Basic Information | |
---|---|
Family ID | F069092 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 47 residues |
Representative Sequence | MGYPPRAVTVEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 73.39 % |
% of genes near scaffold ends (potentially truncated) | 27.42 % |
% of genes from short scaffolds (< 2000 bps) | 74.19 % |
Associated GOLD sequencing projects | 68 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (52.419 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (47.581 % of family members) |
Environment Ontology (ENVO) | Unclassified (37.097 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF01740 | STAS | 4.03 |
PF12844 | HTH_19 | 2.42 |
PF13083 | KH_4 | 2.42 |
PF04545 | Sigma70_r4 | 1.61 |
PF00072 | Response_reg | 0.81 |
PF13783 | DUF4177 | 0.81 |
PF12680 | SnoaL_2 | 0.81 |
PF13545 | HTH_Crp_2 | 0.81 |
PF00027 | cNMP_binding | 0.81 |
PF03544 | TonB_C | 0.81 |
PF08818 | DUF1801 | 0.81 |
PF05199 | GMC_oxred_C | 0.81 |
PF08308 | PEGA | 0.81 |
PF12728 | HTH_17 | 0.81 |
PF03176 | MMPL | 0.81 |
PF00239 | Resolvase | 0.81 |
PF01381 | HTH_3 | 0.81 |
PF07589 | PEP-CTERM | 0.81 |
PF00082 | Peptidase_S8 | 0.81 |
PF12681 | Glyoxalase_2 | 0.81 |
PF13649 | Methyltransf_25 | 0.81 |
PF12704 | MacB_PCD | 0.81 |
PF08240 | ADH_N | 0.81 |
PF04073 | tRNA_edit | 0.81 |
PF07311 | Dodecin | 0.81 |
PF13577 | SnoaL_4 | 0.81 |
PF12867 | DinB_2 | 0.81 |
PF13495 | Phage_int_SAM_4 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.81 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.81 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.81 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.81 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.81 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.81 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.42 % |
Unclassified | root | N/A | 47.58 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001593|JGI12635J15846_10151264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1591 | Open in IMG/M |
3300001593|JGI12635J15846_10483972 | Not Available | 733 | Open in IMG/M |
3300001593|JGI12635J15846_10606273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101618404 | Not Available | 545 | Open in IMG/M |
3300002906|JGI25614J43888_10079177 | Not Available | 914 | Open in IMG/M |
3300002907|JGI25613J43889_10003662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4160 | Open in IMG/M |
3300002907|JGI25613J43889_10016687 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300002907|JGI25613J43889_10037963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1366 | Open in IMG/M |
3300002914|JGI25617J43924_10001409 | Not Available | 6203 | Open in IMG/M |
3300002917|JGI25616J43925_10008293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4519 | Open in IMG/M |
3300002917|JGI25616J43925_10024754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2661 | Open in IMG/M |
3300002917|JGI25616J43925_10161738 | Not Available | 888 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10399648 | Not Available | 558 | Open in IMG/M |
3300004080|Ga0062385_11183780 | Not Available | 522 | Open in IMG/M |
3300004092|Ga0062389_100635453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1235 | Open in IMG/M |
3300004092|Ga0062389_104424894 | Not Available | 529 | Open in IMG/M |
3300005434|Ga0070709_10176195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
3300005468|Ga0070707_100170326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2122 | Open in IMG/M |
3300006041|Ga0075023_100360046 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
3300006102|Ga0075015_100895732 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300006176|Ga0070765_100467871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1182 | Open in IMG/M |
3300007255|Ga0099791_10144592 | Not Available | 1109 | Open in IMG/M |
3300007255|Ga0099791_10273241 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300007255|Ga0099791_10390287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300007258|Ga0099793_10048959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1857 | Open in IMG/M |
3300007258|Ga0099793_10450241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300007265|Ga0099794_10013620 | All Organisms → cellular organisms → Bacteria | 3544 | Open in IMG/M |
3300007265|Ga0099794_10107512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
3300007265|Ga0099794_10364614 | Not Available | 752 | Open in IMG/M |
3300007788|Ga0099795_10103588 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300007788|Ga0099795_10486004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
3300009088|Ga0099830_10020539 | All Organisms → cellular organisms → Bacteria | 4291 | Open in IMG/M |
3300009088|Ga0099830_10221033 | All Organisms → cellular organisms → Bacteria | 1489 | Open in IMG/M |
3300009088|Ga0099830_10321108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1240 | Open in IMG/M |
3300009088|Ga0099830_11860059 | Not Available | 503 | Open in IMG/M |
3300009089|Ga0099828_10670932 | Not Available | 931 | Open in IMG/M |
3300009089|Ga0099828_11575203 | Not Available | 579 | Open in IMG/M |
3300009090|Ga0099827_11119239 | Not Available | 684 | Open in IMG/M |
3300009090|Ga0099827_11128573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
3300009143|Ga0099792_10311869 | Not Available | 937 | Open in IMG/M |
3300010159|Ga0099796_10198895 | Not Available | 812 | Open in IMG/M |
3300011120|Ga0150983_14866777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
3300011269|Ga0137392_10118553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2108 | Open in IMG/M |
3300011269|Ga0137392_10639404 | Not Available | 882 | Open in IMG/M |
3300011270|Ga0137391_10874785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300011271|Ga0137393_10178551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1784 | Open in IMG/M |
3300012096|Ga0137389_10200229 | Not Available | 1662 | Open in IMG/M |
3300012096|Ga0137389_10624380 | Not Available | 926 | Open in IMG/M |
3300012096|Ga0137389_10876925 | Not Available | 770 | Open in IMG/M |
3300012189|Ga0137388_10044515 | All Organisms → cellular organisms → Bacteria | 3560 | Open in IMG/M |
3300012189|Ga0137388_11057527 | Not Available | 748 | Open in IMG/M |
3300012202|Ga0137363_10074369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2511 | Open in IMG/M |
3300012202|Ga0137363_10249550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1442 | Open in IMG/M |
3300012202|Ga0137363_11393272 | Not Available | 591 | Open in IMG/M |
3300012203|Ga0137399_10582516 | Not Available | 940 | Open in IMG/M |
3300012203|Ga0137399_11172448 | Not Available | 647 | Open in IMG/M |
3300012205|Ga0137362_10777489 | Not Available | 821 | Open in IMG/M |
3300012361|Ga0137360_10810403 | Not Available | 806 | Open in IMG/M |
3300012361|Ga0137360_11609097 | Not Available | 555 | Open in IMG/M |
3300012685|Ga0137397_10416306 | Not Available | 1001 | Open in IMG/M |
3300012918|Ga0137396_10433905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
3300012918|Ga0137396_10915543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
3300012923|Ga0137359_10760916 | Not Available | 841 | Open in IMG/M |
3300012923|Ga0137359_11098020 | Not Available | 681 | Open in IMG/M |
3300012925|Ga0137419_11174193 | Not Available | 642 | Open in IMG/M |
3300012927|Ga0137416_10058199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2746 | Open in IMG/M |
3300012927|Ga0137416_10301341 | Not Available | 1328 | Open in IMG/M |
3300012927|Ga0137416_10984873 | Not Available | 753 | Open in IMG/M |
3300012930|Ga0137407_11733785 | Not Available | 595 | Open in IMG/M |
3300020199|Ga0179592_10298652 | Not Available | 716 | Open in IMG/M |
3300020579|Ga0210407_10194914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1573 | Open in IMG/M |
3300020580|Ga0210403_10377787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
3300020583|Ga0210401_10149538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2183 | Open in IMG/M |
3300021088|Ga0210404_10000117 | All Organisms → cellular organisms → Bacteria | 53863 | Open in IMG/M |
3300021170|Ga0210400_10041500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3571 | Open in IMG/M |
3300021180|Ga0210396_10578544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
3300021559|Ga0210409_10910193 | Not Available | 753 | Open in IMG/M |
3300022726|Ga0242654_10284111 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300024227|Ga0228598_1026626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1137 | Open in IMG/M |
3300024330|Ga0137417_1004802 | Not Available | 818 | Open in IMG/M |
3300025922|Ga0207646_11145103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
3300026304|Ga0209240_1004466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5272 | Open in IMG/M |
3300026304|Ga0209240_1011881 | All Organisms → cellular organisms → Bacteria | 3309 | Open in IMG/M |
3300026304|Ga0209240_1030771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2049 | Open in IMG/M |
3300026304|Ga0209240_1113899 | Not Available | 940 | Open in IMG/M |
3300026319|Ga0209647_1050107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2253 | Open in IMG/M |
3300026320|Ga0209131_1007125 | Not Available | 7099 | Open in IMG/M |
3300026482|Ga0257172_1001099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3113 | Open in IMG/M |
3300026514|Ga0257168_1031349 | Not Available | 1136 | Open in IMG/M |
3300026557|Ga0179587_10077273 | Not Available | 1972 | Open in IMG/M |
3300027591|Ga0209733_1009653 | Not Available | 2527 | Open in IMG/M |
3300027591|Ga0209733_1012390 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
3300027603|Ga0209331_1071754 | Not Available | 864 | Open in IMG/M |
3300027629|Ga0209422_1046679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
3300027645|Ga0209117_1001105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9818 | Open in IMG/M |
3300027655|Ga0209388_1079201 | Not Available | 946 | Open in IMG/M |
3300027660|Ga0209736_1103973 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300027671|Ga0209588_1027510 | Not Available | 1809 | Open in IMG/M |
3300027698|Ga0209446_1008557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2508 | Open in IMG/M |
3300027698|Ga0209446_1023481 | All Organisms → cellular organisms → Bacteria | 1537 | Open in IMG/M |
3300027783|Ga0209448_10012721 | Not Available | 2713 | Open in IMG/M |
3300027862|Ga0209701_10122298 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
3300027862|Ga0209701_10161555 | Not Available | 1360 | Open in IMG/M |
3300027862|Ga0209701_10512459 | Not Available | 650 | Open in IMG/M |
3300027875|Ga0209283_10329765 | Not Available | 1004 | Open in IMG/M |
3300027882|Ga0209590_10881473 | Not Available | 564 | Open in IMG/M |
3300027903|Ga0209488_11180953 | Not Available | 517 | Open in IMG/M |
3300027910|Ga0209583_10041942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1574 | Open in IMG/M |
3300028536|Ga0137415_10087708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2968 | Open in IMG/M |
3300030991|Ga0073994_12250838 | Not Available | 1272 | Open in IMG/M |
3300031231|Ga0170824_102798891 | Not Available | 544 | Open in IMG/M |
3300031474|Ga0170818_105790582 | Not Available | 503 | Open in IMG/M |
3300031708|Ga0310686_106400688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3372 | Open in IMG/M |
3300031708|Ga0310686_107051305 | Not Available | 1035 | Open in IMG/M |
3300031708|Ga0310686_112136256 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300031708|Ga0310686_113333654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2749 | Open in IMG/M |
3300031708|Ga0310686_115696083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5902 | Open in IMG/M |
3300031753|Ga0307477_10001749 | All Organisms → cellular organisms → Bacteria | 17613 | Open in IMG/M |
3300031820|Ga0307473_11063420 | Not Available | 594 | Open in IMG/M |
3300031962|Ga0307479_10181690 | All Organisms → cellular organisms → Bacteria | 2069 | Open in IMG/M |
3300032119|Ga0316051_1020974 | Not Available | 599 | Open in IMG/M |
3300032174|Ga0307470_10211423 | Not Available | 1249 | Open in IMG/M |
3300032180|Ga0307471_102942368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
3300032515|Ga0348332_10462192 | Not Available | 584 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 47.58% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.29% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.87% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.84% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.03% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.42% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12635J15846_101512643 | 3300001593 | Forest Soil | MGYPPRAVTVEQKILAALARIESKLDDTERRVKAVQQDLNRVKRIVRG* |
JGI12635J15846_104839722 | 3300001593 | Forest Soil | MGNPSSAVTAEQKILASLARIERKLDDTERRVKAVQQDLNRVKRIVRG* |
JGI12635J15846_106062731 | 3300001593 | Forest Soil | GEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
JGIcombinedJ26739_1016184041 | 3300002245 | Forest Soil | MGSPPPATTNEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
JGI25614J43888_100791773 | 3300002906 | Grasslands Soil | IPAKSNTVEQKILAALIRIESKLDDTERRVKAVQQDVNRVKRIVRG* |
JGI25613J43889_100036622 | 3300002907 | Grasslands Soil | MGNPSSAMTAEQKILATLARIERKLDDMERRVKAVQQDLNRVKRIVRG* |
JGI25613J43889_100166873 | 3300002907 | Grasslands Soil | MAYPPRAMTVEQKILAALVRIESKLDDTERRVKAVQQDVNRVKRIVRG* |
JGI25613J43889_100379632 | 3300002907 | Grasslands Soil | MGYPPRAVTVEQKILATLARIESKLDDTERRVKAVQQDLNRVKRIVRG* |
JGI25617J43924_100014096 | 3300002914 | Grasslands Soil | MPSNAMTAEQKILATLARIERKVDDMERRVKAVQQDLNRVKRIVRG* |
JGI25616J43925_100082934 | 3300002917 | Grasslands Soil | MASPRPAMTNEQKILAALVRIESKLDDTERRVKAVQQDVNRVKRIVRG* |
JGI25616J43925_100247542 | 3300002917 | Grasslands Soil | MGNPSNAMTVEQKILAALVRIESKLDDTERRVKAVQQDVNRVKRIVRG* |
JGI25616J43925_101617382 | 3300002917 | Grasslands Soil | MGSPTPATTNEQKILAALARIESKLDDTERRVKAVQQDLNRVKRIVRG* |
JGIcombinedJ51221_103996481 | 3300003505 | Forest Soil | MERLPTAVTVEQKILAALGRIESKLDDTERRVKAVQQDLNRVKRIVRG* |
Ga0062385_111837802 | 3300004080 | Bog Forest Soil | MASPRPAMTNEQKILAALARIESKVDDTERRVKAVQQDVNRVKRIVRG |
Ga0062389_1006354534 | 3300004092 | Bog Forest Soil | MGYPLSVSTVEQKILAALARIESKLDDTERRVKAIQQDVNRVKRIVRG* |
Ga0062389_1044248941 | 3300004092 | Bog Forest Soil | MASPRPAMTNEQKILAALARIESKVDDTERRVKAVQQDVNRVKRIVRG* |
Ga0070709_101761953 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MERSATPTTVEQKILAAVARIERKVDDVERRVKATQQDLNRVKRIVRG* |
Ga0070707_1001703265 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAEQKILAVLARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0075023_1003600461 | 3300006041 | Watersheds | MASPRPAMTNEQKILAALTRIESKLDDTERRVKAVQQDLNRVKRIVRG* |
Ga0075015_1008957323 | 3300006102 | Watersheds | MASPRPAMTNEQKILAALTRIESKLDDTERRVKAVQQ |
Ga0070765_1004678711 | 3300006176 | Soil | MGYPSSATVEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0099791_101445921 | 3300007255 | Vadose Zone Soil | MASPRPAMTNEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0099791_102732412 | 3300007255 | Vadose Zone Soil | MASNALTAEQKILATLARIERKVDDIERRVKAVQQDLNRVKRIVRG* |
Ga0099791_103902872 | 3300007255 | Vadose Zone Soil | MAYPPRAMTVEQKILAALVRIESKLDDTERRVKAVQQDVN |
Ga0099793_100489592 | 3300007258 | Vadose Zone Soil | MGNPSNAMTAEQKILAALARIERKLDDMERRVKAVQQDLNRVKRIVRG* |
Ga0099793_104502412 | 3300007258 | Vadose Zone Soil | MAYPPRAMTVEQKILAALVRIESKLDDTERRVKAVQQDVNR |
Ga0099794_100136202 | 3300007265 | Vadose Zone Soil | MGSPPRATTVEQKILAALVRIESKLDDTERRVKAIQQDVNRVKRIVRG* |
Ga0099794_101075123 | 3300007265 | Vadose Zone Soil | MTAEQKILAALARIERKLDDMERRVKAVQQDVNRVKRIVRG* |
Ga0099794_103646143 | 3300007265 | Vadose Zone Soil | MASNALTAEQKILAALARIERKVDDIERRVKAVQQDLNRVKRIVRG* |
Ga0099795_101035883 | 3300007788 | Vadose Zone Soil | MGNPSSAMTAEQKILGALARIERKLDDMERRVKAVQQDLNRVKRIVRG* |
Ga0099795_104860041 | 3300007788 | Vadose Zone Soil | NALTAEQKILATLARIERKVDDIERRVKAVQQDLNRVKRIVRG* |
Ga0099830_100205392 | 3300009088 | Vadose Zone Soil | MGYPPRAITVEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0099830_102210331 | 3300009088 | Vadose Zone Soil | KILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0099830_103211082 | 3300009088 | Vadose Zone Soil | MASPRPAMTNEQNILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0099830_118600591 | 3300009088 | Vadose Zone Soil | MTVEQKILAALARIERRLDDMERRVKAVQQDVNRVKRI |
Ga0099828_106709323 | 3300009089 | Vadose Zone Soil | MAYPPSAMTIEQKILAALARVERKLDDMERRVKAVQQDVNRVKRIVRG* |
Ga0099828_115752032 | 3300009089 | Vadose Zone Soil | MTDEQNILAALARIERKLDDIERKVRAVAQDTAQVRRAVKA* |
Ga0099827_111192391 | 3300009090 | Vadose Zone Soil | MGYPPSAMTSEQRILAALSRIESKLDDIERRLKAVEQDVHRVKTAVRS* |
Ga0099827_111285732 | 3300009090 | Vadose Zone Soil | TNEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0099792_103118692 | 3300009143 | Vadose Zone Soil | MGNPSSAMSAEQKILGALARIERKLDDMERRVKAVQQDLNRVKRIVRG* |
Ga0099796_101988952 | 3300010159 | Vadose Zone Soil | MMRPEDKRMGSPPRATTVEQKILAALVRIESKLDDTERRVKAIQQDVNRVKRIVRG* |
Ga0150983_148667772 | 3300011120 | Forest Soil | MERSATPTTVEQKLLAAVARIERKVDDVERRVKATQQDLNRVKRIVRG* |
Ga0137392_101185531 | 3300011269 | Vadose Zone Soil | KSMAYPPSAMTVEQKILAALARIERKLDDMERRVKAVQQDLNRVKRIVRG* |
Ga0137392_106394042 | 3300011269 | Vadose Zone Soil | MTAEQKILAALARIERKLDDMERRVKAVQQDVNRVKRIVR |
Ga0137391_108747851 | 3300011270 | Vadose Zone Soil | NRMASPRPAMTNEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0137393_101785512 | 3300011271 | Vadose Zone Soil | MGYPPSAMTAEQKILAALARIERQLDDIERRLKAVEQDAARVRRKVQA* |
Ga0137389_102002293 | 3300012096 | Vadose Zone Soil | MGYPPSALTVEQKILASLSRIEHKLDDIERLLTAAEQDVNRV |
Ga0137389_106243802 | 3300012096 | Vadose Zone Soil | MPSNAMTAEQKILAALARIERKVDDIERRVKAVQQDLNRVKRIVRG* |
Ga0137389_108769252 | 3300012096 | Vadose Zone Soil | MASPSSAMTNEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0137388_100445153 | 3300012189 | Vadose Zone Soil | MGYPPRAITVEQKILAALVRIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0137388_110575271 | 3300012189 | Vadose Zone Soil | MTAEQKILAALARIERKLDDIERRVKAVEQDAARVRRAVKG* |
Ga0137363_100743691 | 3300012202 | Vadose Zone Soil | MANPRPAMTNEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0137363_102495504 | 3300012202 | Vadose Zone Soil | MTAEQKILAALARIESKLDDIERRVKAVEQDAARVRRAVKG* |
Ga0137363_113932722 | 3300012202 | Vadose Zone Soil | PSAMTAEQKILAALARIERQLDDIERRLKAVEQDAARVRRKVQA* |
Ga0137399_105825161 | 3300012203 | Vadose Zone Soil | RPEDKRMGSPPRATTVEQKILAALVRIESKLDDTERRVKAIQQDVNRVKRIVRG* |
Ga0137399_111724481 | 3300012203 | Vadose Zone Soil | SAMTAEQKILGALARIERKLDDMERRVKAVQQDLNRVKRIVRG* |
Ga0137362_107774891 | 3300012205 | Vadose Zone Soil | LAALARIERKLDDIERRVKAVEQDAARVRRAVKG* |
Ga0137360_108104031 | 3300012361 | Vadose Zone Soil | ILAALIRIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0137360_116090971 | 3300012361 | Vadose Zone Soil | PSSAMTAEQKILGALARIERKLDDMERRVKAVQQDLNRVKRIVRG* |
Ga0137397_104163061 | 3300012685 | Vadose Zone Soil | MGYPPRAITVEQKILAALARIESKLDDTERRVKAVQQDLNRVKRIVRG* |
Ga0137396_104339052 | 3300012918 | Vadose Zone Soil | MTVEQKILAALARIERKLDDMERRVKAVQQDVNRVKRIVRG* |
Ga0137396_109155433 | 3300012918 | Vadose Zone Soil | MGYPPRAVTVEQKILATLARIESKLDDTERRVKAVQQDVNRVKRI |
Ga0137359_107609161 | 3300012923 | Vadose Zone Soil | MGYPPRAMTVEQKILAALIRIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0137359_110980202 | 3300012923 | Vadose Zone Soil | MTAEQKILAALARIERQLDDIERRLKAVEQDAARVRRKVQA* |
Ga0137419_111741931 | 3300012925 | Vadose Zone Soil | MANPSSAMTAEQKILAALARIERKLDDMERRVKAVQQDLNRVKRIVRG* |
Ga0137416_100581994 | 3300012927 | Vadose Zone Soil | MFLQRVARMIRPEEQTNGIPAKSNTVEQKILAALIRIESKLDDTERRVKAVQQDVNRVKRIVRG* |
Ga0137416_103013412 | 3300012927 | Vadose Zone Soil | MASNALTAEQKILAALARIERKVDDIERRVKAVQKDLNRVKRIVRG* |
Ga0137416_109848731 | 3300012927 | Vadose Zone Soil | TPTTTNEQKILAALARIESKLDDTERRVKAVQQDLNRVKRIVRG* |
Ga0137407_117337851 | 3300012930 | Vadose Zone Soil | RSPTPLSTEQKILASLTRIERTLVQMERRVKAVQQDLNRVKRIVRG* |
Ga0179592_102986522 | 3300020199 | Vadose Zone Soil | SKYRRMMRPEDKRMGSPPRATTVEQKILAALVRIESKLDDTERRVKAIQQDVNRVKRIVR |
Ga0210407_101949142 | 3300020579 | Soil | MERSAIAATVEQKILAALARIESKLEDTERRVKAIQQDLNRVKRIVRG |
Ga0210403_103777872 | 3300020580 | Soil | MGYPPRAVTVEQKILAALARIESKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0210401_101495383 | 3300020583 | Soil | MGYPLSVSTVEQKILAALARIESKLDDTERRVKAIQQDVNRVKRIVRG |
Ga0210404_1000011749 | 3300021088 | Soil | MASPRPAMTNEQKILAALARIESKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0210400_100415004 | 3300021170 | Soil | MGSPTPATTNEQKILAALARIESKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0210396_105785442 | 3300021180 | Soil | MGYPSSATVEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0210409_109101932 | 3300021559 | Soil | MERLPTAVTVEQKILAALGRIESKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0242654_102841112 | 3300022726 | Soil | MGYPPRAVTVEQKFLAALARIESKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0228598_10266261 | 3300024227 | Rhizosphere | MVNSPSAMTSEQKILAALARIERKLDDMGRRVKAVQQDVNRVERIVR |
Ga0137417_10048023 | 3300024330 | Vadose Zone Soil | MASNALTAEQKILAALARIERKVDDIERRVKAVQQDLNRVKRIVRG |
Ga0207646_111451031 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNPSNAMTAEQKILAVLARIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0209240_10044665 | 3300026304 | Grasslands Soil | MGNPSSAMTAEQKILATLARIERKLDDMERRVKAVQQDLNRVKRIVRG |
Ga0209240_10118813 | 3300026304 | Grasslands Soil | MAYPPRAMTVEQKILAALVRIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0209240_10307714 | 3300026304 | Grasslands Soil | MGNPSSAMTAEQKILGALARIERKLDDMERRVKAVQQDLNRVKRIVRG |
Ga0209240_11138991 | 3300026304 | Grasslands Soil | MGNPSNAMTVEQKILAALVRIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0209647_10501072 | 3300026319 | Grasslands Soil | MIRPEEQTNGIPAKSNTVEQKILAALIRIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0209131_10071257 | 3300026320 | Grasslands Soil | MGYPPRAVTVEQKILATLARIESKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0257172_10010991 | 3300026482 | Soil | MGNPSNAMTAEQKILAALARIERKLDDMERRVKAVQQDLNRVKRIVRG |
Ga0257168_10313492 | 3300026514 | Soil | MERLPIAVTVEQKILAALARIESKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0179587_100772731 | 3300026557 | Vadose Zone Soil | PSKYRRMMRPEDKRMGSPPRATTVEQKILAALVRIESKLDDTERRVKAIQQDVNRVKRIVRG |
Ga0209733_10096533 | 3300027591 | Forest Soil | MAYPPRATTVEQKILAALVRIESKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0209733_10123901 | 3300027591 | Forest Soil | MGYPPRAVTVEQKILAALARIERKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0209331_10717543 | 3300027603 | Forest Soil | MGNPSNATTAEQKILAALARIERKVDDIERRVKAVQQDLNRVKRIVRG |
Ga0209422_10466792 | 3300027629 | Forest Soil | MAYPPRATTVEQKILAALVRIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0209117_10011054 | 3300027645 | Forest Soil | MASPRPAMTNEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0209388_10792013 | 3300027655 | Vadose Zone Soil | MASPRPAMTNEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVR |
Ga0209736_11039732 | 3300027660 | Forest Soil | MGYPPRAVTVEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0209588_10275101 | 3300027671 | Vadose Zone Soil | TVEQKILAALVRIESKLDDTERRVKAIQQDVNRVKRIVRG |
Ga0209446_10085573 | 3300027698 | Bog Forest Soil | MTVEQKILAALTRIERKVDDMERRVKAVQQDLNRVKRIVRG |
Ga0209446_10234814 | 3300027698 | Bog Forest Soil | DWRGKSMANPPSAMTDEQKILAALTRIERKVDDVERRVKAVQQDLNRVKRIVRG |
Ga0209448_100127217 | 3300027783 | Bog Forest Soil | RNRRMVNSPSSMTSEQKILAALVRIERKLDDMGRRVKAVQQDVNRVKRIVRG |
Ga0209701_101222983 | 3300027862 | Vadose Zone Soil | MGYPPRAITVEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0209701_101615553 | 3300027862 | Vadose Zone Soil | MAYPPSAMTVEQKILAALARIERKLDDMERRVKAVQQDLNRVKRIVRG |
Ga0209701_105124592 | 3300027862 | Vadose Zone Soil | MTAEQKILAALARIERKLDDMERRVKAVQQDVNRVKRIVRG |
Ga0209283_103297652 | 3300027875 | Vadose Zone Soil | MAYPPSAMTIEQKILAALARVERKLDDMERRVKAVQQDVNRVKRIVRG |
Ga0209590_108814731 | 3300027882 | Vadose Zone Soil | MGYPPSAMTSEQRILAALSRIESKLDDIERRLKAVEQDVHRVKTAVRS |
Ga0209488_111809532 | 3300027903 | Vadose Zone Soil | MGYPPSAMTAEQKILAALARIERKLDDIERRVKAVEQDAARVRRAVKG |
Ga0209583_100419421 | 3300027910 | Watersheds | ACLYAGWKSKRMGYPSSALTVEQKILAALARIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0137415_100877084 | 3300028536 | Vadose Zone Soil | MFLQRVARMIRPEEQTNGIPAKSNTVEQKILAALIRIESKLDDTERRVKAVQQDVNRVKRIVRG |
Ga0073994_122508382 | 3300030991 | Soil | MGYPPRAITVEQKILAALARIESKLDDTERRVKAVQQDLNRVKRIVRG |
Ga0170824_1027988912 | 3300031231 | Forest Soil | MVYSPSAMTSEQKILAALVRIERKLDDMARRVKAVQQDVNRVKRIVRG |
Ga0170818_1057905821 | 3300031474 | Forest Soil | MTSEQKILAALVRIERKLDDMARRVKAVQQDVNRVKRIVRG |
Ga0310686_1064006885 | 3300031708 | Soil | MVNSPSSMTSEQKILAALARIERKVDDMERRVKAVQQDLNRVKRIVRG |
Ga0310686_1070513051 | 3300031708 | Soil | MTSEQKILAALVRIERKVDDMERRVKAVQQDVNRVKRIVRG |
Ga0310686_1121362561 | 3300031708 | Soil | MLPRYMTACLYAGWKNKRMGYPSSALTVEQKILAALARIESKLDDTERRVKAVQQDVNRVKR |
Ga0310686_1133336543 | 3300031708 | Soil | MVNSPSSMTSEQKILAALTRIERKVNDVERRVKAVQQDVNRVKRIVRG |
Ga0310686_1156960832 | 3300031708 | Soil | MVNSPSAMTSEQKILAALVRIERQVDDMERRVKAVQQDVNRVERIVRG |
Ga0307477_100017492 | 3300031753 | Hardwood Forest Soil | MGYPTNATTVEEKILAALARIERKLEDTQRRVKAVQQDVNRVKRIVRG |
Ga0307473_110634201 | 3300031820 | Hardwood Forest Soil | MERSATPTTVEQKILAAVARIERKIDDVERRVKATQQDLNRVKRIVRG |
Ga0307479_101816901 | 3300031962 | Hardwood Forest Soil | MGYPPSAMTAEQKILAALARIERKVDDMERRVKAVQQDLNRVKRIVRG |
Ga0316051_10209742 | 3300032119 | Soil | MTACLYAGWKNKRMGYPSSALTVEQKILAALARIESKLDDTERRVKAVQQDVNRVKRMVR |
Ga0307470_102114232 | 3300032174 | Hardwood Forest Soil | MGYPPRAVTIEQKILAALARIESKLDDTERRVKAIQQDVNRVKRIVRG |
Ga0307471_1029423683 | 3300032180 | Hardwood Forest Soil | MGYPPRAVTVEQKILAALARIESKLDDTERRVKAVQQ |
Ga0348332_104621921 | 3300032515 | Plant Litter | MTSEQKILAALTRIERKVNDVERRVKAVQQDVNRVKRIVRG |
⦗Top⦘ |