPRPRGALVLITIYLAVLAAFWLNTYLRIWRS
Ga0307471_10047025633300032180Hardwood Forest SoilRPGRRTTVDEKPSDDEPRPRGALLLIMIYLVVLAAFWLNTYLRIWRS
Ga0307471_10143972913300032180Hardwood Forest SoilVNENDDEPRPRGALILIMIYLCVLAAFWLNTYLRIWRS
Ga0307471_10170006813300032180Hardwood Forest SoilGQARRRPTVDENSNDDEPRPRGALILIMIYLAVLAAFWLNTYLRIWRS
Ga0307472_10191009223300032205Hardwood Forest SoilVIELAEPGRRSTVDDPVHDDEPRPWGALLLILIYLLVLAVFWTNTYLRIWRS
Ga0364933_139241_391_5133300034150SedimentVDDPVHDDEPKPWGALLLILLYLLVLAVFWTNTYLRIWRS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.