NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F068863

Metagenome / Metatranscriptome Family F068863

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F068863
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 114 residues
Representative Sequence MQYSKLFVLAALFASTSAITVRDNSDPEGRNVAKQTWRDMHISGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Number of Associated Samples 104
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 69.35 %
% of genes from short scaffolds (< 2000 bps) 99.19 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.194 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(19.355 % of family members)
Environment Ontology (ENVO) Unclassified
(41.129 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(49.194 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 41.10%    β-sheet: 0.00%    Coil/Unstructured: 58.90%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.19 %
UnclassifiedrootN/A0.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003943|Ga0007808_1008819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300003986|Ga0063233_10201960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300004124|Ga0066178_10102136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum781Open in IMG/M
3300004128|Ga0066180_10271789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300004762|Ga0007749_1145018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300004769|Ga0007748_10078332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300004769|Ga0007748_11301326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300004772|Ga0007791_10141349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300004789|Ga0007752_10025536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300004789|Ga0007752_11180681All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300004793|Ga0007760_11361796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300004793|Ga0007760_11418117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300004794|Ga0007751_10018402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300004794|Ga0007751_10088651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300004836|Ga0007759_11552201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300006415|Ga0099654_10100155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300006850|Ga0075491_1539208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300007554|Ga0102820_1112920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300007692|Ga0102823_1214081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300008119|Ga0114354_1174167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300008938|Ga0103741_1099127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300009024|Ga0102811_1360511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300009059|Ga0102830_1257492All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300009068|Ga0114973_10475942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300009071|Ga0115566_10282518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum984Open in IMG/M
3300009077|Ga0115552_1379324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300009086|Ga0102812_10494147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300009151|Ga0114962_10262833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum978Open in IMG/M
3300009155|Ga0114968_10637019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300009182|Ga0114959_10270176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum857Open in IMG/M
3300009182|Ga0114959_10603999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300009434|Ga0115562_1233793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300009435|Ga0115546_1315346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300009599|Ga0115103_1105729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300009738|Ga0123379_1067190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300010158|Ga0114960_10316411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300010885|Ga0133913_13439344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1035Open in IMG/M
3300010981|Ga0138316_10863312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300010981|Ga0138316_11454050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300010981|Ga0138316_11543049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300012416|Ga0138259_1512430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300012722|Ga0157630_1065339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300012751|Ga0138277_1041885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300012751|Ga0138277_1121644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300012755|Ga0138281_1049402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300012756|Ga0138272_1044670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300012756|Ga0138272_1181641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300012758|Ga0138285_1191873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300012760|Ga0138273_1173745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300012761|Ga0138288_1196979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300012766|Ga0138282_1227011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300012770|Ga0138291_1168472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300012771|Ga0138270_1004232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300012771|Ga0138270_1005322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300012772|Ga0138287_1164218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300012772|Ga0138287_1224418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300012781|Ga0138286_1124134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300012954|Ga0163111_12421147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300012968|Ga0129337_1467711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300012970|Ga0129338_1165830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300013004|Ga0164293_10362223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum986Open in IMG/M
3300013006|Ga0164294_10553376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum781Open in IMG/M
3300013014|Ga0164295_10559527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum879Open in IMG/M
3300016751|Ga0182062_1153430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300017788|Ga0169931_10414906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum989Open in IMG/M
3300018607|Ga0188821_1018400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300018607|Ga0188821_1026434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300018692|Ga0192944_1034248All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300018730|Ga0192967_1039883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum785Open in IMG/M
3300018746|Ga0193468_1056044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018831|Ga0192949_1091646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300018862|Ga0193308_1075499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300019022|Ga0192951_10307773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300019032|Ga0192869_10264628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300019032|Ga0192869_10304931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300019036|Ga0192945_10165915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300019043|Ga0192998_10209840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300019050|Ga0192966_10127622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum892Open in IMG/M
3300019131|Ga0193249_1087331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300020382|Ga0211686_10114726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1105Open in IMG/M
3300021169|Ga0206687_1413023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum682Open in IMG/M
3300021334|Ga0206696_1473350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300021335|Ga0213867_1252743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300021345|Ga0206688_10131819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300021345|Ga0206688_10144619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300021353|Ga0206693_1403372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum781Open in IMG/M
3300021359|Ga0206689_10769198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300021866|Ga0063109_110555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300021941|Ga0063102_1103877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300021962|Ga0222713_10353956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum917Open in IMG/M
3300021962|Ga0222713_10494692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300021962|Ga0222713_10586106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300021964|Ga0222719_10798438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300023175|Ga0255777_10610754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300023179|Ga0214923_10452683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300023184|Ga0214919_10521012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300023700|Ga0228707_1062148All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300024346|Ga0244775_11016812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300025578|Ga0208864_1094724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300025640|Ga0209198_1202837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300025680|Ga0209306_1179974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300025897|Ga0209425_10224476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum986Open in IMG/M
3300026465|Ga0247588_1061228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300027689|Ga0209551_1250003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300027734|Ga0209087_1168899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum864Open in IMG/M
3300027749|Ga0209084_1145532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum998Open in IMG/M
3300028137|Ga0256412_1221592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum698Open in IMG/M
3300028137|Ga0256412_1301309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300028335|Ga0247566_1046069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300028575|Ga0304731_10943316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300028575|Ga0304731_11244284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300030756|Ga0073968_11922353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300030780|Ga0073988_12256860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300030788|Ga0073964_11539713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300030788|Ga0073964_11567964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300030859|Ga0073963_11511244All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300030865|Ga0073972_10734001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300030958|Ga0073971_11232259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300031004|Ga0073984_11140232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300031004|Ga0073984_11242812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300031717|Ga0307396_10359161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300031734|Ga0307397_10389316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300032751|Ga0314694_10418510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake19.35%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.32%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake12.90%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine12.10%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.65%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.84%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.84%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.03%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.03%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.23%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.42%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.42%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.61%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.81%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.81%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.81%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.81%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.81%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.81%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.81%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.81%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003943Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE06Aug07EnvironmentalOpen in IMG/M
3300003986Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2)EnvironmentalOpen in IMG/M
3300004124Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)EnvironmentalOpen in IMG/M
3300004128Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2)EnvironmentalOpen in IMG/M
3300004762Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004772Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5MEnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006850Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009738Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_244_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010158Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaGEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012751Freshwater microbial communities from Lake Montjoie, Canada - M_130821_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012755Freshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012758Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012760Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012761Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012766Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012770Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012772Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012781Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300018607Metatranscriptome of freshwater lake microbial communities from Lake Tornetrask, Sweden - GS667_3p0_dTEnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019043Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782103-ERR1712098)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021866Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300023700Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025578Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA0.5M (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027689Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030788Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030865Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030958Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0007808_100881923300003943FreshwaterSKLFALAALLGCTSAIRLQDNSDPEGRNVDNPHGKINTSLDSTADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0063233_1020196013300003986Freshwater LakeKILNMQYSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0066178_1010213613300004124Freshwater LakeNMQYSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0066180_1027178913300004128Freshwater LakeMQYSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0007749_114501813300004762Freshwater LakeLNMQYSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Ga0007748_1007833213300004769Freshwater LakeASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0007748_1130132623300004769Freshwater LakeMQYSKLFALVALLGCTSAIRIQDNSDPEGRNVDKTTWKNMHISGYNGADEDEIQDNIYSRFSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSDVPSFLEAHFEDAWNHFD*
Ga0007791_1014134913300004772FreshwaterLAALLGCTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0007752_1002553613300004789Freshwater LakeILNMQYSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0007752_1118068113300004789Freshwater LakeLNMQYSKLFALAALLGCTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0007760_1136179613300004793Freshwater LakeKILKMQYSKLFALVALLGCTSAIRIQDNSDPEGRNVDKTTWKNMHISGYNGADEDEIQDNIYSRFSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSDVPSFLEAHFEDAWNHFD*
Ga0007760_1141811713300004793Freshwater LakeMQYSKLFALAALLGCTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0007751_1001840213300004794Freshwater LakeRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0007751_1008865113300004794Freshwater LakeMFKSLAAAALLGMASTHRLAVSDVSDVLGRNVDHYTHKDTHISGYNGADEDEIYDNIFSRFSKEGLTPSGHKTGQKLLMKDDAKIASGQALEAAHWLSPSEVPSYLDANFENAWNHYD*
Ga0007759_1155220113300004836Freshwater LakeNVDKTTWKNMHISGYNGADEDEIQDNSDPEGRNVDKTTWKNMHISGYNGADEDEIQDNIYSRFSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSDVPSFLEAHFEDAWNHFD
Ga0099654_1010015513300006415LakeSSDLLKMQYSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRNMHISGYNGADEDEIQDNIYSRYSKEGVTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLAPSAVPSYLEAHFEDSWNHFD*
Ga0075491_153920813300006850AqueousLAGAVRLADNSDPEGRNVDRTTWKDMKISGFNGADEDEIMDSIFSRFAQEGRTPSNHKTGQKLLMKDDAKLAAGTILEAAHKLAPNAVPGFLNANFEKAWNHFDQNHEGWIRYEETHTFQRYL*
Ga0102820_111292013300007554EstuarineMKLLVLSALIASVASIRLNDNSDPEGRNVDKTTWKDMHISGYNGADEDEIMDSIFSKYSREGRTPSNHKTGQKLLMKDEAKLAAGTILEAAHKLEPKDVPAFLEANFEKAWNHYD*
Ga0102823_121408123300007692EstuarineMKLLVLSALIASAASIRLNDNSDPEGRNVDKTTWKDMHISGYNGADEDEIMDSIFSKYSREGRTPSNHKTGQKLLMKDEAKLAAGTILEAAHKLEPKDVPAFLEANFEKAWNHYD*
Ga0114354_117416713300008119Freshwater, PlanktonMQYSKLFVLAALLASTSAITVRDHSVPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0103741_109912713300008938Ice Edge, Mcmurdo Sound, AntarcticaMLVLAALFVGADAIKIKDDSDKDGKNVDGTTWKEMHVSGYNGADEDEIMDNVYARFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLESAHKLKPAEVPAYLDANFENSWNHFD*
Ga0102811_136051113300009024EstuarineASIRLNDNSDPEGRNVDKTTWKDMHISGYNGADEDEIMDSIFSKYSREGRTPSNHKTGQKLLMKDEAKLAAGTILEAAHKLEPKDVPAFLEANFEKAWNHYD*
Ga0102830_125749213300009059EstuarineMKFYAIVALLGLAGAVRLTDNSDPEGRNVDKTTWKDMHISGYNGADEDEIMDSIFSKYSQEGRTPSNHKTGQKLLMKDDAKLAAGTILEAAHKLEPKAVPGFLNANFEKAWNHFDQNHEGWIRYEENHTFQR*
Ga0114973_1047594213300009068Freshwater LakeMNYSKLFALAALLGCTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0115566_1028251813300009071Pelagic MarineMGLSKIIAISALLAYTSAIRLKDDSDPNGKNFDGAQTYEDMTLSGHNGADEDEIMDNIYSRYSKEGRTPSGHKTGQKLLMKDDGKLAAGTVLEAAHFLKPAEVPGYLDSNFENAWNHFDQNHEGWIRYEETHTFQRYLNG*
Ga0115552_137932413300009077Pelagic MarineMQFSKIIALAALFGMVDVNAVKISAMDNSDPEGRNVDKTTWKDMKISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLLPPAVPAYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQGAL
Ga0102812_1049414723300009086EstuarineMKLLVLSALIASVASIRLNDNYDPEGRNVDKTTWKDMHISGYNGADEDEIMDSIFSKYSREGRTPSNHKTGQKLLMKDEAKLAAGTILEAAHKLEPKDVPAFLEANFEKAWNHYD*
Ga0114962_1026283313300009151Freshwater LakeMQYSKLFVLAALFASTSAITVRDSSDPEGRNVATQTWRDMHISGYNGADEDEIQDNIYSRYSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0114968_1063701913300009155Freshwater LakeMQYSKLFVLAALFASASAITVRDNSDPEGRNVATQTWRDMHISGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIASGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0114959_1027017613300009182Freshwater LakeIINKILNMQYSKLFVLAALFASASAITVRDNSDPEGRNVAKQTWRDMHISGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0114959_1060399913300009182Freshwater LakeMQFSKLFALAALLGCISAIRIQDNSDPEGRNVDKTTWKDMHISGYNGADEDEIQDNIYSRFSKEGITPSGHKTGQKLLMKDDAKIAAG*
Ga0115562_123379313300009434Pelagic MarineQIDTNSEAESLMAIGADLDDDSDPNGKNVDGAETYADQKISGYNGADEDEIMDNIFGKYSKEGRTPSGHKTGQKLLMKDEGKLAAGTILEAAHKLQPAEVPGYLDAHFEEAWNHFDQNHEGWIRYEETHTF*
Ga0115546_131534613300009435Pelagic MarineMQFSKIIALAALFGMVDVNAVKISAMDNSDPEGRNVDKTTWKDMKISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLLPPAVPAYLDANFEKSWNHFDQNHEGWIRYEETHT
Ga0115103_110572913300009599MarineLAALFAGADAIKIKDDSDKEGRNVDKTTWKEMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLESAHKLKPAEVPGYLE*
Ga0123379_106719013300009738MarineSDPDGKNVAGVETWADQKISGYNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLAPRDVPGYLDANFENAW*
Ga0114960_1031641113300010158Freshwater LakeMQYSKLFVLAALFASTSAITVRDNSDPEGRNVAKQTWRDMHISGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0133913_1343934413300010885Freshwater LakeMQFSKLFALAALLGCTSAIRIQDNSDPEGRNVDKTTWKDMHISGYNGADEDEIQDNIYSRFSKEGITPSGHKTGQKLLMKDDAKIAAG*
Ga0138316_1086331213300010981MarineKIFNMQITKVLALFLGVTSAIKLTDDSDANGGNVDKTTWKDMHISGYNGADEDEIMDNIFSKYSREGQTPSGHKTGQKLLMKDEAKLASGTILEAAHKLQPSQVPGYLEANFENTWNHFD
Ga0138316_1145405013300010981MarineMALVGAIKVRDDSDPMGKNFDGAQTHSDMKISGYNGADEDEIMDNIFSRFSKEGMTPSGHKTGQKLLMKDEAKLAAGTVLESAHKLKPSQVPAYLDSNFEKAWNHFD*
Ga0138316_1154304913300010981MarineAVVALVGALKLRDDSNAMGQNFDGAETHSDMHISGYNGADEDEIMDNIFSRFAKEGLTPSGHKTGQKLLMKDEAKLAAGMILESAHKLKPHEVPSYLDGAFEAAWNHYD*
Ga0138259_151243013300012416Polar MarineKIIAITALLGFTSAVRLHDDSDPNGVNQPGAQTYADMTLSGHNGADEDEIMDNIFGRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLTPAEVPGYLDSNFETAWNHFD*
Ga0157630_106533913300012722FreshwaterQYSKLFALAALLGFTSAIRLQDNSDPEGRNVDKTTWADMHRSGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0138277_104188513300012751Freshwater LakeFVLAALLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0138277_112164413300012751Freshwater LakeSKLFALAALLGCTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0138281_104940213300012755Freshwater LakeSKLFVLAALFASTSAITVRDSSDPEGRNVATQTWRDMHISGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0138272_104467013300012756Freshwater LakeKMQFSKLFALAALLGCTSAIRIQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0138272_118164113300012756Freshwater LakeALLGCTSAIRIQDNSDPEGRNVDKTTWKNMHISGYNGADEDEIQDNIYSRFSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSDVPSFLEAHFEDAWNHFD*
Ga0138285_119187313300012758Freshwater LakeLFVLAALFASTSAITVRDSSDPEGRNVATQTWRDMHISGYNGADEDEIQDNIYSRYSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0138273_117374513300012760Freshwater LakeILNMQYSKLFVLAALFASASAITVRDNSDPEGRNVATQTWRDMHISGYNGADEDEIQDNIYSRYSKEGITPSGHKTGQKLLMKDDAKIASGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0138288_119697913300012761Freshwater LakeNMQYSKLFALAALLGFTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0138282_122701113300012766Freshwater LakeLNMQYSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIASGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Ga0138291_116847213300012770Freshwater LakeQYSKLFVLAALFASTSAITVRDSSDPEGRNVATQTWRDMHISGYNGADEDEIQDNIYSRYSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0138270_100423213300012771Freshwater LakeLNMQYSKLFVLAALFASASAITVRDNSDPEGRNVAKQTWRDMRISGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Ga0138270_100532213300012771Freshwater LakeLFALAALLGCTSAIRIQDNSDPEGRNVDKTTWKDMHISGYNGADEDEIQDNIYSRFSKEGITPSGHKTGQKLLMKDDAKIAAG*
Ga0138287_116421813300012772Freshwater LakeNMQYSKLFALAALLGCTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0138287_122441813300012772Freshwater LakeMQYSKLFVLAALFASTSAITVRDSSDPEGRNVATQTWRDMHISGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0138286_112413413300012781Freshwater LakeLNMQYSKLFVLAALFASTSAITVRDSSDPEGRNVATQTWRDMHISGYNGADEDEIQDNIYSRYSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Ga0163111_1242114713300012954Surface SeawaterMYSKFIAVVALLGSVSAVKLSVQDDSDPLGRNVDKTTWEDMHISGYNGADEDEIMDNIYGHYAKEGRTPSGHKTGQKLLMKDDAKIAAGTTLEAAHKLKPAEVPGYLDAHFEAAWDHFDQNHEGWIRYE
Ga0129337_146771123300012968AqueousVLSALIASAASIRLNDNSDPEGRNVDKTTWKDMHISGYNGADEDEIMDSIFSKYSREGRTPSNHKTGQKLLMKDEAKLAAGTILEAAHKLEPKDVPAFLEANFEKAWNNYD*
Ga0129338_116583013300012970AqueousLNMQYSKLFALAALLGFTSAIRLQDNSDPEGRNVDKTTWKNMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0164293_1036222323300013004FreshwaterMQYSKLFALAALLGFTSAIRLQDNSDPEGRNVDKTTWADMHRSGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS*
Ga0164294_1055337613300013006FreshwaterLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD*
Ga0164295_1055952713300013014FreshwaterMFKSLAAAALLGMASTHRVAVSDVSDVLGRNVDKYTHKDTHISGYNGADEDEIYDNVFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTALEAAHWLSPSEVPSYLDANFENAWNHYD*
Ga0182062_115343013300016751Salt MarshMNKFLVIAALLSAIEAVKISDNSDPNGKNVDGVETYKEQVLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLMKDDAKIAAGTILEAAHKMQPSAVPAYMDANFENAWNHFDQNKEGWIRYEESHTMQRYL
Ga0169931_1041490623300017788FreshwaterMQYSKLFALAALLGCTSAIKLHDNSDPEGRNVDKTTWRNMHISGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSDVPAYLDKHFENSWNHFD
Ga0188821_101840013300018607Freshwater LakeMQYSKLFALVALLGCTSAIRIQDNSDPEGRNVDKTTWKNMHISGYNGADEDEIQDNIYSRFSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSDVPSFLEAHFEDAWNHFD
Ga0188821_102643413300018607Freshwater LakeSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRNMHISGYNGADEDEIQDNIYSRYSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Ga0192944_103424813300018692MarineMKFTLAIAALLGAAVAIKLRDDSEPEGRNLDSARWQEMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKIASGTVLEAAHKLNPH
Ga0192967_103988313300018730MarineHGDIKLNNNIMQLSKIIAITALLGFTSAVRLHDDSDPNGVNVDGAETFADMTLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPA
Ga0193468_105604413300018746MarineAIAALLGAAVAIKLRDDSEPEGRNLDTARWQEMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLNPH
Ga0192949_109164613300018831MarineKFTLAIAALLGAAVAIKLRDDSEPEGRNLDSARWQEMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKIASGTVLEAAHKLNPH
Ga0193308_107549913300018862MarineAALLGAAVAIKLRDDSEPEGRNLDTARWQEMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKLAAGTVLEAAHKLNPH
Ga0193030_1020140213300018989MarineFDGAETHSDMHISGYNGADEDEIMDNIFSRFAKEGQTPSGHKTGQKLLMKDEAKIAAGMILESAHKLKPHEVPQYLDGAFEAAWNHYD
Ga0192951_1030777313300019022MarineDNSDPLGRNVDKTTWEDMKISGYNGADEDEIMDSIYARFSREGQTPSGHMTGQKLLMKDDAKLAAGTVLEAAHKLKPGEVPGFLAKNFEPSWNHFDQNHEGWIRYEETHVF
Ga0192869_1026462813300019032MarineMGPSKIIAISALLACTSAIRLKDDSDPNGKNFDGAQTYEDMTLSGHNGADEDEIMDNIYSRYSKEGRTPSGHKTGQKLLMKDDGKLAAGTVLEAAHFLKPDEVPGYLDSNFENAWNHFDQNHEGWIRYEETHTFQRYLNG
Ga0192869_1030493113300019032MarineMKFTVAIAALLGAAVAIKLRDDSEPEGRNLDTARWQEMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPH
Ga0192945_1016591523300019036MarineMGLSKIIAISALLACTSAIRLKDDSDPNGKNLDGAQTYEDMTLSGHNGADEDEIMDNIYSRYSKEGRTPSGHKTGQKLLMKDDGKLAAGTVLEAAHFLKPAEVPGYLDSNFENAWNHFDQNHEGWIRYEETHTFQRYLNG
Ga0192998_1020984013300019043MarineLAALFGVTEAIKIRDDSDKKGRNVDQTTWEDMHISGYNGADEDEIMDNVFSRFAKEGRTPSGHKTGQKLLMKDEAKLAAGTVLEAAHKLEPSSVPGFLDSNFENAWNHFDQNHEGWIRYEETHTFQRHLQG
Ga0192966_1012762213300019050MarineTWGIIKLNNNIMQLSKIIAITALLGFTSAVRLHDDSDPNGVNVDGAETFADMTLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPA
Ga0193249_108733113300019131MarineLKFAVMALLSVSAIRIQDDSNEEGRNVADAETWYEQKISGYNGADEDEIMDNIFSKFAKEGMTPSGHKTGQKLLMKDEAKLAAGTVLESAHKLKPSSVPAYLDSNFEKAWNHFD
Ga0211686_1011472613300020382MarineMQLSKIIAITALLGFTSAVRLHDDSDPNGVNVDGAETFADMTLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPA
Ga0206687_141302313300021169SeawaterLAALFAGADAIKIKDDSDKEGRNVDKTTWKEMHVSGYNGADEDEIMDNIYSRFSKEGRTPSGHKTGQKLLMKDEAKLAAGTVLESAHKLKPAEVPGYLE
Ga0206696_147335013300021334SeawaterYDVSGLRLSALDNSDPEGRNVDATTWKDMHISGYNGADEDEIMDNIYSRYSKEGRTPSGHRTGQKLLMKDDAKLAAGTVLEAAHKLTPGEVPGYLDANFEAAWNHFD
Ga0213867_125274313300021335SeawaterMQFSKIIALAALFGVADVSALRIRDNSDPEGRNVDKTTWKDMKISGYNGADEDEIMDNIFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLEPAAVPAYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQGALNK
Ga0206688_1013181913300021345SeawaterMRFVIALFIGLAASVKITDDSDSEGKNIDQTTWKDMHISGFNGADEDEIMDNIFSKYAKEGETPSGHKTGQKLLMKDDAKLASGTILEAAHKLVPSKVPGYLEANFENSWNHFD
Ga0206688_1014461913300021345SeawaterKIFNMQITKIVALFLGVTVAVNLKDSSDPEGGNVDKTTWKDMHISGYNGADEDEIMDNIFSKYSREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLEPSRVPGYLEANF
Ga0206693_140337213300021353SeawaterMYTKFIAVVALLGSVSAIKLSVQDDSDPLGRNVDKNTWEDMHISGYNGADEDEIMDNIYGHYAKEGRTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLKPAEVPGYLDAHFESAWDHFDQNHEGWVRYE
Ga0206689_1076919813300021359SeawaterNKFMAVAALLGSISAVKLRDDSDSLGRNVDHTTWEDMHISGYNGADEDEIMDNVYGHFAKEGRTPSGHKTGQKLLMKDDAKIAAGTTLEAAHKLKPSEVQSYLDANFE
Ga0063109_11055513300021866MarineMKFTVAIAALLGAVVAIRLGDDSESEGRNMDTARWQEMHISGYNGADEDEIMDNVFSKFSKEGLTPSGHKTGQKLLMKDDAKIAAGTILEAAHKLAPSAVPAYLDS
Ga0063102_110387713300021941MarineTMQFSKLGAIAALLGMTEAVRVTDNSDPLGRNVDRTTWTDMKISGYNGADEDEIMDNVYGRYSREGQTPSGHKTGQKLLMKDDAKLACGTVLEAAHKLQPQQVPAFLAKNFETAWNHFDQNHEGWIRYEETHVFQRFITG
Ga0222713_1035395613300021962Estuarine WaterMKFAVFAALIAGAYSIRLTDNSDPHGRNFPGAPTWEDMKISGYNGADEDEIMDSIFSRFSKEGRTPSGHKTGQKLLMKDDAKLAAGTILEAAHKLRPDQVPAYLSANFESAWDHFDQNHEGWIRYEETHVF
Ga0222713_1049469213300021962Estuarine WaterMVLAALLSATEAVRLSDNSDKLGRNTPDAPTWEDMKISGYNGADEDEIMDSIFSRYSKEGRTPSGHKTGQKLLMKDDGKLAAGTILEAAHKLKPADVPAYLSANFENAWDHFDQNHEGWIRYEETHTFQRYL
Ga0222713_1058610613300021962Estuarine WaterMKLLVLSALIASAASIRLNDNSDPEGRNVDKTTWKDMHISGYNGADEDEIMDSIFSKYSREGRTPSNHKTGQKLLMKDEAKLAAGTILEAAHKLEPKDVPAFLEANFEKAWNHYD
Ga0222719_1079843813300021964Estuarine WaterMKYTVFAALIAGAYSVRLSDNSDPHGRNFEGAPTWADMKISGYNGADEDEIMDSVFSRYSHEGKTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLTPAQVPAYLSANFESAWDHFDQNHEGWIRYEETHTFQRFLMGSLNK
Ga0255777_1061075413300023175Salt MarshVPWIIIILTNKMKFTIAVAALLGVAAALQISDNSEPEGRNTAGAETWYEQKISGYNGADEDEIMDNIYSKFSKEGQTPSGHKTGQKLLMKDDAKIAAGTVLEAAHKLNPSQVPAFLDANFEKAWSHYDQNNEGWIRYEETHTFQRYLNGALN
Ga0214923_1045268313300023179FreshwaterMQYSKLFVLAALFASASAITVRDNSDPEGRNVAKQTWRDMHISGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Ga0214919_1052101213300023184FreshwaterMQYSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Ga0228707_106214813300023700FreshwaterQYSKLFALAALLGCTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS
Ga0244775_1101681213300024346EstuarineMKLLVLSALIASVASIRLNDNSDPEGRNVDKTTWKDMHISGYNGADEDEIMDSIFSKYSREGRTPSNHKTGQKLLMKDEAKLAAGTILEAAHKLEPKDVPAFLEANFEKAWNHYD
Ga0208864_109472413300025578FreshwaterLAALLGCTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS
Ga0209198_120283713300025640Pelagic MarineMFKLFAVASIANLTNAVRLDDSSDPLGRNVDNSTHWDMHISGYNGADEDEIMDNIFSKFSKEGLTSTGHKTGQKLLMKDDAKLAAGQILEAAHFMKPADVPA
Ga0209306_117997413300025680Pelagic MarineMQFSKIIALAALFGMVDVNAVKISAMDNSDPEGRNVDKTTWKDMKISGYNGADEDEIMDNVFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLLPPAVPAYLDANFEKSWNHFDSKPDGWLDAARVAQFMRFLTGNNMIDLTLQIK
Ga0209425_1022447613300025897Pelagic MarineMGLSKIIAISALLAYTSAIRLKDDSDPNGKNFDGAQTYEDMTLSGHNGADEDEIMDNIYSRYSKEGRTPSGHKTGQKLLMKDDGKLAAGTVLEAAHFLKPAEVPGYLDSNFENAWNHFDQNHEGWIRYEETHTFQRYLNG
Ga0247588_106122813300026465SeawaterIFNMQITKIVALFLGVTSAIKLADDSNSEGKNIDETTWKDMKISGYNGADEDEIMDNIFSKYSREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLQPHAVPGYLEANFENTWNHFD
Ga0209551_125000313300027689Freshwater LakeNMQYSKLFVLAALLASTSAITVRDHSDPEGGNVDHTTWRDMHKSGYNGADEDEIQDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Ga0209087_116889913300027734Freshwater LakeMQYSKLFALAALLGCTSAIRLQDNSDPEGRNVDKTTWKDMHISGFNGADEDEIMDNIYSRYSKEGLTPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPS
Ga0209084_114553213300027749Freshwater LakeMQYSKLFVLAALFASTSAITVRDSSDPEGRNVATQTWRDMHISGYNGADEDEIQDNIYSRYSKEGITPSGHKTGQKLLMKDDAKIAAGTVLEAAHFLKPSEVPAYLEAHFEDSWNHFD
Ga0256412_122159213300028137SeawaterFNMQITKIVALFLGVTSAIKLADDSNSEGKNIDETTWKDMKISGYNGADEDEIMDNIFSKYSREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLQPHAVPGYLEANFENTWNHFD
Ga0256412_130130913300028137SeawaterITMAALAAAVRLEDDSDPQGRNVDTWTHHDQYISGYNGADEDEIMDNIFSKFSKEGITPSGHKTGQKLLMKDEAKLAAGMILESAHKLEPAQVPAFLDGRFEDAWNHYD
Ga0247566_104606913300028335SeawaterKIFNMQITKIVALFLGVTSAIKLADDSNSEGKNIDETTWKDMKISGYNGADEDEIMDNIFSKYSREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLQPHAVPGYLEANFENTWNHFD
Ga0304731_1094331613300028575MarineAVVALVGALKLRDDSNAMGQNFDGAETHSDMHISGYNGADEDEIMDNIFSRFAKEGLTPSGHKTGQKLLMKDEAKLAAGMILESAHKLKPHEVPSYLDGAFEAAWNHYD
Ga0304731_1124428423300028575MarineMALVGAIKVRDDSDPMGKNFDGAQTHSDMKISGYNGADEDEIMDNIFSRFSKEGMTPSGHKTGQKLLMKDEAKLAAGTVLESAHKLKPSQVPAYLDSNFEKAWNHFD
Ga0073968_1192235313300030756MarineAVMALVGAIKVRDDSDPMGKNFDGAQTHSDMKISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLLKDEAKIAAGMILEAAHKLQPHEVPAYLEGSFENAWNHYDQNHEGWIRYEETHTF
Ga0073988_1225686013300030780MarineIFNMQITKIVALFLGVTAAVKLTDDSDSKGRNVDKTTWEDMHISGYNGADEDEIMDNIFSKYSREGQTPSGHKTGQKLLMKDEAKLAAGTILEAAHKLQPSQVPGYLEANFENAWSHFD
Ga0073964_1153971313300030788MarineLAVMALVGAIKVRDDSDPMGKNFDGAQTHSDMKISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLLKDEAKIAAGMILEAAHKLQPHEVPAYLEGSFENAWNHYDQNHEGWIRYEETHTF
Ga0073964_1156796423300030788MarineALVGAIKVRDDSNPMGQNFDGAQTHTDMHISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLMKDEAKLAAGMILESAHKLQPHEVPAYLDKAFEDAWNHYD
Ga0073963_1151124413300030859MarineGAIKVRDDSNPMGQNFDGAQTHTDMHISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLMKDEAKLAAGMILESAHKLQPHEVPAYLDKAFEDAWNHYD
Ga0073972_1073400113300030865MarineVMALVGAIKVRDDSDPMGKNFDGAQTHSDMKISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLLKDEAKIAAGMILEAAHKLQPHEVPAYLEGSFENAWNHYDQNHEGWIRYEETHTF
Ga0073971_1123225913300030958MarineALVGAIKVRDDSDPMGKNFDGAQTHSDMKISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLLKDEAKIAAGMILEAAHKLQPHEVPAYLEGSFENAWNHYDQNHEGWIRYEETHT
Ga0073984_1114023213300031004MarineAVVALVGAIRVKDESDPMGKNFEGAELHTDMHISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLMKDEAKLAAGMILESAHKLSPHEVPAYLDGSFENAWNHYD
Ga0073984_1124281213300031004MarineYKLAVVALVGAIKVRDDSDPMGKNFDGAQTHTDMHISGYNGADEDEIMDNIFSRFSKEGLTPSGHKTGQKLLLKDEAKIAAGMILESAHKLQPHEVPAFLESNFESAWNHYD
Ga0307396_1035916113300031717MarineIMQLSKIIAITALLGFTSAVRLHDDSDPNGVNVDGAETFADMTLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPA
Ga0307397_1038931623300031734MarineSKIIAITALLGFTSAVRLHDDSDPNGVNVDGAETFADMTLSGHNGADEDEIMDNIFSRFSKEGRTPSGHKTGQKLLLKDDAKIAAGTILEAAHKLKPA
Ga0314694_1041851013300032751SeawaterGMTEAIKIKDNSDALGRNVDKTTWEDMKISGYNGADEDEIMDSIYSRYSREGQTPSGHKTGQKLLMKDDAKLASGTILEAAHKLKPGEVPGFLAKNFE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.