NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069419

Metagenome / Metatranscriptome Family F069419

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069419
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 37 residues
Representative Sequence MGKKKTKKQSAKATLAEVIKEMAKPRVASSAREQ
Number of Associated Samples 108
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 37.90 %
% of genes near scaffold ends (potentially truncated) 32.26 %
% of genes from short scaffolds (< 2000 bps) 79.84 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.032 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil
(11.290 % of family members)
Environment Ontology (ENVO) Unclassified
(20.968 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.839 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.77%    β-sheet: 0.00%    Coil/Unstructured: 53.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF13545HTH_Crp_2 41.13
PF00072Response_reg 4.03
PF05532CsbD 1.61
PF13620CarboxypepD_reg 1.61
PF04264YceI 1.61
PF02065Melibiase 0.81
PF13432TPR_16 0.81
PF00118Cpn60_TCP1 0.81
PF00027cNMP_binding 0.81
PF00011HSP20 0.81
PF01165Ribosomal_S21 0.81
PF01435Peptidase_M48 0.81
PF02954HTH_8 0.81
PF00589Phage_integrase 0.81
PF01337Barstar 0.81
PF03631Virul_fac_BrkB 0.81
PF07676PD40 0.81
PF00691OmpA 0.81
PF00753Lactamase_B 0.81
PF01915Glyco_hydro_3_C 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 1.61
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 1.61
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.81
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.81
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 0.81
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.81
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.81
COG2732Barstar, RNAse (barnase) inhibitorTranscription [K] 0.81
COG3345Alpha-galactosidaseCarbohydrate transport and metabolism [G] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.03 %
UnclassifiedrootN/A20.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100673844All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300002245|JGIcombinedJ26739_101176228All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300002245|JGIcombinedJ26739_101857596Not Available504Open in IMG/M
3300004104|Ga0058891_1579349All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300004475|Ga0068969_1487022All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300004479|Ga0062595_100977876All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300005328|Ga0070676_11247226All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005455|Ga0070663_100452819All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300005537|Ga0070730_10073341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P172411Open in IMG/M
3300005537|Ga0070730_10128146All Organisms → cellular organisms → Bacteria1736Open in IMG/M
3300005538|Ga0070731_10503837All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae806Open in IMG/M
3300005541|Ga0070733_10347030Not Available984Open in IMG/M
3300005542|Ga0070732_10086173All Organisms → cellular organisms → Bacteria1842Open in IMG/M
3300005557|Ga0066704_10829759All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300005578|Ga0068854_100407022All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300005591|Ga0070761_10010787All Organisms → cellular organisms → Bacteria5148Open in IMG/M
3300005610|Ga0070763_10092418All Organisms → cellular organisms → Bacteria → Acidobacteria1514Open in IMG/M
3300005712|Ga0070764_10434949All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300005993|Ga0080027_10322338Not Available616Open in IMG/M
3300005995|Ga0066790_10062199All Organisms → cellular organisms → Bacteria1610Open in IMG/M
3300006059|Ga0075017_100007096All Organisms → cellular organisms → Bacteria7096Open in IMG/M
3300006059|Ga0075017_101323114Not Available566Open in IMG/M
3300006102|Ga0075015_100043151All Organisms → cellular organisms → Bacteria2105Open in IMG/M
3300006163|Ga0070715_10016819All Organisms → cellular organisms → Bacteria2757Open in IMG/M
3300006893|Ga0073928_10083338Not Available2733Open in IMG/M
3300006893|Ga0073928_10145250All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1920Open in IMG/M
3300006893|Ga0073928_10477244All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium898Open in IMG/M
3300007982|Ga0102924_1212041All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300009038|Ga0099829_11130921All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009176|Ga0105242_12327725Not Available582Open in IMG/M
3300009518|Ga0116128_1008715All Organisms → cellular organisms → Bacteria3684Open in IMG/M
3300009522|Ga0116218_1138754All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1105Open in IMG/M
3300009522|Ga0116218_1425312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae592Open in IMG/M
3300009523|Ga0116221_1509696Not Available527Open in IMG/M
3300009551|Ga0105238_10303942All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300009698|Ga0116216_10199792All Organisms → cellular organisms → Bacteria → Acidobacteria1226Open in IMG/M
3300009700|Ga0116217_10038251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter3583Open in IMG/M
3300009764|Ga0116134_1061970All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300009839|Ga0116223_10050922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2704Open in IMG/M
3300010343|Ga0074044_10011108All Organisms → cellular organisms → Bacteria → Acidobacteria6824Open in IMG/M
3300011070|Ga0138567_1042203All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300011075|Ga0138555_1057030Not Available672Open in IMG/M
3300011269|Ga0137392_10606833Not Available908Open in IMG/M
3300011998|Ga0120114_1023529Not Available1274Open in IMG/M
3300012189|Ga0137388_10072059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2882Open in IMG/M
3300012202|Ga0137363_11440173Not Available579Open in IMG/M
3300014496|Ga0182011_10626872Not Available682Open in IMG/M
3300014501|Ga0182024_10097762All Organisms → cellular organisms → Bacteria → Acidobacteria4290Open in IMG/M
3300014501|Ga0182024_12896655All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300014838|Ga0182030_10983119All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300014968|Ga0157379_10475178All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300017822|Ga0187802_10053416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1479Open in IMG/M
3300017822|Ga0187802_10405095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae540Open in IMG/M
3300017928|Ga0187806_1088819All Organisms → cellular organisms → Bacteria → Acidobacteria977Open in IMG/M
3300017932|Ga0187814_10225294All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300017933|Ga0187801_10386677All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300017937|Ga0187809_10253350All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300017943|Ga0187819_10634171Not Available605Open in IMG/M
3300018004|Ga0187865_1126729All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300018019|Ga0187874_10255941All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300018030|Ga0187869_10531253All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300018034|Ga0187863_10027642All Organisms → cellular organisms → Bacteria3386Open in IMG/M
3300018035|Ga0187875_10534387All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300018040|Ga0187862_10726180All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300019879|Ga0193723_1153904All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300019890|Ga0193728_1110913All Organisms → cellular organisms → Bacteria → Acidobacteria1256Open in IMG/M
3300020004|Ga0193755_1116250All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300020010|Ga0193749_1014535All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1538Open in IMG/M
3300020018|Ga0193721_1120175All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300020579|Ga0210407_10978375All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300020579|Ga0210407_11481119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae501Open in IMG/M
3300020583|Ga0210401_10002442All Organisms → cellular organisms → Bacteria20607Open in IMG/M
3300021170|Ga0210400_10009431All Organisms → cellular organisms → Bacteria7904Open in IMG/M
3300021402|Ga0210385_10502415All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300021405|Ga0210387_11650991All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300021432|Ga0210384_10648353All Organisms → cellular organisms → Bacteria → Acidobacteria947Open in IMG/M
3300021478|Ga0210402_10001260All Organisms → cellular organisms → Bacteria26219Open in IMG/M
3300021479|Ga0210410_10273177All Organisms → cellular organisms → Bacteria → Acidobacteria1517Open in IMG/M
3300022881|Ga0224545_1054486All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300023255|Ga0224547_1001138All Organisms → cellular organisms → Bacteria3287Open in IMG/M
3300025432|Ga0208821_1063281All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300025473|Ga0208190_1086595All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300025899|Ga0207642_10003203All Organisms → cellular organisms → Bacteria5132Open in IMG/M
3300025905|Ga0207685_10003616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3790Open in IMG/M
3300025919|Ga0207657_11100490Not Available607Open in IMG/M
3300025945|Ga0207679_10221005Not Available1594Open in IMG/M
3300026291|Ga0209890_10262854Not Available532Open in IMG/M
3300026294|Ga0209839_10035992All Organisms → cellular organisms → Bacteria → Acidobacteria1852Open in IMG/M
3300026294|Ga0209839_10207915All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300026552|Ga0209577_10558112All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300026786|Ga0207497_102797All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300027047|Ga0208730_1026403Not Available667Open in IMG/M
3300027605|Ga0209329_1043843Not Available947Open in IMG/M
3300027610|Ga0209528_1103315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300027645|Ga0209117_1018037All Organisms → cellular organisms → Bacteria → Acidobacteria2302Open in IMG/M
3300027676|Ga0209333_1138256Not Available657Open in IMG/M
3300027684|Ga0209626_1149985All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300027684|Ga0209626_1210691Not Available515Open in IMG/M
3300027857|Ga0209166_10051223All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P172411Open in IMG/M
3300027884|Ga0209275_10673612All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300027889|Ga0209380_10412390Not Available792Open in IMG/M
3300027905|Ga0209415_10325709All Organisms → cellular organisms → Bacteria → Acidobacteria1301Open in IMG/M
3300027908|Ga0209006_10750256All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300027911|Ga0209698_10113874All Organisms → cellular organisms → Bacteria → Acidobacteria2249Open in IMG/M
3300028023|Ga0265357_1008180All Organisms → cellular organisms → Bacteria → Acidobacteria1023Open in IMG/M
3300028047|Ga0209526_10698696All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300028047|Ga0209526_10955102Not Available516Open in IMG/M
3300028666|Ga0265336_10080465All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium972Open in IMG/M
3300029944|Ga0311352_10030905All Organisms → cellular organisms → Bacteria → Acidobacteria5070Open in IMG/M
3300029944|Ga0311352_11164588Not Available587Open in IMG/M
3300030602|Ga0210254_10646991Not Available518Open in IMG/M
3300030659|Ga0316363_10098472All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300030906|Ga0302314_11825883All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300030991|Ga0073994_12427475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae518Open in IMG/M
3300031040|Ga0265754_1009590All Organisms → cellular organisms → Bacteria → Acidobacteria747Open in IMG/M
3300031231|Ga0170824_106750114All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300031261|Ga0302140_10759330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae699Open in IMG/M
3300031918|Ga0311367_11521735All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300031962|Ga0307479_10950131Not Available830Open in IMG/M
3300032160|Ga0311301_10216899All Organisms → cellular organisms → Bacteria3237Open in IMG/M
3300032160|Ga0311301_10549310All Organisms → cellular organisms → Bacteria → Acidobacteria1689Open in IMG/M
3300032180|Ga0307471_101408496Not Available857Open in IMG/M
3300033888|Ga0334792_024954All Organisms → cellular organisms → Bacteria2076Open in IMG/M
3300033888|Ga0334792_057426All Organisms → cellular organisms → Bacteria1186Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil11.29%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil10.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.84%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.03%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.23%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring3.23%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.23%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.23%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil3.23%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.23%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.61%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.61%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.61%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.81%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.81%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.81%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.81%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.81%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004475Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 62 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300011070Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011075Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300023255Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300026786Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A5a-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027605Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027684Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031040Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10067384423300002245Forest SoilRSTIDGRMAKRKPQKQSASETLAEVIKEMAKPRVVMSGTRTGK*
JGIcombinedJ26739_10117622823300002245Forest SoilMAKKKTPRHSAKVTLTAKATLAQIIKEMAKPRVAKSARGGL*
JGIcombinedJ26739_10185759613300002245Forest SoilMGKRKTKKQSAKATLPEVIKEMADPRVARSAREQSS
Ga0058891_157934913300004104Forest SoilEKPQKQSAKATLAAKETLAEVIKEMAKPRVAESARGGGL*
Ga0068969_148702213300004475Peatlands SoilPGLVKSWCMGKRKTRKQSAKATLAEVVKEMAKPRVATSARE*
Ga0062595_10097787623300004479SoilMNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL*
Ga0070676_1124722623300005328Miscanthus RhizosphereMDKRKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL*
Ga0070663_10045281923300005455Corn RhizosphereNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL*
Ga0070730_1007334153300005537Surface SoilMIANMSKKKIKKQSPKATLAEVTREMAKPRVAESARQP*
Ga0070730_1012814613300005537Surface SoilMGIMGKKNAKKQSAKATLAAITKEMAMPRVTRSAREQ*
Ga0070731_1050383713300005538Surface SoilMGAWVKEKTREQSPKATLAEVVKEMAKPRVVMSARE
Ga0070733_1034703023300005541Surface SoilVTSWGLWGKKKTKKQSAKAILAEVIKEMAKPRVARSAKE*
Ga0070732_1008617353300005542Surface SoilMGKKKTKKQSAKATLAEVIKEMAKPRVARSAREHSHLWN*
Ga0066704_1082975923300005557SoilMAKRKTQKKSAKATLAEVIKEMAKPRVAMSARGGS*
Ga0068854_10040702223300005578Corn RhizosphereMNKGETKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL*
Ga0070761_1001078753300005591SoilMDKRKTKAKKLLAKVTLAEVIKEMAKPRVAASAR*
Ga0070763_1009241823300005610SoilMAKKKTQKKSAKATLAEVIKEMAKERVAMSARGGL*
Ga0070764_1043494913300005712SoilMAKKKTPKKSAKATLAEVIKEMAKERVAMSARGGL*
Ga0080027_1032233823300005993Prmafrost SoilMGTMRKKKTKKQSAKETLAEVIKEMAKPRVASSARE*
Ga0066790_1006219913300005995SoilSHRTTGKKKSKKQSAKETLAEVMKEMAKPRVAMSAREQGV*
Ga0075017_10000709633300006059WatershedsMAKRKTQKKSAKSTLAEVIKEMAKPRVAMSARDGS*
Ga0075017_10132311423300006059WatershedsVYVGKTKVKKQSAKATLAEVIKEMAKPRVVASAK*
Ga0075015_10004315123300006102WatershedsMAKRKTQKKSAKSTLAEVIKEMAKPRVAMSARGGS*
Ga0070715_1001681933300006163Corn, Switchgrass And Miscanthus RhizosphereMAKRKAAKQSAKATLAEVLKVMAKPRVAVSARGGS*
Ga0073928_1008333873300006893Iron-Sulfur Acid SpringMAKGKTQKQSAKATLAEVIKEMAKPRVAKSAREHSPQRSK*
Ga0073928_1014525043300006893Iron-Sulfur Acid SpringMETMNKKKTKKQSAKATLAEVTKEMAKPRVASSAR*
Ga0073928_1047724423300006893Iron-Sulfur Acid SpringMGKRKPKKQSAEATLAEVVKEMAKPRVVRSAREQ*
Ga0102924_121204133300007982Iron-Sulfur Acid SpringMAKRKTQKQSAKATLAEVIKEMAKKRVAMSARGGS*
Ga0099829_1113092113300009038Vadose Zone SoilMGKKKTKKQSAKTTLAEVIKEMAKPRVVSSARGQ*
Ga0105242_1232772513300009176Miscanthus RhizosphereMNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRR
Ga0116128_100871523300009518PeatlandMGKKKTKKQSAKATLAEVIKEMAKPRVASSAREQ*
Ga0116218_113875423300009522Peatlands SoilMKSWVMGKRKTKKQLAKATLAEVVKEMAKPRVVMSAKG*
Ga0116218_142531223300009522Peatlands SoilMAKRKTQKKSAKATLAEVIKEMAKPRVAMSARGGL*
Ga0116221_150969623300009523Peatlands SoilMKSWVMGKRKTKKQLAKAALAEVVKEMAKPRVVMSAKG*
Ga0105238_1030394213300009551Corn RhizosphereMNKGKTKKQSAKATLAEVIKEMAKPRVAKSAKERMVRRQL*
Ga0116216_1019979213300009698Peatlands SoilSWVCMAKRKTPKQSAKATLAEVIKEMAKPRVAMSARGGL*
Ga0116217_1003825113300009700Peatlands SoilMAKKKTQEKSAKATLAEVIKEMAKKRVAMSARGGL*
Ga0116134_106197013300009764PeatlandMIAKTGCMRERKTRKLSGKATLAEVIKEMARPRGAESARE*
Ga0116223_1005092223300009839Peatlands SoilMGKRKTKTKEQQDKATLAEVRKEMAKPRVAMSARE*
Ga0074044_1001110843300010343Bog Forest SoilMKSWVMSKRKTKKQLAKATLAEVVKEMAKPRVVMSAKE*
Ga0138567_104220323300011070Peatlands SoilCMGKRKTRKQSAKATLAEVIKEMAKPRVATSARE*
Ga0138555_105703013300011075Peatlands SoilVDLPGLVKSWGMGKRKTRKQSAKATLAEVIKEMAKPRVATSARE*
Ga0137392_1060683313300011269Vadose Zone SoilMGNMGKKKTKKQSAKTTLAEVIKEMAKPRVATSARE*
Ga0120114_102352943300011998PermafrostMGAMRKKKTKKQSPEETLAEVIKEMAKPRVASSARE*
Ga0137388_1007205923300012189Vadose Zone SoilMGNMGKKKTKKQSAKTTLAEVVKEMAKPRVVSSARGQ*
Ga0137363_1144017323300012202Vadose Zone SoilVTSSTVDKKKTKEQSLKATLAEVTKEMAKPRVAMSARR*
Ga0182011_1062687213300014496FenKSWVMGKRKTKKQSDKATLAEVVKEMAKPRVATSARE*
Ga0182024_1009776233300014501PermafrostMKLSHRTRGKKKSKKQSAKATLAEVVKEMAKPRVAMSARE*
Ga0182024_1289665523300014501PermafrostDAPGLVKSWGMGKRKTKKQSDKATLAEVIKEMAKPRVATSARE*
Ga0182030_1098311923300014838BogMHEIIGTMGKKITKKKSAKATLAEVIKEMAKPRVATSARE*
Ga0157379_1047517813300014968Switchgrass RhizosphereKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL*
Ga0187802_1005341623300017822Freshwater SedimentMKSWVMGKRKTKKQLAKATLAEVVKEMAKPRVVMSAKE
Ga0187802_1040509523300017822Freshwater SedimentMAKKTPQKKSAKATLAEVIKEMAKERVAMSARGGL
Ga0187806_108881923300017928Freshwater SedimentMAKKKTQKKSAKATLAEVIKEMAKERVAMSARGGL
Ga0187814_1022529413300017932Freshwater SedimentDAPGLVKSSGMGKRKTRKESAKATLAEVIKEMAKPRVVMSAKE
Ga0187801_1038667723300017933Freshwater SedimentMAKKKPQKKSAKATLAEVIKEMAKERVAMSARGGL
Ga0187809_1025335023300017937Freshwater SedimentMAKRKTQKKSAKATLAEVIREMAKERVAMSARGGL
Ga0187819_1063417113300017943Freshwater SedimentMKSWVMSKRKTKKQSAKATLAEVVKEMAKPRVVMSAKG
Ga0187865_112672913300018004PeatlandLVKSWVMGKRKTKKQSDKATLAEVVKEMAKPRVATSARE
Ga0187874_1025594133300018019PeatlandGYMGKRKAKKQSAKATLAEVIKEMAKPRVATSARE
Ga0187869_1053125323300018030PeatlandSWRMGKRKTKKQSAKVTLAEVIKEMAKPRVASSARE
Ga0187863_1002764263300018034PeatlandMKASHGTIRKKKTKKQSAKATLAEVIKEMAKPRVAMSARE
Ga0187875_1053438713300018035PeatlandMHEIIGTMGKKITKKKSAKATLAEVIKEMAKPRVATSARE
Ga0187862_1072618013300018040PeatlandRSREIIAIMSKKKTKKQSDKETLAEVIKEMAKPRVATSARE
Ga0193723_115390423300019879SoilMIEAMRKKKTKKQSAKVTLAEVIKEMAKPRVASSAKE
Ga0193728_111091323300019890SoilMKLSHGTRGKKKSKKQSAKATLAEVMKEMAKPRVATSARE
Ga0193755_111625023300020004SoilMAKRKTQKKSAKATLAEVIKEMAKPRVAMSARGGL
Ga0193749_101453533300020010SoilMGKRKAKRESAKATLAKVIKEMAKPSVAMSARGGL
Ga0193721_112017523300020018SoilMAKRKTPKKSAKATLAEVIKEMAKPRVAMSARGGS
Ga0210407_1097837513300020579SoilMIEAMGKKKTKKQSAKATLAEVIKEMAKPRVATSARE
Ga0210407_1148111923300020579SoilMAKKKTPKKSAKATLAEVIKEMAKERVAMSARGGL
Ga0210401_10002442183300020583SoilVTSWGLWGKKKTKKQSAKAILAEVIKEMAKPRVARSAKE
Ga0210400_1000943163300021170SoilMMANMSKKKIKKQSPKATLAEVTREMAKPRVAESARKR
Ga0210385_1050241523300021402SoilMAKGEKQKQSAKATLADVIKEMAKPRVAKSVREHSPQRSK
Ga0210387_1165099123300021405SoilMAKRKTRKQSAKATLAEVIEEMAKRRVAMSARGGL
Ga0210384_1064835313300021432SoilMGKRKTKKQSAKATLAEVIKEMAKPRVAMSAREHSH
Ga0210402_1000126073300021478SoilMGKRKTKKQQDKATLAEIVKEMAKPRVAMSGRERSPTFLKHKY
Ga0210410_1027317723300021479SoilMAKKKIQKKSAKATLAEVIKEMAKERVAMSARGGL
Ga0224545_105448623300022881SoilMAKKKTQKKSAKATLAEVIKEMAKERVAMSARSGL
Ga0224547_100113813300023255SoilPGLVKSWGMGKRKTKKQSDKATLAEVVKEMAKPRVATSARE
Ga0208821_106328113300025432PeatlandIMGTMGKRKTKKQSAKATLAEVIKEMAKPRVATSARE
Ga0208190_108659513300025473PeatlandPRLVKSSAMGKRKTKKQSAKATLAEVVKEMAKPRVAMSARE
Ga0207642_1000320323300025899Miscanthus RhizosphereMNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL
Ga0207685_1000361613300025905Corn, Switchgrass And Miscanthus RhizosphereMAKRKAAKQSAKATLAEVLKVMAKPRVAVSARGGS
Ga0207657_1110049013300025919Corn RhizosphereMNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQLYS
Ga0207679_1022100513300025945Corn RhizosphereMNKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVV
Ga0209890_1026285423300026291SoilMGTMRKKKTKKQSAKETLAEVIKEMAKPRVASSARE
Ga0209839_1003599243300026294SoilMGTMRKKKTQKQSAKETLAEVIKEMAKPRVASSARE
Ga0209839_1020791523300026294SoilTREVIWTMGKKKTKKQSSKATLAEVVKEMAKPRVATSAKE
Ga0209577_1055811223300026552SoilMAKRKTQKKSAKATLAEVIKEMAKPRVAMSARGGS
Ga0207497_10279723300026786SoilKGKTKKQSAKATLAEVIKEMAKPRVAKSARERVVRRQL
Ga0208730_102640323300027047Forest SoilPVDAPGLVKSWRMGKRKTKKQSAKATLAEVIKEMAKPRVATSARE
Ga0209329_104384313300027605Forest SoilRCMAKRKTQKRSAKATLAEVIKEMAKPRMTTVCKRA
Ga0209528_110331513300027610Forest SoilMGKKKSKKQWNKATLAEVTKEMAKPRVARSAREYSHVF
Ga0209117_101803753300027645Forest SoilMGKRKTKTKKQSAKATLAEVVKEMAKPRVAMSARE
Ga0209333_113825633300027676Forest SoilMPKRRTQKQSAKVTLAEVIKEMAKSRVAMSAREDCHIVRME
Ga0209626_114998513300027684Forest SoilMETMNKKKTKKQSAKATLAEVTKEMAKPRVASSAR
Ga0209626_121069123300027684Forest SoilMKKKTKKQSDKDTLAEVTKEMAKPRVAASARTQVPIL
Ga0209166_1005122313300027857Surface SoilMIANMSKKKIKKQSPKATLAEVTREMAKPRVAESARQP
Ga0209275_1067361213300027884SoilMAKRKTRKQSAKATLAEVIEEMAMRRVAMSARGGL
Ga0209380_1041239033300027889SoilMKPSLGTMGEKKAKRQSDKATLAEVIKEMAKPRVAMSARE
Ga0209415_1032570923300027905Peatlands SoilMKSWVMGKRKTKKQLAKAALAEVVKEMAKPRVVMSAKG
Ga0209006_1075025613300027908Forest SoilMAKRKPQKQSASETLAEVIKEMAKPRVVMSGTRTGK
Ga0209698_1011387423300027911WatershedsMAKRKTQKKSAKSTLAEVIKEMAKPRVAMSARGGS
Ga0265357_100818033300028023RhizosphereMVKKKTPKKSAKATLAEVIKEMAKERVAMSARGGL
Ga0209526_1069869623300028047Forest SoilMGGMGKTKAKKQSAKATLAEVIKEMAKPRVVASAK
Ga0209526_1095510213300028047Forest SoilMGKRKTKKQSAKATLPEVIKEMADPRVARSAREQSSGYSQ
Ga0265336_1008046523300028666RhizosphereMKLSHRTTGKKKSKKQSAKATLAEVMKEMAKPRVAMSARE
Ga0311352_1003090563300029944PalsaMGKKKAKRQSDKATLAEVIKEMAKPRVAMSAREQSPF
Ga0311352_1116458823300029944PalsaMAKTKTKEQSAKATLAEVVKEMAKPRVAKSAREKSSAYSE
Ga0210254_1064699113300030602SoilMRKRKTKEQQDKATLAEVIKEMAKPRVAMSARERGHIV
Ga0316363_1009847223300030659Peatlands SoilMGKRKTKTKEQQDKATLAEVRKEMAKPRVAMSARE
Ga0302314_1182588313300030906PalsaMKPSHGTMGKKKAKRQSDKATLAEVIKEMAKPRVAMSAREQS
Ga0073994_1242747513300030991SoilMAKRKTTQQLAKATLAEVIKEMAKPRVAMSARGGL
Ga0265754_100959013300031040SoilMAKRKTQKQSAKATLAEVIKEMAKKRVAMSARGGS
Ga0170824_10675011413300031231Forest SoilARARDIIGTVGKRKTKKQSAKATLAEVIKEMAKPRVTSSARGG
Ga0302140_1075933023300031261BogMHEIIGTMSKKKTKKQSAKATLAEVIKEMAKPRVAASAKE
Ga0311367_1152173513300031918FenDHWCMGKRKAKQQSAKAILAEVIKEMAKPRVVASAKQ
Ga0307479_1095013113300031962Hardwood Forest SoilMMANMSKKKIKKQSPKATLAEVTREMAKPRVAESARKP
Ga0311301_1021689913300032160Peatlands SoilMAKKKTQEKSAKATLAEVIKEMAKKRVAMSARGGL
Ga0311301_1054931013300032160Peatlands SoilMAKKKTQKKSVKATLAEVIKEMAKERVAMSARGGL
Ga0307471_10140849623300032180Hardwood Forest SoilMGKRKTKKQSAKATLAEVVKEMAKPRAAASAREPRFLGKKF
Ga0334792_024954_625_7473300033888SoilMKLSHRTRGKKKSKKQSAKATLAEVVKEMAKPRVAMSARE
Ga0334792_057426_804_9263300033888SoilMGKRKTKKQSAKATLAEVIKEMAKPRVASSAREQSSVFLE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.