Basic Information | |
---|---|
Family ID | F069042 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 49 residues |
Representative Sequence | MKRIEEKFKRTVKYWRISYKQASGRDRLYIGLFALLILTYVWWVALTF |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 71.77 % |
% of genes near scaffold ends (potentially truncated) | 20.16 % |
% of genes from short scaffolds (< 2000 bps) | 79.03 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (63.710 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (14.516 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.194 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.290 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.89% β-sheet: 0.00% Coil/Unstructured: 42.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF02163 | Peptidase_M50 | 6.50 |
PF02577 | BFN_dom | 4.07 |
PF12681 | Glyoxalase_2 | 3.25 |
PF00589 | Phage_integrase | 2.44 |
PF00903 | Glyoxalase | 1.63 |
PF13808 | DDE_Tnp_1_assoc | 1.63 |
PF13437 | HlyD_3 | 1.63 |
PF02589 | LUD_dom | 1.63 |
PF01555 | N6_N4_Mtase | 0.81 |
PF07635 | PSCyt1 | 0.81 |
PF00772 | DnaB | 0.81 |
PF00395 | SLH | 0.81 |
PF00805 | Pentapeptide | 0.81 |
PF00248 | Aldo_ket_red | 0.81 |
PF01978 | TrmB | 0.81 |
PF03796 | DnaB_C | 0.81 |
PF01695 | IstB_IS21 | 0.81 |
PF13416 | SBP_bac_8 | 0.81 |
PF13649 | Methyltransf_25 | 0.81 |
PF06197 | DUF998 | 0.81 |
PF00171 | Aldedh | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 4.07 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.63 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.81 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.81 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.81 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.81 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.81 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.81 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.81 |
COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 63.71 % |
All Organisms | root | All Organisms | 36.29 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_100512199 | Not Available | 628 | Open in IMG/M |
3300000787|JGI11643J11755_11667855 | Not Available | 674 | Open in IMG/M |
3300000953|JGI11615J12901_11009528 | Not Available | 569 | Open in IMG/M |
3300000956|JGI10216J12902_104522205 | Not Available | 1177 | Open in IMG/M |
3300003203|JGI25406J46586_10020482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2674 | Open in IMG/M |
3300003203|JGI25406J46586_10252489 | Not Available | 518 | Open in IMG/M |
3300003267|soilL1_10017144 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
3300003319|soilL2_10067669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7238 | Open in IMG/M |
3300003319|soilL2_10127746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2823 | Open in IMG/M |
3300003319|soilL2_10298719 | Not Available | 1164 | Open in IMG/M |
3300003987|Ga0055471_10119943 | Not Available | 784 | Open in IMG/M |
3300003993|Ga0055468_10041770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1130 | Open in IMG/M |
3300003993|Ga0055468_10059610 | Not Available | 993 | Open in IMG/M |
3300003996|Ga0055467_10122154 | Not Available | 759 | Open in IMG/M |
3300003996|Ga0055467_10202209 | Not Available | 613 | Open in IMG/M |
3300003999|Ga0055469_10305318 | Not Available | 516 | Open in IMG/M |
3300004052|Ga0055490_10014843 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
3300004114|Ga0062593_101788426 | Not Available | 675 | Open in IMG/M |
3300004156|Ga0062589_100944694 | Not Available | 799 | Open in IMG/M |
3300004463|Ga0063356_100795712 | Not Available | 1318 | Open in IMG/M |
3300004480|Ga0062592_100994589 | Not Available | 766 | Open in IMG/M |
3300004778|Ga0062383_10097886 | Not Available | 1250 | Open in IMG/M |
3300004778|Ga0062383_10694894 | Not Available | 520 | Open in IMG/M |
3300005183|Ga0068993_10003994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2854 | Open in IMG/M |
3300005289|Ga0065704_10001166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 12405 | Open in IMG/M |
3300005289|Ga0065704_10193869 | Not Available | 1177 | Open in IMG/M |
3300005295|Ga0065707_10246632 | Not Available | 1138 | Open in IMG/M |
3300005343|Ga0070687_100372820 | Not Available | 928 | Open in IMG/M |
3300005438|Ga0070701_10778435 | Not Available | 651 | Open in IMG/M |
3300005445|Ga0070708_101868417 | Not Available | 557 | Open in IMG/M |
3300005467|Ga0070706_100924209 | Not Available | 806 | Open in IMG/M |
3300005545|Ga0070695_101761442 | Not Available | 519 | Open in IMG/M |
3300005546|Ga0070696_100888988 | Not Available | 738 | Open in IMG/M |
3300005549|Ga0070704_101459160 | Not Available | 628 | Open in IMG/M |
3300005615|Ga0070702_100494551 | Not Available | 897 | Open in IMG/M |
3300005617|Ga0068859_100141375 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
3300005874|Ga0075288_1006351 | All Organisms → cellular organisms → Bacteria | 1518 | Open in IMG/M |
3300006049|Ga0075417_10627512 | Not Available | 548 | Open in IMG/M |
3300006194|Ga0075427_10001541 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
3300006755|Ga0079222_11235015 | Not Available | 673 | Open in IMG/M |
3300006755|Ga0079222_11904603 | Not Available | 580 | Open in IMG/M |
3300006755|Ga0079222_12016914 | Not Available | 568 | Open in IMG/M |
3300006806|Ga0079220_10362441 | Not Available | 927 | Open in IMG/M |
3300006806|Ga0079220_11257418 | Not Available | 616 | Open in IMG/M |
3300006844|Ga0075428_100648946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1126 | Open in IMG/M |
3300006844|Ga0075428_102051814 | Not Available | 592 | Open in IMG/M |
3300006854|Ga0075425_102340366 | Not Available | 593 | Open in IMG/M |
3300006865|Ga0073934_10060764 | All Organisms → cellular organisms → Bacteria | 3165 | Open in IMG/M |
3300006880|Ga0075429_100054627 | All Organisms → cellular organisms → Bacteria | 3474 | Open in IMG/M |
3300006918|Ga0079216_10339682 | Not Available | 911 | Open in IMG/M |
3300006954|Ga0079219_10035235 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
3300006954|Ga0079219_10209261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1115 | Open in IMG/M |
3300006969|Ga0075419_10317803 | Not Available | 1053 | Open in IMG/M |
3300009037|Ga0105093_10442946 | Not Available | 715 | Open in IMG/M |
3300009087|Ga0105107_10483714 | Not Available | 862 | Open in IMG/M |
3300009094|Ga0111539_10891813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1034 | Open in IMG/M |
3300009095|Ga0079224_102416471 | Not Available | 749 | Open in IMG/M |
3300009100|Ga0075418_10767339 | Not Available | 1041 | Open in IMG/M |
3300009100|Ga0075418_11935511 | Not Available | 642 | Open in IMG/M |
3300009147|Ga0114129_10000734 | All Organisms → cellular organisms → Bacteria | 41734 | Open in IMG/M |
3300009147|Ga0114129_10043573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6313 | Open in IMG/M |
3300009147|Ga0114129_10164773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3026 | Open in IMG/M |
3300009147|Ga0114129_10176258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 2912 | Open in IMG/M |
3300009162|Ga0075423_10099421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermolimosa | 3043 | Open in IMG/M |
3300009162|Ga0075423_11201367 | Not Available | 809 | Open in IMG/M |
3300009168|Ga0105104_10035431 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
3300009506|Ga0118657_10015954 | All Organisms → cellular organisms → Bacteria | 11911 | Open in IMG/M |
3300009545|Ga0105237_11507711 | Not Available | 679 | Open in IMG/M |
3300009789|Ga0126307_10097189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2331 | Open in IMG/M |
3300009789|Ga0126307_11373112 | Not Available | 572 | Open in IMG/M |
3300009873|Ga0131077_10017007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 13118 | Open in IMG/M |
3300010038|Ga0126315_10125949 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300010038|Ga0126315_10138141 | Not Available | 1434 | Open in IMG/M |
3300010040|Ga0126308_10405223 | Not Available | 910 | Open in IMG/M |
3300010041|Ga0126312_10211174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 1357 | Open in IMG/M |
3300010041|Ga0126312_10218456 | Not Available | 1334 | Open in IMG/M |
3300010041|Ga0126312_10227924 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300010041|Ga0126312_10665877 | Not Available | 750 | Open in IMG/M |
3300010045|Ga0126311_11274772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 610 | Open in IMG/M |
3300010403|Ga0134123_10519374 | Not Available | 1125 | Open in IMG/M |
3300012201|Ga0137365_10098505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2200 | Open in IMG/M |
3300012204|Ga0137374_10018932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 7841 | Open in IMG/M |
3300012350|Ga0137372_10178414 | Not Available | 1715 | Open in IMG/M |
3300012353|Ga0137367_10027539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4397 | Open in IMG/M |
3300014317|Ga0075343_1165961 | Not Available | 555 | Open in IMG/M |
3300014745|Ga0157377_10560409 | Not Available | 809 | Open in IMG/M |
3300015371|Ga0132258_12990219 | Not Available | 1172 | Open in IMG/M |
3300018052|Ga0184638_1138153 | Not Available | 885 | Open in IMG/M |
3300018059|Ga0184615_10212608 | Not Available | 1087 | Open in IMG/M |
3300018075|Ga0184632_10220025 | Not Available | 834 | Open in IMG/M |
3300018075|Ga0184632_10301045 | Not Available | 694 | Open in IMG/M |
3300018084|Ga0184629_10404628 | Not Available | 717 | Open in IMG/M |
3300018469|Ga0190270_10520960 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300020003|Ga0193739_1048718 | Not Available | 1091 | Open in IMG/M |
3300024430|Ga0196962_10001184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 9022 | Open in IMG/M |
3300025160|Ga0209109_10288775 | Not Available | 786 | Open in IMG/M |
3300025160|Ga0209109_10370194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 672 | Open in IMG/M |
3300025551|Ga0210131_1039770 | Not Available | 741 | Open in IMG/M |
3300025918|Ga0207662_10409974 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
3300025935|Ga0207709_10370696 | Not Available | 1087 | Open in IMG/M |
3300025959|Ga0210116_1007614 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
3300025959|Ga0210116_1008296 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
3300026118|Ga0207675_100509799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1198 | Open in IMG/M |
3300026118|Ga0207675_102323107 | Not Available | 550 | Open in IMG/M |
3300027713|Ga0209286_1146437 | Not Available | 867 | Open in IMG/M |
3300027840|Ga0209683_10259389 | Not Available | 800 | Open in IMG/M |
3300027880|Ga0209481_10101972 | Not Available | 1387 | Open in IMG/M |
3300027886|Ga0209486_10613427 | Not Available | 691 | Open in IMG/M |
3300027886|Ga0209486_10613427 | Not Available | 691 | Open in IMG/M |
3300027909|Ga0209382_11083454 | Not Available | 829 | Open in IMG/M |
3300027979|Ga0209705_10114793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1459 | Open in IMG/M |
3300031058|Ga0308189_10521828 | Not Available | 514 | Open in IMG/M |
3300031228|Ga0299914_11529110 | Not Available | 519 | Open in IMG/M |
3300031824|Ga0307413_10728174 | Not Available | 827 | Open in IMG/M |
3300031858|Ga0310892_10683199 | Not Available | 703 | Open in IMG/M |
3300031901|Ga0307406_10767163 | Not Available | 811 | Open in IMG/M |
3300031949|Ga0214473_10043617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 5256 | Open in IMG/M |
3300031949|Ga0214473_10310959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1797 | Open in IMG/M |
3300031995|Ga0307409_101218974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 776 | Open in IMG/M |
3300032002|Ga0307416_101885532 | Not Available | 701 | Open in IMG/M |
3300032012|Ga0310902_10844621 | Not Available | 627 | Open in IMG/M |
3300033417|Ga0214471_10004233 | All Organisms → cellular organisms → Bacteria | 11083 | Open in IMG/M |
3300033486|Ga0316624_11721674 | Not Available | 579 | Open in IMG/M |
3300034128|Ga0370490_0214565 | Not Available | 633 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 14.52% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 8.87% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.06% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 8.06% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.65% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.03% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.03% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.23% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 3.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 3.23% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.23% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.61% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.61% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.61% |
Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.81% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 0.81% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.81% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1005121992 | 3300000559 | Soil | MKRIEEKFRRKVKYWRISYKQASGRDRLAIGMFLML |
JGI11643J11755_116678551 | 3300000787 | Soil | MKRIEEKFKRTVKYWRISYKQANGRDRLYLGLFGLMILVYAWWVALVS* |
JGI11615J12901_110095281 | 3300000953 | Soil | MKQIEEKFKRTVKYWRISYKQASGRDRLYIGLFSLLVLVYAWWITVVL* |
JGI10216J12902_1045222051 | 3300000956 | Soil | MKLGKGLQNMKRIEEKFKRKVKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIITLF* |
JGI25406J46586_100204822 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MKRIEDKFKRIVKYWSISYKQASGRDRLVIGMFLMLLAYEWWLILVF* |
JGI25406J46586_102524891 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MGKQSYAMKRFEEKFKRTVKYLRVAYKQASGRDRLYLGLFSLMVLVYAWWVFLVL* |
soilL1_100171445 | 3300003267 | Sugarcane Root And Bulk Soil | MKRIEEKFKRTVKYWRISYQQASMRDRVSIYLFASLLLAYVWWVTLSF* |
soilL2_100676694 | 3300003319 | Sugarcane Root And Bulk Soil | MKRIEEKFKRLVKYWSISYKQASGRDRLAIGMFLMLLAYEWWLILVF* |
soilL2_101277465 | 3300003319 | Sugarcane Root And Bulk Soil | MKRIEEKLKRKVKFWRVSYLQASERERLSMGMFAVLILVYMWWASVIF* |
soilL2_102987191 | 3300003319 | Sugarcane Root And Bulk Soil | MKQIEEKFKRKVKYLRVRYQQSTGRDRLYLGLYGLLVIIYAWWVMLVVY* |
Ga0055471_101199432 | 3300003987 | Natural And Restored Wetlands | MKRIEEKLKRKVKYWRISFMQASGRERLHLGLYSLVILVYAWWYLLTF* |
Ga0055468_100417703 | 3300003993 | Natural And Restored Wetlands | MKRIEEKLKRKVKYWRISFMQASGRERLHLGLFSILILVYAWWVFIVL* |
Ga0055468_100596101 | 3300003993 | Natural And Restored Wetlands | MKRIREKLNRTVKYWRVRYKQASGRDRLFMGMWSLVVLVYAWWVLLVL* |
Ga0055467_101221542 | 3300003996 | Natural And Restored Wetlands | MKRIEEKFKRTVKYWRISYKQASGRDRLYLGLFALMMLTYAWWLSLTF* |
Ga0055467_102022091 | 3300003996 | Natural And Restored Wetlands | IMEKGFYFMKRIEEKLKRKVKYWRTSYHQANGRERLLLGLYGMLILMYAWWYLLVL* |
Ga0055469_103053181 | 3300003999 | Natural And Restored Wetlands | MKRIEEKLKRKVKYWRTSYHQASGRERLLLGLYGMLILMYTWWYLLVL* |
Ga0055490_100148431 | 3300004052 | Natural And Restored Wetlands | MKRIEEKLKRKVKYWRISFLQASGRDRVSLGMFMILILVYMWWVSLIT* |
Ga0062593_1017884262 | 3300004114 | Soil | MGKVLYLMKRIEEKFKRTVKYWRISYKQANGRDRLYLGLFGLMILVYAWWVALVT* |
Ga0062589_1009446941 | 3300004156 | Soil | MKQIEEKFKRTVKYWRISYQQASGRDRLYMGLFSLLVLVYAWWIMVVL* |
Ga0063356_1007957121 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKRIEEKFKRKVKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIII* |
Ga0062592_1009945891 | 3300004480 | Soil | MKRIEEKFKRTVKYWRISYKQANGRDRLYLGLFGLMILVYAWW |
Ga0062383_100978863 | 3300004778 | Wetland Sediment | MKQMEEKFKRTMKYWRIRYKQASGRDRLYLGLFSLTVLVYAWWIMVVL* |
Ga0062383_106948941 | 3300004778 | Wetland Sediment | MKRIEEKLKRKVKYWRVSYLQASGRDRLSMGMFTMLMLIYMWWVILIH* |
Ga0068993_100039945 | 3300005183 | Natural And Restored Wetlands | MKQIEEKFKRTVKYWRITYKQASGRDRLALAMFGVLMAAYMWWVLLSF* |
Ga0065704_100011668 | 3300005289 | Switchgrass Rhizosphere | MKQIEEKFKRTVKYWRISYKQASGRDRLYVGLFSLLVLVYAWWIMVVL* |
Ga0065704_101938692 | 3300005289 | Switchgrass Rhizosphere | MKRIEEKLRRKVKYWRISYQQANGHDRLAIGLFALMMLAYVWWVALTF* |
Ga0065707_102466321 | 3300005295 | Switchgrass Rhizosphere | LRRKVKYWRISYQQANGHDRLAIGLFALMMLAYVWWVALTF* |
Ga0070687_1003728201 | 3300005343 | Switchgrass Rhizosphere | MKQMEEKVKRTVKYWRIRYKQTNGRDRLYIGLFALMILTYVWWFTLLN |
Ga0070701_107784353 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | HNMKRIEEKFKRKVKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIII* |
Ga0070708_1018684171 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQMEEKVKRTVKYWRVRYKQASGRDRLYIGLFALMILTYVWWFTLLNLAF* |
Ga0070706_1009242092 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQIEEKFKRTVKYWRICYKQASGRDRLYMGLFSLLVLVYAWWIMVVLY* |
Ga0070695_1017614421 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQMEEKVKRTVKYWRIRYKQTNGRDRLYIGLFALMILTYVWWFTLLNLAF* |
Ga0070696_1008889881 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQIEEKFKRTVKYWRISYKQASGRDRLYMGLFSLLVLVYAWWIMVVLY* |
Ga0070704_1014591601 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKQMEEKVKRTVKYWRVRYKQASGRDRLYIGLFALMILTYVWWFTLMNLAF* |
Ga0070702_1004945513 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | EIGKGFCFMKQMEEKVKRTVKYWRIRYKQTNGRDRLYIGLFALMILTYVWWFTLLNLAF* |
Ga0068859_1001413752 | 3300005617 | Switchgrass Rhizosphere | MKQMEEKVKRTVKYWRIRYKQTNGRDSLYIGLFALMILTYVWWFTLLNLAF* |
Ga0075288_10063512 | 3300005874 | Rice Paddy Soil | FMKQIEVKFKRTVKYWRIRYQQASGRDRLYLGLFSLTVLVYAWWIMVVL* |
Ga0075417_106275122 | 3300006049 | Populus Rhizosphere | MKQIEEKFKRTVKYWRISYKQASGRDRLYMGLFSLLVLVQRGGSW* |
Ga0075427_100015413 | 3300006194 | Populus Rhizosphere | MKRIEEKFKRIVKYWCISYKQASGRDRLAIGMFLMLLAYEWWLILVF* |
Ga0079222_112350151 | 3300006755 | Agricultural Soil | MKQIEEKFKRKVKYLRVRYQQSTGRDRLYLGLYGLLVIIYAWWVMVVVY* |
Ga0079222_119046031 | 3300006755 | Agricultural Soil | MKQMEEKVKRTVKYWRIRYKQTNGRDRLYIGLFALMILTYVWWFTLLNLA |
Ga0079222_120169142 | 3300006755 | Agricultural Soil | MVTMKQIEEKFRRKVKYWRVSYQQASGRERLYMGLYGLVILVYAWWYLLIS* |
Ga0079220_103624411 | 3300006806 | Agricultural Soil | CYRYETWEGLQNMKRIEEKFRRKVKYWRISLMQASGRDRMSLGMFMVLILIYMWWVSIIT |
Ga0079220_112574181 | 3300006806 | Agricultural Soil | MKQMEEKVKRTVKYWRIRYKQTNGRDRLYIGLFALIILTYVWWFTLMNLAF* |
Ga0075428_1006489461 | 3300006844 | Populus Rhizosphere | MKQIEEKFKRKVKFWRISYKQASGRDRLYLGLYSVLILVYTWWYFLVS* |
Ga0075428_1020518142 | 3300006844 | Populus Rhizosphere | MKRIEEKFKRKVKYWRISFMQASGRDRLSVGMFMVLILVYMWWVSIII* |
Ga0075425_1023403662 | 3300006854 | Populus Rhizosphere | MKQMEEKVKRTVKYWRVRYKQASGRDRLYIGLFALMILTYVWWFTLMNL |
Ga0073934_100607646 | 3300006865 | Hot Spring Sediment | MKRIEEKLKRKVKYWWISFYQASERERLYYGLYGLSILVFMWWYIFIV* |
Ga0075429_1000546274 | 3300006880 | Populus Rhizosphere | MKRIEEKFKRKVKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIIT* |
Ga0079216_103396821 | 3300006918 | Agricultural Soil | NFMKQIEEKLKRKMKYLRISYKQASGRDRLSLGLYSLLILVYLWWYFLVL* |
Ga0079219_100352352 | 3300006954 | Agricultural Soil | MKQMEEKVKRTVKYWRIRYKQTSGRDRLYIGLFALMILTYVWWFTLLNLAF* |
Ga0079219_102092612 | 3300006954 | Agricultural Soil | MTFELCYRYKTWEGLPNMKRIEEKFRRKVKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIIT* |
Ga0075419_103178031 | 3300006969 | Populus Rhizosphere | MKLGKGLPNMKRIEEKFKRKVKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIIT* |
Ga0105093_104429461 | 3300009037 | Freshwater Sediment | MKRIEEKFKRTVKYWRISYKQASGRDRLTLGLFGLVILVYAWWLILVF* |
Ga0105107_104837142 | 3300009087 | Freshwater Sediment | MKRIEEKLKRKIKFWRISYHQASGRDRLLLGLYSMLILMYAWWYILVL* |
Ga0111539_108918131 | 3300009094 | Populus Rhizosphere | MKRIEEKFKRTVKYWRISFKQASGRDRLYVGLFALLMLTYVWWVTLIF* |
Ga0079224_1024164711 | 3300009095 | Agricultural Soil | MGRVYHMKQRIEEKLKRKVKYWRISYQQASGRDRLYLGLYGLLILIYVWWVFIVL* |
Ga0075418_107673391 | 3300009100 | Populus Rhizosphere | MKRIEEKFKRKMKYWRVSYMQASGRDRLYFGLYGIMILVYAWWVFVIA* |
Ga0075418_119355112 | 3300009100 | Populus Rhizosphere | MKLGKGLQNMKRIEEKFKRKVKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIIT* |
Ga0114129_1000073432 | 3300009147 | Populus Rhizosphere | MKRIEEKFKRKVKYWRISFMQASGRDRLSLGMFMVLILVYMWWVSIII* |
Ga0114129_100435733 | 3300009147 | Populus Rhizosphere | MKRIEEKFKRTVKYWRISYKQASGRDRLYLGLFALLMLAYVWWVALTL* |
Ga0114129_101647731 | 3300009147 | Populus Rhizosphere | MKRIEEKLKRKVKFWRISLMQASGRDRMSLGMFMVLILVYMWWVSILT* |
Ga0114129_101762582 | 3300009147 | Populus Rhizosphere | MKQIEEKFKRTVKYWRISYKQASGRDRLYMGLFSLLVLVYAWWIMVILY* |
Ga0075423_100994212 | 3300009162 | Populus Rhizosphere | MKRIEEKFKRTVKYWRISYKQASGRDRLYIGLFALLILTYVWWVALTF* |
Ga0075423_112013671 | 3300009162 | Populus Rhizosphere | MKQMEEKVKRTVKYWRVRYKQASGRDRLYIGLFALMILTYVWWFT |
Ga0105104_100354313 | 3300009168 | Freshwater Sediment | MKQIEEKLKRTVKYWRISYRQANGRDRLYMGLFGSLVLVYAWWVILVF* |
Ga0118657_100159548 | 3300009506 | Mangrove Sediment | MKRIKEKFKRTVKYWHISYQQASGRDRMVLGMVVMMLLAYAWLAIQVF* |
Ga0105237_115077111 | 3300009545 | Corn Rhizosphere | MKQMEEKVKRTVKYLRIRYKQTNVRDRLYIGLFALMILTYVWWFTLLNLAF* |
Ga0126307_100971892 | 3300009789 | Serpentine Soil | MKQIEQKFKRKMKYWRVSYQQASGRDRLSMGLFSLLMLAYTWWVFLVF* |
Ga0126307_113731121 | 3300009789 | Serpentine Soil | MKRIEEKFKRKVKYWRISLMQASGRDRMSLGMFMALILVYMWWVSIIT* |
Ga0131077_100170073 | 3300009873 | Wastewater | MKQIKEKSKRIVKYWHVRYKQASERDRLSMGLFTVLILTYAWWVFLVLEHP* |
Ga0126315_101259492 | 3300010038 | Serpentine Soil | MKQIEEKFKRKVKYWRISYKQANGRDRLYMGLYSVVILVYMWWYFLIS* |
Ga0126315_101381412 | 3300010038 | Serpentine Soil | MKQIEEKFKRKVKYWRISYKQASERDRLYMGLYGVLILVYMWWYFLTF* |
Ga0126308_104052232 | 3300010040 | Serpentine Soil | MKPIKEIFRRKMKYWRVSYMQASGRDRLSIGMFALLMATYVWWVIVVL* |
Ga0126312_102111743 | 3300010041 | Serpentine Soil | MNYGKGDCLMKQIEEKFKRKVKYWRVSYQQASGRDRLTVGLFSLLMLAYAWWVFLVF* |
Ga0126312_102184562 | 3300010041 | Serpentine Soil | MKQIEEKFKRKVKYWRISYKQASGRDRLYMGLYSVLILVYIWWYLLIA* |
Ga0126312_102279243 | 3300010041 | Serpentine Soil | MKQIEEKFKRKVKYWRISYKQANGRDRLYMGLYSVLILVYMWWYFLNS* |
Ga0126312_106658771 | 3300010041 | Serpentine Soil | MKQIEEKFKRTVKYWRISYKQASGRDRLYMGLFSLLVLVYAWWVMVVLY* |
Ga0126311_112747722 | 3300010045 | Serpentine Soil | MKQIEEKFKRKVKYWRISYKQASERDRLCMGLYGVLILVYMWWYFLAF* |
Ga0134123_105193741 | 3300010403 | Terrestrial Soil | MKPIREKLKRTVKYWRVSYKQASGKDRLLMGMGALVVLVYAWWVTLVL* |
Ga0137365_100985053 | 3300012201 | Vadose Zone Soil | MKRIEEKFKRTVKYWRISYQQSSERDRLFIGMFTLMVLVYAWWIFVVL* |
Ga0137374_100189326 | 3300012204 | Vadose Zone Soil | MKQIEEKFKRTVKYWRISFKQASGRDRLSIYLFASLLLAYVWWVTLAF* |
Ga0137372_101784142 | 3300012350 | Vadose Zone Soil | MKRIEEKFKRTVKYWRISYQQSSERDRLFIGMFTLMVLVYAWWIMVVF* |
Ga0137367_100275395 | 3300012353 | Vadose Zone Soil | MKQIEEKLKRTVKYWRISYQQASGRDRLYVGLFSLLVLVYAWWIMVVL* |
Ga0075343_11659612 | 3300014317 | Natural And Restored Wetlands | MKRIEEKLKRKVKYWRISFLQASGRDRMSLGMFII |
Ga0157377_105604092 | 3300014745 | Miscanthus Rhizosphere | MKQIEEKVKRTVKYWRISYKQASGRDRLYLGLFGLLLLVYAWWIMVVLY* |
Ga0132258_129902193 | 3300015371 | Arabidopsis Rhizosphere | MKRIEQKLKRKVKYWRITYQQATGRDRLALGLFALMLLAYVWWISLTL* |
Ga0184638_11381532 | 3300018052 | Groundwater Sediment | MKQIKEKFKRTVKYWRISYRQANGRDRLSMGMFALLMLAYAWWVIMVF |
Ga0184615_102126081 | 3300018059 | Groundwater Sediment | MKRIEEKFKRKVKYWRVSLMQASGRDRMSLGMFMVLILVYMWWVSLIT |
Ga0184632_102200252 | 3300018075 | Groundwater Sediment | MKRIKEKFKRTVKYWRISYRQANGRDRLSMGMFALLMLAYAWWVILVF |
Ga0184632_103010452 | 3300018075 | Groundwater Sediment | MKRIEEKFKRTVKYWRIRYKQASGRDRLSLGMFALVMLVYTWWVMLVS |
Ga0184629_104046282 | 3300018084 | Groundwater Sediment | MKRIEEKFKRTVKYWRISFKQASGRERLSIGLFALMMLAYVWWVTLIY |
Ga0190270_105209602 | 3300018469 | Soil | EKFKRKVKFWRISLMQASGRDRLSLGMFMVVILVYMWWVSIIG |
Ga0193739_10487181 | 3300020003 | Soil | MKQIEEKLKRKMKYLRISYKQASGRDRLSLGLYSVLILIYVWWYFLVL |
Ga0196962_100011849 | 3300024430 | Soil | MKRIEEKLKRKVKFWRVSYLQASERERLSMGMFAVLILVYMWWVSSVF |
Ga0209109_102887752 | 3300025160 | Soil | MKQIEEKLKRKVKYWRISFHQASGRDRLLLGLYGLLILIYAWWYILVI |
Ga0209109_103701941 | 3300025160 | Soil | GSEFLRACSLIVEKGTYFMKQIEEKFKRKVKYWLISYKQASGRDRLSLGLYSLLILVYLWWYILVQ |
Ga0210131_10397702 | 3300025551 | Natural And Restored Wetlands | MKQIEEKFKRTVKYWRITYKQASGRDRLALAMFGVLMAAYMWWVLLSF |
Ga0207662_104099743 | 3300025918 | Switchgrass Rhizosphere | MKQMEEKVKRTVKYWRIRYKQTNGRDRLYIGLFALMILTYVWWFTLLNL |
Ga0207709_103706962 | 3300025935 | Miscanthus Rhizosphere | MKQMEEKVKRTVKYWRIRYKQTNGRDRLYIGLFALMILTYVWWFTLLNLAF |
Ga0210116_10076141 | 3300025959 | Natural And Restored Wetlands | MKRIEEKLKRKVKYWRISFLQASGRDRVSLGMFMILILVYMWWVSLIT |
Ga0210116_10082962 | 3300025959 | Natural And Restored Wetlands | MKRIEEKLKRKVKYWRISFLQASGRDRMSLGMFIILILVYMWWVSLIT |
Ga0207675_1005097991 | 3300026118 | Switchgrass Rhizosphere | MKQIEEKVKRTVKYWRISYKQASGRDRLYLGLFGLLVLVYSWWIMVVLY |
Ga0207675_1023231071 | 3300026118 | Switchgrass Rhizosphere | MKRIEEKFKRTVKYWRISYKQASGRDRLYLGLFALMMLTY |
Ga0209286_11464371 | 3300027713 | Freshwater Sediment | MKRIEEKFKRTVKYWRISYKQASGRDRLTLGLFGLVILVYAWWLILVF |
Ga0209683_102593891 | 3300027840 | Wetland Sediment | MKRIEEKLKRKVKYWRVSYLQASGRDRLSMGMFTMLMLIYMWWVILIH |
Ga0209481_101019722 | 3300027880 | Populus Rhizosphere | MKRIEEKFKRKVKYWRISFMQASGRDRLSVGMFMVLILVYMWWVSIII |
Ga0209486_106134271 | 3300027886 | Agricultural Soil | FMKRLREKVKRTAKYWRVSYKQASGNDRLYIGMFALAMLVYAWWVSLGL |
Ga0209486_106134272 | 3300027886 | Agricultural Soil | MKQIEEKLKRKMKYLRISYKQASGRDRLSLGLYSLLILVYLWWYFLVL |
Ga0209382_110834541 | 3300027909 | Populus Rhizosphere | MKRIEEKFKRKMKYWRVSYMQASGRDRLYFGLYGIMILVYAWWVFVIA |
Ga0209705_101147933 | 3300027979 | Freshwater Sediment | HFMKRIEEKFKRTVKYWRISYKQASGRDRLTLGLFGLVILVYAWWLILVF |
Ga0308189_105218281 | 3300031058 | Soil | FMKQIEEKFKRTVKYWRISYQQASGRDRLYMGLFSLLVLVYAWWIMVVL |
Ga0299914_115291101 | 3300031228 | Soil | MKQIEEKLKRKVKYWRISYKQASGRERLYLGLYSLLILVYAWWVFVVL |
Ga0307413_107281741 | 3300031824 | Rhizosphere | IEGGKRDYPMKQIEEKFKRKVKYWRTSYKQANGRERLHLGLYSLLILVYAWWYLLTF |
Ga0310892_106831991 | 3300031858 | Soil | MKRIEEKFKRKVKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIII |
Ga0307406_107671632 | 3300031901 | Rhizosphere | MKLGKGLQNMKRIEEKFKRKVKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIIT |
Ga0214473_100436173 | 3300031949 | Soil | MKRIEEKFKRKVKYWRISYQQASGRDRLYWGLFSLLILVYAWWLLLVF |
Ga0214473_103109592 | 3300031949 | Soil | MKPLKEKFKRIVKYWRVSYQQASGRDRLLIGIYMLMVLVYAWWVILII |
Ga0307409_1012189742 | 3300031995 | Rhizosphere | YGKGFLMKQIEEKLKRKVKYWRVSYHQASGRERLLLGLYGIVILMYTWWYLLVL |
Ga0307416_1018855322 | 3300032002 | Rhizosphere | MNYGKGFLMKQIEEKLKRKVKYWRVSYHQASGRERLLLGLYGIVILMYTWWYLLVL |
Ga0310902_108446211 | 3300032012 | Soil | VKYWRISLMQASGRDRMSLGMFMVLILVYMWWVSIII |
Ga0214471_100042334 | 3300033417 | Soil | MKRIEEKFNRTVKYWRIRYKQASGRDRLSLGMFALVMLVYTWWAMLVS |
Ga0316624_117216741 | 3300033486 | Soil | MRRIKEKLKRTVKYWRISYKQANERDRLLVGAFTLMMLAYVWWALLTF |
Ga0370490_0214565_477_632 | 3300034128 | Untreated Peat Soil | SYLMKRIEEKLKRKVKYWRTSYHQANGRERLLLGLYGMLILMYAWWYLLVL |
⦗Top⦘ |