NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068801

Metagenome / Metatranscriptome Family F068801

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068801
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 45 residues
Representative Sequence RAWEALLRDKKRTGDAINLVLLGDDGPYVAARPADEVRAALDTLIA
Number of Associated Samples 110
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 98.39 %
% of genes from short scaffolds (< 2000 bps) 95.16 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.968 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.710 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.129 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.68%    β-sheet: 24.32%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF01220DHquinase_II 70.97
PF01321Creatinase_N 22.58
PF02274ADI 0.81
PF09285Elong-fact-P_C 0.81
PF00351Biopterin_H 0.81
PF02786CPSase_L_D2 0.81
PF01761DHQ_synthase 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG07573-dehydroquinate dehydrataseAmino acid transport and metabolism [E] 70.97
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 22.58
COG1834N-Dimethylarginine dimethylaminohydrolaseAmino acid transport and metabolism [E] 0.81
COG2235Arginine deiminaseAmino acid transport and metabolism [E] 0.81
COG3186Phenylalanine-4-hydroxylaseAmino acid transport and metabolism [E] 0.81
COG4874Uncharacterized conserved proteinFunction unknown [S] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.97 %
UnclassifiedrootN/A4.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918006|ConsensusfromContig8850All Organisms → cellular organisms → Bacteria730Open in IMG/M
2140918008|ConsensusfromContig254292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
2166559005|cont_contig12813All Organisms → cellular organisms → Bacteria1457Open in IMG/M
2170459003|FZN2CUW02HKWGMNot Available507Open in IMG/M
3300000956|JGI10216J12902_110943513All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300004114|Ga0062593_100088260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2133Open in IMG/M
3300004153|Ga0063455_100467908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300004156|Ga0062589_101818491All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300005093|Ga0062594_101041330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300005327|Ga0070658_10599413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria955Open in IMG/M
3300005332|Ga0066388_103367272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria817Open in IMG/M
3300005435|Ga0070714_101682251All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300005436|Ga0070713_100845059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300005436|Ga0070713_101637077All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300005437|Ga0070710_11434473All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005439|Ga0070711_100905442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria753Open in IMG/M
3300005447|Ga0066689_10759975All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005529|Ga0070741_10229366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1784Open in IMG/M
3300005530|Ga0070679_100390647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1337Open in IMG/M
3300005530|Ga0070679_101840767All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005540|Ga0066697_10197700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1195Open in IMG/M
3300005542|Ga0070732_10073283All Organisms → cellular organisms → Bacteria1998Open in IMG/M
3300005552|Ga0066701_10575430All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300005569|Ga0066705_10535243All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300005764|Ga0066903_106388323All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300005834|Ga0068851_10860486All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300006034|Ga0066656_11130219All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006575|Ga0074053_11254523All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300006796|Ga0066665_10747486All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300009093|Ga0105240_12304083All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300009098|Ga0105245_10660665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1076Open in IMG/M
3300009137|Ga0066709_102397095All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300009174|Ga0105241_10651924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria956Open in IMG/M
3300009174|Ga0105241_11610784All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300009174|Ga0105241_12179766All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300009651|Ga0105859_1165312All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300010373|Ga0134128_12792327All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300010376|Ga0126381_104626449All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300010399|Ga0134127_13350256All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300010401|Ga0134121_11363787All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300012008|Ga0120174_1063962All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300012210|Ga0137378_11095276All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300012211|Ga0137377_11126740All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300012357|Ga0137384_10947149All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300012882|Ga0157304_1052774All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300012898|Ga0157293_10149390All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300012927|Ga0137416_10483146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1064Open in IMG/M
3300012961|Ga0164302_10749407All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300012982|Ga0168317_1059268All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300013104|Ga0157370_11396912All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300013307|Ga0157372_11058152All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300013763|Ga0120179_1077667All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300014058|Ga0120149_1055439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1007Open in IMG/M
3300014325|Ga0163163_11613935All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300014969|Ga0157376_10687856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1027Open in IMG/M
3300015262|Ga0182007_10271203All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300015356|Ga0134073_10174079All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300015371|Ga0132258_10129896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6005Open in IMG/M
3300015373|Ga0132257_103702645All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300015373|Ga0132257_104618687All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300018058|Ga0187766_11227812All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300018064|Ga0187773_10189456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1088Open in IMG/M
3300018476|Ga0190274_11832434Not Available702Open in IMG/M
3300020069|Ga0197907_10993581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1468Open in IMG/M
3300020075|Ga0206349_1784311All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300021363|Ga0193699_10131895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1022Open in IMG/M
3300021377|Ga0213874_10034333All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300024279|Ga0247692_1075938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300025909|Ga0207705_10043798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3215Open in IMG/M
3300025909|Ga0207705_10938892All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300025911|Ga0207654_10984750All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300025913|Ga0207695_10306603All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300025924|Ga0207694_11626770All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300025927|Ga0207687_11948111All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300025929|Ga0207664_11226185All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300025949|Ga0207667_10574780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1138Open in IMG/M
3300025949|Ga0207667_12184162All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300026530|Ga0209807_1159268Not Available851Open in IMG/M
3300026530|Ga0209807_1289417All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300026550|Ga0209474_10612860All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300027829|Ga0209773_10290158Not Available683Open in IMG/M
3300027869|Ga0209579_10427060All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300027869|Ga0209579_10794687All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300027911|Ga0209698_10344341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1172Open in IMG/M
3300027965|Ga0209062_1142996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria937Open in IMG/M
3300028587|Ga0247828_11146511All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300028778|Ga0307288_10462071All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300028778|Ga0307288_10481238All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300028828|Ga0307312_11029920All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300030007|Ga0311338_11917337All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031231|Ga0170824_108688961All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300031234|Ga0302325_11575214All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300031239|Ga0265328_10459256All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300031247|Ga0265340_10510765All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031474|Ga0170818_105361626All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300031572|Ga0318515_10288651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300031670|Ga0307374_10583714All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300031682|Ga0318560_10459446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300031708|Ga0310686_115412278All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300031712|Ga0265342_10027583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3546Open in IMG/M
3300031712|Ga0265342_10553966All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300031712|Ga0265342_10659564All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300031723|Ga0318493_10259709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300031724|Ga0318500_10684638All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031781|Ga0318547_10996139All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300031782|Ga0318552_10134850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300031798|Ga0318523_10116405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1319Open in IMG/M
3300031798|Ga0318523_10585363All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300031799|Ga0318565_10079372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1559Open in IMG/M
3300031938|Ga0308175_100698612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1101Open in IMG/M
3300031942|Ga0310916_11284585All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300032009|Ga0318563_10246617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria965Open in IMG/M
3300032009|Ga0318563_10721465All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300032039|Ga0318559_10409784All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300032043|Ga0318556_10348034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria775Open in IMG/M
3300032067|Ga0318524_10384014All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300032089|Ga0318525_10038031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2365Open in IMG/M
3300032160|Ga0311301_12707101All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300032261|Ga0306920_104447749All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300032770|Ga0335085_11470737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium711Open in IMG/M
3300032893|Ga0335069_12194480All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300033004|Ga0335084_12028826All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300033805|Ga0314864_0048583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria963Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.26%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.65%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.03%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere4.03%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.42%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.42%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.61%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.81%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.81%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.81%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918006Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1EnvironmentalOpen in IMG/M
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006575Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009651Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012008Permafrost microbial communities from Nunavut, Canada - A39_80cm_12MEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012982Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfieldEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027965Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P1_C_017581302140918006SoilALQRDKKRIGEEFNLVLLGDDGPRVEARPADEVRAALDSLIE
Bog_all_C_015017202140918008SoilAWAALQRDKKRTGNAINLVLLGDDGPYVEARSPDEVRAALDTLIA
cont_0813.000011602166559005SimulatedMLRDKKRSGGEINVVLLGDDGPVVEPRPADEVRAALDTLIR
E4A_123176302170459003Grass SoilTEAERGEINVVLLGDAGPVVEPRPADEVRAALDTLIR
JGI10216J12902_11094351313300000956SoilELAPKPVNVDPERAWQALLRDKKRAGDAINAVVLTDNGPAVEQRPPDEVRRELNRLIAS*
Ga0062593_10008826043300004114SoilRDKKRSGDAINLVLLGEGGPCVEERPAAEVRRELERLIG*
Ga0063455_10046790813300004153SoilDPDRAWQALLRDKKSTGGRINLVLLGKRGPYVEPRDPVEVRSELERLIA*
Ga0062589_10181849123300004156SoilRDKKRTDDAINLVLLGEGGPRVEARPAAEVRRELERLIA*
Ga0062594_10104133013300005093SoilLLRDKKSTGGQINLVLLGERGPFVERRDPDEVRRELERLIA*
Ga0070658_1059941333300005327Corn RhizosphereVDRDRAWAALLRDKKRTGDAINLVLLGEDGPKVEARPADVVRAALDTLIA*
Ga0066388_10336727213300005332Tropical Forest SoilLLRDKKRTGDAINLVLLGDDGPRVEERPAPEVRRELERLIG*
Ga0070714_10168225113300005435Agricultural SoilLRDKKRTGDAINLVLLGEGGPYVEPRPADEVRRELDRLIA*
Ga0070713_10084505913300005436Corn, Switchgrass And Miscanthus RhizospherePDRAWQALARDKKRTGEAINLVLLGDDGPYVEARPADEVRAALDTLIAS*
Ga0070713_10163707723300005436Corn, Switchgrass And Miscanthus RhizosphereERAWQALLRDKKRTGDEINLVLLGDSGPYVEARPAEDVRRELERLIA*
Ga0070710_1143447313300005437Corn, Switchgrass And Miscanthus RhizosphereLQRDKKRAGDEIRLVLLGDDGPYLEARPAAEVRAALDSLIAQ*
Ga0070711_10090544233300005439Corn, Switchgrass And Miscanthus RhizosphereDRGRAWEALLRDKKRSGDAVNLVLLGDDGPYVEARPPDEVRAALDTLIA*
Ga0066689_1075997523300005447SoilRAWQALLRDKKRTGDAINLVLLGAGGPRVEERPAAEVRRELERLIK*
Ga0070741_1022936613300005529Surface SoilGGEINLVLLSDDGPYVAPRPAAEVRAALDTLIACKS*
Ga0070679_10039064733300005530Corn RhizosphereAVDRDRAWAALLRDKKRTGDAINLVLLDDDGPKVEARPADVVRAALDTLIA*
Ga0070679_10184076713300005530Corn RhizosphereRAWEALLRDKKRTGDAINLVLLGDDGPYVAARPADEVRAALDTLIA*
Ga0066697_1019770013300005540SoilRSGGEINLVLLGDDGPYVAARPAEEVRAALDTLIA*
Ga0070732_1007328343300005542Surface SoilWQALLRDKKRDGDAINVVLLGEDGPVVEARPAAEVRRALDRLIAG*
Ga0066701_1057543033300005552SoilAVDAERAWQALLRDKKRTGDAINLVLVGDGGPRVEERPAVEVRRELERLIK*
Ga0066705_1053524313300005569SoilWQALLRDKKRTGDAINLVLLGAGGPRVEERPAAEVRRELERLIK*
Ga0066903_10638832313300005764Tropical Forest SoilKKRTGDTINLVLLGDGGPRVEPRPADAVRAALDTLIR*
Ga0068851_1086048613300005834Corn RhizosphereKKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA*
Ga0066656_1113021923300006034SoilWQALLRDKKRTGDAINLVLLGDGGPRVEKRPAAEVRPELERLIK*
Ga0074053_1125452313300006575SoilWQALLRDKKRTGDAINLVLLGDSGPYVEARPAEDVRRELERLIY*
Ga0066665_1074748633300006796SoilWQALLRDKKRTGEAINLVLLGDGGPRVEERPAAEVQRELERLIK*
Ga0105240_1230408323300009093Corn RhizosphereRDKKRTDDAINLVLLGDDGPRVEPRPAAEVRAALDTLIA*
Ga0105245_1066066533300009098Miscanthus RhizosphereALLRDKKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA*
Ga0066709_10239709513300009137Grasslands SoilELAPRPVHVDADRAWQALLRDKKRAGDAINVVVLTEDGPAVEARDPQEVRAQLDRLLA*
Ga0105241_1065192433300009174Corn RhizosphereAALLRDKKRTGDAINLVLLDDDGPKVEARPADVVRAALDTLIA*
Ga0105241_1161078423300009174Corn RhizosphereQRDKKRTGDAINLVLLGDDGPYVEARPAGEVKAALDRLIA*
Ga0105241_1217976623300009174Corn RhizosphereALLRDKKRTGEAINLVLLGDGGPRVEARPADAVRAALDTLIR*
Ga0105859_116531233300009651Permafrost SoilRDKKVEGVDVHLVLLGADGPRVEVRPPAEVRAALDSLIA*
Ga0126309_1048370313300010039Serpentine SoilKKRTGDTVNVVVLTENGPELQPRDAAEVRRELARLIA*
Ga0134128_1279232723300010373Terrestrial SoilALLRDKKRTGADINLVLLGDDGPYVEARSPDEVRAALDTLIR*
Ga0126381_10462644913300010376Tropical Forest SoilDPERAWQALLRDKKRTGDEINLVLLGDSGPYVEARPADDVRRELERLIA*
Ga0134127_1335025613300010399Terrestrial SoilSGETINLVLLGDDGPVVEGRPAGEVRAALDTLIG*
Ga0134121_1136378713300010401Terrestrial SoilDPERAWRALTRDKKRTGEEINLVLLGDEGPYVQARAADEVRAALDTLIAS*
Ga0120174_106396213300012008PermafrostLQRDKKRTGDEIQLVLLGDDGPLVEARPPDEVRAALDSLIAS*
Ga0137378_1109527613300012210Vadose Zone SoilPVVAALDPQPVEVDRDRAWEALLRDKKRSGDAINLVLLGERGPYVDARSPDEVRAALDTLLA*
Ga0137377_1112674013300012211Vadose Zone SoilAPQPVRVDAERAWEALLRDKKRTGDAINLVLLGEHGPYVQERPAAEVRRELERLIA*
Ga0137384_1094714933300012357Vadose Zone SoilRDKKQRDGELNLVLLGDEGPYVAAHPADEVRAALDSLIR*
Ga0157304_105277423300012882SoilDPGRAWEALLRDKKRTGDAINVVLLGEDGPRVEERPAGDVRRELERLIA*
Ga0157293_1014939033300012898SoilLLRDKKSTAGRINLVLLGESGPYVEPREADEVRRELERLIA*
Ga0137416_1048314633300012927Vadose Zone SoilRDKKRTGEAINVVVLGDDGPRVEERPAADVRRELERLIA*
Ga0164302_1074940713300012961SoilPKPVAVDRDRAWEALLRDKKRTDETINLVLLGEDGPVVAARPPDVVRAALDTLIA*
Ga0168317_105926833300012982Weathered Mine TailingsEALLRDKKRSGATINLVLLADGGPVVEARSADEVRAALDTLIA*
Ga0157370_1139691213300013104Corn RhizosphereKRSGNVINLVLLGDDGPVVEPRPADDVRAALDSLIR*
Ga0157372_1105815213300013307Corn RhizosphereALLRDKKRTGADINLVLLGNDGPYVEARSPDEVRAALDTLIL*
Ga0120179_107766713300013763PermafrostAWEALLRDKKRERDEINLVLLGDDGPYVEARPPDEVRAALDTLIA*
Ga0120149_105543933300014058PermafrostLLLDKKRTGDAINLVLLGDDGPRLEARPAHEVRAALDSLIR*
Ga0163163_1161393533300014325Switchgrass RhizosphereAWQALLRDKKRSGDEIVLVLLGADGPTVEPRPADEVRQALYTLIR*
Ga0157376_1068785613300014969Miscanthus RhizosphereRSGDEIVLVLLGDDGPTVESRPADEVRQALYTLIS*
Ga0182007_1027120313300015262RhizosphereKRSGDTINLVLLGDAGPYLEARSPEEVRAALDTLIAD*
Ga0134073_1017407913300015356Grasslands SoilGDAINLVLLGDDGPYVEARPADDVRAALDRLIVS*
Ga0132258_1012989613300015371Arabidopsis RhizosphereSGVERELDPQPVGLDPERAWQALLRDKKRTGDAINVVVLTGDGAKVEPRPPEEVRRELNRLIA*
Ga0132257_10370264513300015373Arabidopsis RhizosphereVSVDRERAWQALLRDKKRTGEAINLVLLGDEGPYVEARPADEVRRELERLIA*
Ga0132257_10461868723300015373Arabidopsis RhizosphereDKKRTGDAVNVVLLGEDGPVVEERPAAEVRRELQRLIT*
Ga0187766_1122781213300018058Tropical PeatlandDKKRTGDAINLVLLGADGPYVEPRPADEVRRELERLIA
Ga0187773_1018945613300018064Tropical PeatlandALLRDKKRSGDAVNVVLLGPGGPVVEERPAAAVRRELDRLIA
Ga0190274_1183243423300018476SoilERAWQALLRDKKHIGGDINIVLLGDGGPVVEARPADEVRRELERLIVGAG
Ga0197907_1099358113300020069Corn, Switchgrass And Miscanthus RhizosphereKRAAGEINLVLLSDDGPTLEARSAEEVRAALDTLIR
Ga0206349_178431113300020075Corn, Switchgrass And Miscanthus RhizosphereKKRAGGEINLVLLSDDGPTLEARSAEEVRAALDTLIR
Ga0193699_1013189513300021363SoilEALQRDKKRTGDEINLVLLGDDGPYVEARSADEVRAALDRLLR
Ga0213874_1003433333300021377Plant RootsRAWRALLRDKKRAGDTINLVLLGDAGPVVESRPADEVRAALDTLII
Ga0247692_107593823300024279SoilDTAPMIEALDPQPVQVDRDRAWEALQRDKKRTGDEINLVLLGEDGPYVEARSPDEVRAALDTLIL
Ga0207705_1004379813300025909Corn RhizosphereVAVDRRRAWEALLRDKKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA
Ga0207705_1093889223300025909Corn RhizosphereDRDRAWAALLRDKKRTGESINLVLLGDDGPKVEARPADEVRAFFAELI
Ga0207654_1098475013300025911Corn RhizosphereVAVDRDDAWAALLRDKKRTGEAINLVLLGDGGPRVEARPADAVRAALDTLIR
Ga0207695_1030660313300025913Corn RhizosphereARVDVDRAWEALLRDKKRAGAEINVVLLGADGPVVEPRPADEVRRELERLIA
Ga0207694_1162677023300025924Corn RhizosphereLRDKKRSGETINLVLLGDDGPVVEGRPAGEVRAALDTLIG
Ga0207687_1194811123300025927Miscanthus RhizosphereALLRDKKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA
Ga0207664_1122618513300025929Agricultural SoilPVSVDRERAWEALLRDKKRTGDAINVVVLGEDGPRVEERPAADLRRELERLIA
Ga0207667_1057478033300025949Corn RhizosphereRRRAWEALLRDKKRTDDAINLVLLGEDGPRVEPRPAAEVRAALDTLIA
Ga0207667_1218416223300025949Corn RhizosphereRAWAALLRDKKRSGGEINLVLLGADGPLVEARPEAEVRAALATLIA
Ga0209807_115926813300026530SoilWQALLRDKKRTGDAINLVLLGAGGPRVEERPAAEVRRELERLIK
Ga0209807_128941723300026530SoilDPERAWQALLRDKKRTGDAINLVLLGGDGPLVEERPAADVRRELERLIA
Ga0209474_1061286023300026550SoilDPAPIVDALDPQPVAVDRDVAWEALQRDKKRSGGQINLVLLGEDGPYVAARPAEEVRAALDTLIRH
Ga0209773_1029015833300027829Bog Forest SoilDKKRSGEEINLVLLGDGGPYVEARPAAEVRRELERLIA
Ga0209579_1042706013300027869Surface SoilDADRAWAALLRDKKRTGDAINVVLLGEDGPFVDERPAADVRRELERLIQ
Ga0209579_1079468713300027869Surface SoilALQRDKKVEGGAVKLVLLGEHGPTLEERPPAEVRAALDSLIA
Ga0209698_1034434113300027911WatershedsKRSGAAINLVLLGEDGPFVAERPAAEVREALEALIAAEP
Ga0209062_114299633300027965Surface SoilREGGEILLVLLGDDGPVVEARPADEVRAALDTLMA
Ga0247828_1114651123300028587SoilQALLRDKKRSGDEIVLVLLGDDGPTVESRPADEVRQALYTLIS
Ga0307288_1046207113300028778SoilAWQALLRDKKRSGDEIVLVLLGDDGPTVESRPADEVQQALYTLIS
Ga0307288_1048123823300028778SoilDKKRTGEEINLVLLGDDGPYVEARSPDEVRAALDTLIR
Ga0307312_1102992023300028828SoilLLRDKKRTGNAINVVVLGDDGPRVEERSAPDVRRELERLIA
Ga0311338_1191733723300030007PalsaGGAINLVLLGPDGPVVEERPAAEVRGALEELIADPALNGAH
Ga0170824_10868896113300031231Forest SoilVHVDRERAWAALLRDKKRSGETINLVLLGEDGPYLDARSPDEVRAALDTLIS
Ga0302325_1157521433300031234PalsaKPVAVDADRAWEALLRDKKRSGDEINLVLLGEDGPYVEARPAVEVRAELERLIA
Ga0265328_1045925623300031239RhizosphereDPERAWAALQRDKKRTGSDINLVLLGDDGPFVEARSPDEVRAALDTLIS
Ga0265340_1051076523300031247RhizosphereKKVEGGAVKLVLLGADGPTVEERPPAEVRAALDSLIA
Ga0170818_10536162613300031474Forest SoilPVHVDPERAWQALLRDKKRTGDTINLVLLGDKGPYVAPRPADEVRRELERLIA
Ga0318515_1028865113300031572SoilAWSALQRDKKRAGGEINLVLLGSDGPIVEPRPPHEVRTALDSLIAD
Ga0307374_1058371423300031670SoilERAWQALLRDKKRTGEAINLVLLGPDGPFVEERPPEEVRRELERLIA
Ga0318560_1045944633300031682SoilKKRSGDEINLVLLGDHGPAVEARPADEVRSALNSLIA
Ga0310686_11541227823300031708SoilAWQALLRDKKRSGEAIKLVLLGDDGPYVAERPAAEVREALETLIAKPSLSRAS
Ga0265342_1002758313300031712RhizosphereKRTGSDINLVLLGDDGPFVEARSPDEVRAALDTLIS
Ga0265342_1055396623300031712RhizosphereALQRDKKVEGGAVKLVLLGADGPTVEERPPAEVRAALDSLIA
Ga0265342_1065956423300031712RhizosphereDRAWEALLRDKKGQDGAINLVLLSPDGPTVESRPHAEVRAALDSLIA
Ga0318493_1025970913300031723SoilERAWQALLRDKKRTGDAINLVLLGADGPYVEPRPADEVRRELDRLIA
Ga0318500_1068463813300031724SoilVRRDKKRAGGEIRLVLLGEDGPVVEARPEGEVRAALDTLIR
Ga0318547_1099613923300031781SoilAWEALRRDKKRAGGEIRLVLLGEDGPVVEARPEGEVRAALDTLIR
Ga0318552_1013485033300031782SoilVAADHERAWAALLRDKKRSGDEINLVLLGDHGPAVEARPADEVRSALNSLIA
Ga0318523_1011640533300031798SoilRAWAALLRDKKRSGDEINLVLLGDHGPAVEARPADEVRSALNSLIA
Ga0318523_1058536323300031798SoilVRVDPERAWQAVLRDKKRTGDAINLVLLGADGPYVEPRPADEVRRELDRLIA
Ga0318565_1007937213300031799SoilERAWSALQRDKKRAGGEINLVLLGSDGPIVEPRPPHEVRTALDSLIAD
Ga0308175_10069861213300031938SoilLLRDKKRTGDAINVVLVGDGGPRIEERPAAEVRRELERLIA
Ga0310916_1128458523300031942SoilALLRDKKRSDGEINLVLLGDDGPFVEPRPEADVRAALDDLIV
Ga0318563_1024661733300032009SoilRPVRVDRDRAWDALLRDKKRSAGAINLVLLGATGPVVESRPADEVRAALYSLTLD
Ga0318563_1072146513300032009SoilLLRDKKRSGEAINLVLLGDAGPYVEARPAAEVRRELERLIA
Ga0318559_1040978423300032039SoilSERAWQALLRDKKRSGDAINLVLLGDDGPYVEPRPADDVRRELERLIA
Ga0318556_1034803433300032043SoilDALLRDKKRSAGAINLVLLGATGPVVESRPADEVRAALYSLTLD
Ga0318524_1038401433300032067SoilAWQALLRDKKRTGDAINLVLLGADGPYVEPRPADEVRRELDRLIA
Ga0318525_1003803113300032089SoilALLRDKKRSGDEINLVLLGDHGPAVEARPADEVRSALNSLIA
Ga0311301_1270710113300032160Peatlands SoilRAWEALLRDKKRSGADVNLVLLGDDGPYLATRPAAEVRAALESLIAVG
Ga0306920_10444774913300032261SoilVRVDPERAWQALLRDKKRSGEAINLVLLGDAGPYVEARPAADVRRELERLIA
Ga0335085_1147073713300032770SoilLRDKKRSGDAINLVLLGDEGPYVEARPADEVRRELERLIA
Ga0335069_1219448013300032893SoilRAWQALLRDKKRERGEILLVLLGDGGPVVEPRAADVVRAALETLIV
Ga0335084_1202882613300033004SoilDRDRAWQALLRDKKRSGDSINLVLLGDQGPYVDARPPDEVRAALDTLIS
Ga0314864_0048583_2_1213300033805PeatlandDKKRAGGAINLVLLGADGPTVEPRPPDEVRAALDSLIRD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.