NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F069230

Metagenome Family F069230

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069230
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 42 residues
Representative Sequence KVRELRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS
Number of Associated Samples 103
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 96.77 %
% of genes from short scaffolds (< 2000 bps) 87.10 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.484 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(44.355 % of family members)
Environment Ontology (ENVO) Unclassified
(49.194 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(41.129 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.00%    β-sheet: 0.00%    Coil/Unstructured: 60.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF13561adh_short_C2 6.45
PF00753Lactamase_B 4.03
PF00501AMP-binding 2.42
PF00196GerE 2.42
PF01183Glyco_hydro_25 2.42
PF06441EHN 1.61
PF06094GGACT 1.61
PF02566OsmC 1.61
PF00211Guanylate_cyc 1.61
PF01955CbiZ 1.61
PF01978TrmB 1.61
PF12900Pyridox_ox_2 1.61
PF16859TetR_C_11 1.61
PF02230Abhydrolase_2 1.61
PF00202Aminotran_3 1.61
PF00072Response_reg 0.81
PF11066DUF2867 0.81
PF09678Caa3_CtaG 0.81
PF00190Cupin_1 0.81
PF01177Asp_Glu_race 0.81
PF03795YCII 0.81
PF00682HMGL-like 0.81
PF12802MarR_2 0.81
PF08281Sigma70_r4_2 0.81
PF00850Hist_deacetyl 0.81
PF13602ADH_zinc_N_2 0.81
PF00892EamA 0.81
PF00041fn3 0.81
PF03737RraA-like 0.81
PF14451Ub-Mut7C 0.81
PF08327AHSA1 0.81
PF12146Hydrolase_4 0.81
PF00589Phage_integrase 0.81
PF00239Resolvase 0.81
PF13271DUF4062 0.81
PF07676PD40 0.81
PF13469Sulfotransfer_3 0.81
PF00069Pkinase 0.81
PF01510Amidase_2 0.81
PF10935DUF2637 0.81
PF12697Abhydrolase_6 0.81
PF01988VIT1 0.81
PF01370Epimerase 0.81
PF03358FMN_red 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.23
COG3757Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 familyCell wall/membrane/envelope biogenesis [M] 2.42
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 1.61
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 1.61
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 1.61
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 1.61
COG1865Adenosylcobinamide amidohydrolaseCoenzyme transport and metabolism [H] 1.61
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.61
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 0.81
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.81
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.81
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.81
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.81
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.48 %
UnclassifiedrootN/A39.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_100724307All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300004082|Ga0062384_100854874Not Available640Open in IMG/M
3300005187|Ga0066675_10454776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia952Open in IMG/M
3300005332|Ga0066388_102906439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales875Open in IMG/M
3300005332|Ga0066388_107312332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300005332|Ga0066388_108373864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia515Open in IMG/M
3300005337|Ga0070682_100021666All Organisms → cellular organisms → Bacteria3796Open in IMG/M
3300005434|Ga0070709_10677330Not Available801Open in IMG/M
3300005435|Ga0070714_100118098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2356Open in IMG/M
3300005436|Ga0070713_100115257All Organisms → cellular organisms → Bacteria2348Open in IMG/M
3300005764|Ga0066903_106363872All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005840|Ga0068870_10111856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1561Open in IMG/M
3300006028|Ga0070717_10141132All Organisms → cellular organisms → Bacteria2078Open in IMG/M
3300006173|Ga0070716_101277076All Organisms → cellular organisms → Bacteria → Terrabacteria group592Open in IMG/M
3300006176|Ga0070765_102151048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300006755|Ga0079222_10504618Not Available887Open in IMG/M
3300006800|Ga0066660_10431554All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300009174|Ga0105241_10043860All Organisms → cellular organisms → Bacteria3388Open in IMG/M
3300009792|Ga0126374_11419912Not Available566Open in IMG/M
3300009824|Ga0116219_10125762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1490Open in IMG/M
3300010043|Ga0126380_10000555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia12746Open in IMG/M
3300010359|Ga0126376_13041537Not Available518Open in IMG/M
3300010360|Ga0126372_10026861All Organisms → cellular organisms → Bacteria3526Open in IMG/M
3300010360|Ga0126372_10887166All Organisms → cellular organisms → Bacteria893Open in IMG/M
3300010361|Ga0126378_10470068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1372Open in IMG/M
3300010379|Ga0136449_100274092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3107Open in IMG/M
3300010398|Ga0126383_10599201All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → Piscinibacter defluvii1173Open in IMG/M
3300012199|Ga0137383_10280255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1221Open in IMG/M
3300012201|Ga0137365_10369216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1059Open in IMG/M
3300012206|Ga0137380_10431018Not Available1168Open in IMG/M
3300012209|Ga0137379_10149616Not Available2243Open in IMG/M
3300012356|Ga0137371_11169340Not Available575Open in IMG/M
3300012971|Ga0126369_12380348Not Available616Open in IMG/M
3300014165|Ga0181523_10023408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4056Open in IMG/M
3300014326|Ga0157380_11354986All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300016270|Ga0182036_11776762Not Available522Open in IMG/M
3300016294|Ga0182041_11153505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300016341|Ga0182035_11946561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300016371|Ga0182034_11395734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria612Open in IMG/M
3300017821|Ga0187812_1147232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii759Open in IMG/M
3300017928|Ga0187806_1313440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300017946|Ga0187879_10566591Not Available631Open in IMG/M
3300017955|Ga0187817_10296999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1030Open in IMG/M
3300017973|Ga0187780_11489693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300017975|Ga0187782_11590233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300018064|Ga0187773_10601052Not Available672Open in IMG/M
3300018085|Ga0187772_11030795Not Available602Open in IMG/M
3300018090|Ga0187770_11693344Not Available517Open in IMG/M
3300020582|Ga0210395_10743944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300021178|Ga0210408_10389053Not Available1111Open in IMG/M
3300021178|Ga0210408_10428718Not Available1053Open in IMG/M
3300021432|Ga0210384_10417103Not Available1209Open in IMG/M
3300021474|Ga0210390_10165077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1868Open in IMG/M
3300021478|Ga0210402_10805157Not Available865Open in IMG/M
3300021560|Ga0126371_10593391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1257Open in IMG/M
3300021560|Ga0126371_11174039All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300021560|Ga0126371_12549102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300025899|Ga0207642_11162792All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025916|Ga0207663_10545786Not Available906Open in IMG/M
3300025921|Ga0207652_11830022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → unclassified Nocardia → Nocardia sp. ncl2512Open in IMG/M
3300025935|Ga0207709_10736259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → unclassified Nocardia → Nocardia sp. ncl2792Open in IMG/M
3300026067|Ga0207678_10092586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2583Open in IMG/M
3300026551|Ga0209648_10205320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1499Open in IMG/M
3300027824|Ga0209040_10087207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1791Open in IMG/M
3300027857|Ga0209166_10514788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium614Open in IMG/M
3300031549|Ga0318571_10158406Not Available787Open in IMG/M
3300031564|Ga0318573_10463978All Organisms → cellular organisms → Bacteria → Terrabacteria group681Open in IMG/M
3300031573|Ga0310915_11269917Not Available508Open in IMG/M
3300031668|Ga0318542_10338691Not Available773Open in IMG/M
3300031679|Ga0318561_10816137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ISL-99512Open in IMG/M
3300031680|Ga0318574_10346254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia866Open in IMG/M
3300031682|Ga0318560_10564517Not Available616Open in IMG/M
3300031713|Ga0318496_10032302All Organisms → cellular organisms → Bacteria2652Open in IMG/M
3300031723|Ga0318493_10901230Not Available501Open in IMG/M
3300031724|Ga0318500_10691005Not Available520Open in IMG/M
3300031744|Ga0306918_10240220Not Available1379Open in IMG/M
3300031747|Ga0318502_10285877Not Available968Open in IMG/M
3300031747|Ga0318502_10476358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales747Open in IMG/M
3300031747|Ga0318502_10693334Not Available615Open in IMG/M
3300031751|Ga0318494_10079128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1783Open in IMG/M
3300031769|Ga0318526_10388433Not Available570Open in IMG/M
3300031771|Ga0318546_10028104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3319Open in IMG/M
3300031771|Ga0318546_10074074Not Available2181Open in IMG/M
3300031771|Ga0318546_10232415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1266Open in IMG/M
3300031777|Ga0318543_10479937All Organisms → cellular organisms → Bacteria → Terrabacteria group557Open in IMG/M
3300031779|Ga0318566_10161870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1110Open in IMG/M
3300031781|Ga0318547_10098800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus africanus1664Open in IMG/M
3300031781|Ga0318547_10108742Not Available1593Open in IMG/M
3300031781|Ga0318547_10775593Not Available597Open in IMG/M
3300031782|Ga0318552_10152043Not Available1163Open in IMG/M
3300031797|Ga0318550_10522518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300031798|Ga0318523_10010162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3794Open in IMG/M
3300031799|Ga0318565_10307506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300031799|Ga0318565_10345237Not Available722Open in IMG/M
3300031832|Ga0318499_10096091Not Available1144Open in IMG/M
3300031832|Ga0318499_10143810Not Available930Open in IMG/M
3300031835|Ga0318517_10348537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii669Open in IMG/M
3300031845|Ga0318511_10387506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300031859|Ga0318527_10049119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1638Open in IMG/M
3300031860|Ga0318495_10198273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300031894|Ga0318522_10057594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus africanus1385Open in IMG/M
3300031894|Ga0318522_10297581Not Available612Open in IMG/M
3300031896|Ga0318551_10212335Not Available1074Open in IMG/M
3300031910|Ga0306923_12374225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales527Open in IMG/M
3300031912|Ga0306921_12742830All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031941|Ga0310912_10190778Not Available1564Open in IMG/M
3300031941|Ga0310912_10312929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1217Open in IMG/M
3300031941|Ga0310912_10886505Not Available687Open in IMG/M
3300031946|Ga0310910_10090745Not Available2249Open in IMG/M
3300031954|Ga0306926_10407424All Organisms → cellular organisms → Bacteria → Terrabacteria group1678Open in IMG/M
3300031954|Ga0306926_11420858Not Available804Open in IMG/M
3300032001|Ga0306922_10908455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces914Open in IMG/M
3300032008|Ga0318562_10525879Not Available685Open in IMG/M
3300032025|Ga0318507_10276947Not Available729Open in IMG/M
3300032043|Ga0318556_10234080Not Available958Open in IMG/M
3300032044|Ga0318558_10076343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1533Open in IMG/M
3300032044|Ga0318558_10702345Not Available506Open in IMG/M
3300032076|Ga0306924_10961780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium940Open in IMG/M
3300032089|Ga0318525_10101555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus africanus1466Open in IMG/M
3300032089|Ga0318525_10389761Not Available714Open in IMG/M
3300032089|Ga0318525_10539290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300032180|Ga0307471_103225484Not Available578Open in IMG/M
3300032261|Ga0306920_103187331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Flexivirga → Flexivirga caeni614Open in IMG/M
3300032828|Ga0335080_11620247Not Available637Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil44.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.03%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.03%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.03%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.23%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.61%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.61%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.61%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.81%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10072430713300000956SoilLGARRADGLTYRELAAEFGISDTSAHAAVNRKTWVHVS*
Ga0062384_10085487413300004082Bog Forest SoilVGNPQAKLSDDKVRKLRSRRADGLTYRQLATEFGISDVSAYAAVHRKTWAHVT*
Ga0066675_1045477613300005187SoilGKVQQLRARRADGLTYQQLADEFGISDVSARSAVNGRTWAHVA*
Ga0066388_10290643913300005332Tropical Forest SoilRAKLTSGKVRELRARRADGLTYRQLAAEFGISDASACAAVNRKTWAHVS*
Ga0066388_10731233223300005332Tropical Forest SoilQLRARRADGLTYRQLAAEFGISDATACAAVNRKTWAHVS*
Ga0066388_10837386423300005332Tropical Forest SoilRAKLTSGKVRELRARRADGLTYRQLAAEFGISDASACAAANRKTWAHVS*
Ga0070682_10002166613300005337Corn RhizosphereKVRKLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA*
Ga0070709_1067733013300005434Corn, Switchgrass And Miscanthus RhizosphereNVRRLRARRADGLTYQQLADEFGISDVSAHAAVNRRTWAHVA*
Ga0070714_10011809843300005435Agricultural SoilAKLTSGKVRELRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS*
Ga0070713_10011525713300005436Corn, Switchgrass And Miscanthus RhizosphereRRLRARRADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA*
Ga0066903_10636387223300005764Tropical Forest SoilEGNRRAKLTSVRVRQLRARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVS*
Ga0068870_1011185613300005840Miscanthus RhizosphereKFEGYERGADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA*
Ga0070717_1014113223300006028Corn, Switchgrass And Miscanthus RhizosphereVGNPQAKLSDDSVRKLRSHRADGLTYRQLATEFGISDVSAYAAVHRKTWAHVT*
Ga0070716_10127707613300006173Corn, Switchgrass And Miscanthus RhizosphereLRARRADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA*
Ga0070765_10215104823300006176SoilKLTAGKVAELRARRADGLTYRQLADEFCISDVSAHAAVNRRTWAHVA*
Ga0079222_1050461823300006755Agricultural SoilRELRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA*
Ga0066660_1043155413300006800SoilKLTDDKVRQLRALRADGMTYRQLAAEFGISDVSACAAVNRKTWAHVT*
Ga0105241_1004386043300009174Corn RhizosphereTAEKVRKLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA*
Ga0126374_1141991213300009792Tropical Forest SoilRRADGLTYRQLAAEFGISDVTASAAVNRKTWAHVN*
Ga0116219_1012576223300009824Peatlands SoilAKLTTRKVRQLRARRAQGLTYRQLAAEFGISDVSAYAAANRRTWAHVS*
Ga0126380_1000055573300010043Tropical Forest SoilLTSGKVRELRARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVS*
Ga0126376_1304153713300010359Tropical Forest SoilLRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS*
Ga0126372_1002686163300010360Tropical Forest SoilELRARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVS*
Ga0126372_1088716613300010360Tropical Forest SoilGKVRELRARRADGLTYRQLAAEFGISDTSAHAAVNRKTWAHVS*
Ga0126378_1047006813300010361Tropical Forest SoilAKLTSGKVRELRARRADGLTYRQLAAEFGISDVTASAAVNRKHWRM*
Ga0136449_10027409213300010379Peatlands SoilLSDDKVTKLRARRTDGLTYRQLAAEFGISDVSACAAVNRRTWAHVT*
Ga0126383_1059920113300010398Tropical Forest SoilVRQLRARRADGLTYRQLAAEFDISDVTACAAVNRKTWAHVN*
Ga0137383_1028025543300012199Vadose Zone SoilARRADGLTYRQLAVEFGISDVSACAAVNRKTWAHVS*
Ga0137365_1036921613300012201Vadose Zone SoilRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS*
Ga0137380_1043101813300012206Vadose Zone SoilRLRARRADGLTYRQLAGEFGISDVSAYAAVNRTTWAHVA*
Ga0137379_1014961613300012209Vadose Zone SoilKVRRLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA*
Ga0137371_1116934013300012356Vadose Zone SoilSRKVRQLRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS*
Ga0126369_1238034813300012971Tropical Forest SoilLRARRADGLTYRQLAAEFGISDVTACAAVNRKTWAHVN*
Ga0181523_1002340813300014165BogVRKLRALRAGGLTYRQLAAEFGISDVSACAAVNRKTWA
Ga0157380_1135498613300014326Switchgrass RhizosphereLTAEKVRRLRARRADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA*
Ga0182036_1177676213300016270SoilDKVRRLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS
Ga0182041_1115350523300016294SoilRAKLTNGKVRQLRARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVT
Ga0182035_1194656123300016341SoilRARRAQGLTYRQLAADFGISDVSARAAVNGTTWRHIA
Ga0182034_1139573423300016371SoilRARRADGLTYRQLAAEFGISDVTARAAVNRKTWTHVT
Ga0187812_114723223300017821Freshwater SedimentKLTDEKVRGLRARRADGLTYQQLAAEFGISDVSACAAVNRKT
Ga0187806_131344023300017928Freshwater SedimentAKLTNAKVTELRARRADGLTYRQLAAEFGISDVSAWAAVNRRTWTHVN
Ga0187879_1056659113300017946PeatlandVRKLRALRAGGLTYRQLAAEFGISDVSACAAVNRKTWAHVP
Ga0187817_1029699913300017955Freshwater SedimentRRAQGLTYRQLAARFGISDVTAWAAVNGKTWRHIA
Ga0187780_1148969323300017973Tropical PeatlandKVRELRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS
Ga0187782_1159023313300017975Tropical PeatlandVRQLRARRADGLTYRQLAAEFGVSDASACAAVNRKTWAHVS
Ga0187773_1060105223300018064Tropical PeatlandAKLTAGKVRELRARRADGLTFRQLAREFGISDVSACAAVNRRTWAHVS
Ga0187772_1103079513300018085Tropical PeatlandRRADGLTYRQLAAEFGISDVSACAAVNRRTWVHVA
Ga0187770_1169334413300018090Tropical PeatlandLRARRADGLTYRQLAAEFGISDVSACAAVNRRTWVHVA
Ga0210395_1074394423300020582SoilRKVRQLRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS
Ga0210408_1038905313300021178SoilSPHAKLTAGNVRRLRARRADGLTYQQLADEFGISDVSAHAAVNRRTWAHVA
Ga0210408_1042871813300021178SoilVRRLRARRADGLTYQQLADEFGISDVSAHAAVNRRTWAHVA
Ga0210384_1041710333300021432SoilEKVRQLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA
Ga0210390_1016507743300021474SoilDKVRTLRALRAGGLTYRQLAAEFGISDVSACAAVNRKTWAHVT
Ga0210402_1080515723300021478SoilAKLTAEKVRKLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA
Ga0126371_1059339133300021560Tropical Forest SoilVGEGNRRAKLTSGKVRELRARRADGLTYRQLAAEFGISDVTASAAVNRKTWAHVN
Ga0126371_1117403913300021560Tropical Forest SoilNRRAKLTTAKVRQLRARRAGGLTYRQLAAEFGISDSSACAAVNRKTWAHVN
Ga0126371_1254910213300021560Tropical Forest SoilKLTDNKVRQLRARRADGVTYRQLAAEFGISDVSAWAAVNGRTWAHVS
Ga0207642_1116279223300025899Miscanthus RhizosphereKLRARRADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA
Ga0207663_1054578623300025916Corn, Switchgrass And Miscanthus RhizosphereEKVRRLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA
Ga0207652_1183002213300025921Corn RhizosphereVRKLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA
Ga0207709_1073625913300025935Miscanthus RhizosphereRRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA
Ga0207678_1009258613300026067Corn RhizosphereKVRKLRARRADGLTYRQLAGELGISDVSAHAAVNRTTWAHVA
Ga0209648_1020532033300026551Grasslands SoilARRVEGLTYRQLAGEFGISDASACAAVNRRTWAHVA
Ga0209040_1008720713300027824Bog Forest SoilAKLTNDKVRQLRARRADGLTYRQLAAESGISDVSAWAAVNGKTWAHVS
Ga0209166_1051478813300027857Surface SoilRRAQGLTFRQLAAEFGISDVSAWAAVNGKTWRHVT
Ga0318571_1015840623300031549SoilKLTAEKVRQLRARRADGLTYQQLAGEFGISDVSAHAAVNRRTWAHIA
Ga0318573_1046397823300031564SoilAKVKQLRARRADGLTYRQLAAEFGISDVTAYAAVNRKTWAHVR
Ga0310915_1126991723300031573SoilARRAEGLTYRQLAAEFGISDVTARAAVQRTTWAHVS
Ga0318542_1033869123300031668SoilARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS
Ga0318561_1081613713300031679SoilGKVRELRARRAAGLTYRQLAAEFGISDASACAAVNRKTWAHVS
Ga0318574_1034625423300031680SoilVRQLRARRAEGLTYRQLATKFGISDVSACAAVNRKTWAHVT
Ga0318560_1056451713300031682SoilRKLRARRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS
Ga0318496_1003230243300031713SoilAKLTSRKVRKLRARRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS
Ga0318493_1090123013300031723SoilELRTRRAEGVTYRKLAAEFSISDVSACSAVNRKTWAHVV
Ga0318500_1069100523300031724SoilVRQLRARRADGLTYRQLAAEFGISDVSAWAAVNGKTWTHVS
Ga0306918_1024022023300031744SoilKLTNAKVRQLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS
Ga0318502_1028587713300031747SoilRKVRRLRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS
Ga0318502_1047635813300031747SoilTAEKVRQLRARRSDGLTYQQLAGEFGISDVSACAVVNRRTWAHVA
Ga0318502_1069333423300031747SoilRKVRKLRARRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS
Ga0318494_1007912833300031751SoilRRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS
Ga0318526_1038843313300031769SoilLTSRKVRKLRARRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS
Ga0318546_1002810453300031771SoilKVRQLRARRADGLTYRQLAAEFGISDVSAWAAVNGKTWTHVS
Ga0318546_1007407413300031771SoilQVRQLRARRADGLTYRQLAAEFGISDMTARAAANRKTWAHVN
Ga0318546_1023241533300031771SoilRRAEGLTYRQLAAEFGISDVTARAAVQRTTWAHVS
Ga0318543_1047993713300031777SoilVRELRARRAAGLTYRQLAAEFGISDASACAAVNRKTWAHVS
Ga0318566_1016187013300031779SoilLSDGKVRKLRARRADGLTYKQLAAEFGISDVSARAAVNRKTWTHVT
Ga0318547_1009880013300031781SoilRAKLTPGKVRKLRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA
Ga0318547_1010874233300031781SoilVRQLRARRADGATYRQLAAEFGISDMTARAAANRKTWAHVT
Ga0318547_1077559313300031781SoilVRQLRARRAAGLTYRQLAAEFGISDLSACAVVNRKTWAHVI
Ga0318552_1015204323300031782SoilKLTSGQVRQLRARRADGLTYRQLAAEFGISDMTARAAANRKTWAHVT
Ga0318550_1052251823300031797SoilAKLTNGKVRQLRARRADGLTYRQLAAEFGISDVTARAAVNRKTWTHVT
Ga0318523_1001016243300031798SoilAKLTNAKVRQLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS
Ga0318565_1030750613300031799SoilTAGKVRELRARRADGLTYQQLATEFGISDVSAWAAVNGKTWAHVN
Ga0318565_1034523723300031799SoilLTPGKVRKLRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA
Ga0318499_1009609123300031832SoilEKVRQLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS
Ga0318499_1014381023300031832SoilTSGRVRELRARRAAGLTYRQLAAEFGISDASARAAANRKTWAHVS
Ga0318517_1034853723300031835SoilRRAGGLTYRQPAAEFGISDVSACAAVNRKTWAQVP
Ga0318511_1038750613300031845SoilKVRQLRARRADGLTYRQLAAEFGISDVTARAAVNRKTWTHVT
Ga0318527_1004911913300031859SoilRKVRELRARRAEGLTYRQLAAEFGISDASACAAVNRKTWAHVP
Ga0318495_1019827333300031860SoilKVRELRARRAEGLTYRQLAAEFGISDASACAAVNRKTWAHVP
Ga0318522_1005759433300031894SoilPGKVRKLRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA
Ga0318522_1029758123300031894SoilKLTGRKVRELRARRAEGLTYRQLAAEFGISDASACAAVNRKTWAHVP
Ga0318551_1021233523300031896SoilIGQGNPRAILTDAKVRLLRARRAQGLTYRQLAAEFGISDVSAWAAANGRTWRHVA
Ga0306923_1237422523300031910SoilKLTADKVRQLRARRADGLTYRQLAGEFGISDVSACAVVNRRTWAHVA
Ga0306921_1274283013300031912SoilKVRQLRARRADGLTYRQLAAEFGVSDVSACAAVNRKTWAHVN
Ga0310912_1019077813300031941SoilRARRADGLTYRQLAAEFGVSDVSACAAVNRKTWAHVN
Ga0310912_1031292913300031941SoilRARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVT
Ga0310912_1088650513300031941SoilTNAKVRQLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS
Ga0310910_1009074513300031946SoilVRQLRARRADGLTYRQLAAEFGISDMTARAAANRKTWAHVT
Ga0306926_1040742423300031954SoilRELRARRAAGLTYRQLAAEFGISDASARAAANRKTWAHVS
Ga0306926_1142085823300031954SoilRAKLTSGKVRVLRARRTAGLTYRQLAAEFGISDASARAAVNRKTWAHVS
Ga0306922_1090845513300032001SoilARRAAGLTYRQLAAEFGISDASACAAVNRKTWAHVS
Ga0318562_1052587923300032008SoilQLRARRADGATYRQLAAEFGISDMTARAAANRKTWAHVT
Ga0318507_1027694713300032025SoilTDDKVRQLRARRADGLTYRQLAAEFGISDVSAWAAVNGKTWTHVS
Ga0318556_1023408013300032043SoilQLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS
Ga0318558_1007634313300032044SoilVRELRARRAEGLTYRQLAAEFGISDASACAAVNRKTWAHVP
Ga0318558_1070234513300032044SoilARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA
Ga0306924_1096178033300032076SoilVRQLRARRADGLTYRQLAAEFGISDTSACAAVNRKTWAHVR
Ga0318525_1010155513300032089SoilTPGKVRKLRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA
Ga0318525_1038976123300032089SoilAEKVRQLRARRADGLTYQQLASEFGISDVSAHAAVNRRTWAHIA
Ga0318525_1053929013300032089SoilEKVRQLRARRADGLTYRQLAGEFGISDVSAHAAVNRRTWAHVG
Ga0307471_10322548413300032180Hardwood Forest SoilVRRLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA
Ga0306920_10318733123300032261SoilARRADGLTYRQLASEFGISDVSACAAVNRRTWAHIT
Ga0335080_1162024713300032828SoilTSGKVRQLRARRADGLTYRQLAAEFGISDTSACAAVNGKTWAHVS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.