 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F069808 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MGPDELADFEERTFRQWDRASLFDLRRAIERRRRELGS |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 15.45 % |
| % of genes near scaffold ends (potentially truncated) | 52.03 % |
| % of genes from short scaffolds (< 2000 bps) | 85.37 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.293 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.195 % of family members) |
| Environment Ontology (ENVO) | Unclassified (55.285 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (69.919 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.97% β-sheet: 0.00% Coil/Unstructured: 53.03% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13520 | AA_permease_2 | 7.32 |
| PF00069 | Pkinase | 6.50 |
| PF01638 | HxlR | 3.25 |
| PF13091 | PLDc_2 | 1.63 |
| PF07519 | Tannase | 1.63 |
| PF00583 | Acetyltransf_1 | 0.81 |
| PF13483 | Lactamase_B_3 | 0.81 |
| PF13602 | ADH_zinc_N_2 | 0.81 |
| PF06071 | YchF-GTPase_C | 0.81 |
| PF07045 | DUF1330 | 0.81 |
| PF04972 | BON | 0.81 |
| PF03992 | ABM | 0.81 |
| PF00589 | Phage_integrase | 0.81 |
| PF00801 | PKD | 0.81 |
| PF13414 | TPR_11 | 0.81 |
| PF01261 | AP_endonuc_2 | 0.81 |
| PF12681 | Glyoxalase_2 | 0.81 |
| PF05957 | DUF883 | 0.81 |
| PF04326 | AlbA_2 | 0.81 |
| PF02687 | FtsX | 0.81 |
| PF13505 | OMP_b-brl | 0.81 |
| PF07690 | MFS_1 | 0.81 |
| PF03450 | CO_deh_flav_C | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 26.02 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 3.25 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 0.81 |
| COG4575 | Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.29 % |
| All Organisms | root | All Organisms | 31.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.88% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.06% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.06% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.06% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.25% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.44% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.44% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.63% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_01908310 | 2140918013 | Soil | MGPDELADFDERTFRQWDRASLFDLRRAIERRRREF |
| MBSR1b_0866.00001320 | 2162886012 | Miscanthus Rhizosphere | MGPDELADFDERTFRQWDRASLFDLRRAIERRRREFAG |
| ICCgaii200_05512851 | 2228664021 | Soil | MGPDELTDFEARTFRQWDRASLGDLRRAIERRWRELAGYSPGRAR |
| ICChiseqgaiiFebDRAFT_110432953 | 3300000363 | Soil | ELADFEERTFRQWDRASLRALRIAIDRRRQELLR* |
| INPhiseqgaiiFebDRAFT_1056244414 | 3300000364 | Soil | KSRRDDGPDELADFEERTFRQCERASLWELRRAIERRRKELAT* |
| JGI1027J11758_129054512 | 3300000789 | Soil | MGPDELADFEERTFRQWDRASLGDLRWAMQRRRKELIG* |
| JGI10216J12902_1174665573 | 3300000956 | Soil | GPDELADFEERTFRQWERASLSALRIAIDRRRRELAG* |
| Ga0070676_100873051 | 3300005328 | Miscanthus Rhizosphere | VGQACRHDGPDELADFEERTFRQWDRESLFDLRRAIERRRREFAG* |
| Ga0070683_1009697672 | 3300005329 | Corn Rhizosphere | VKLVATMGPDELADFEARTFKQWDRASLVAVRRAIDARRRELAS* |
| Ga0068868_1021722962 | 3300005338 | Miscanthus Rhizosphere | LVATMGPDELADFDERTFRQWDRASLFDLRRAIERRWRELGERR* |
| Ga0070691_108195341 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VALWVKLVATMGPDELADFEARTFGTWDRASLVAVRRAIDAR |
| Ga0070669_1001183331 | 3300005353 | Switchgrass Rhizosphere | VKLIATMGPDELADFEARTFTQWDRASLGDLRIAIQRPRRELTR* |
| Ga0070675_1011476332 | 3300005354 | Miscanthus Rhizosphere | ATMGPDELADFEARTFRQWDRGSLSAVRIAIDRRRREFAG* |
| Ga0070663_1004167961 | 3300005455 | Corn Rhizosphere | TMGPDELADFEARTFRQWDRASLGALRIAIDRRRRELSA* |
| Ga0070678_1019927762 | 3300005456 | Miscanthus Rhizosphere | VKLVATMGPDELADFEARTFKQWDRASLSALRIAIDRRRKE |
| Ga0070662_1004308831 | 3300005457 | Corn Rhizosphere | TMGPDELADFEERTFRQWDRASLFDLRRAIERRWRELGERR* |
| Ga0070662_1019575762 | 3300005457 | Corn Rhizosphere | KIIATMGPDELRDFEERTFRQWDGASIAHRSGPNDARRRELAG* |
| Ga0070693_1008005742 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLVATMGPDELADFEARTFKQWDRASLSALRIAIDRRRRALGG* |
| Ga0070665_1005043831 | 3300005548 | Switchgrass Rhizosphere | SDSRIKLIATTGADELADFKARTFKQWDRASLVAVRRSIDARRRELAS* |
| Ga0070665_1012910641 | 3300005548 | Switchgrass Rhizosphere | MGPDELADFEERTFRQWDRASLRALRIAIDRRRQELLR* |
| Ga0070664_1000497945 | 3300005564 | Corn Rhizosphere | MGPDELADFDERTFRQWDRASLLDLRRAIERRRREFAG* |
| Ga0068857_1002152922 | 3300005577 | Corn Rhizosphere | MGPDELTDFEARTFKQWDRSSLSAVRIAIDRRRKDLAG* |
| Ga0068854_1004067042 | 3300005578 | Corn Rhizosphere | MGPDELADFEARTFKQWDRASLSALRVAIDRRRKELAR* |
| Ga0068854_1013382552 | 3300005578 | Corn Rhizosphere | VGELVATMGHDELADFEARTFKQWDRASLRAVRIAIDRRRKELTR* |
| Ga0070702_1010915022 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTGADELADFKARTFKQWDRASLVAVRRSIDARRRELAS* |
| Ga0068859_1004083931 | 3300005617 | Switchgrass Rhizosphere | TMRPDELEDFEARTFKQWDRASLTALRIAIDRRRKELDR* |
| Ga0068859_1022279521 | 3300005617 | Switchgrass Rhizosphere | MGPDELADFDERTFRQWDRASLFDLRRAIERRRRELAE* |
| Ga0068861_1018639731 | 3300005719 | Switchgrass Rhizosphere | GPDELADFDERTFRQWDRASLFDLRRAIERRRRELAE* |
| Ga0068858_1000936271 | 3300005842 | Switchgrass Rhizosphere | GPDELADFDERTFRQWDRASLFDLRRAIERRRREFAG* |
| Ga0068858_1002046051 | 3300005842 | Switchgrass Rhizosphere | MGPDELADFEARTFKQRDRASLSAVRIAIDRRRRELAG* |
| Ga0068860_1009876333 | 3300005843 | Switchgrass Rhizosphere | PDELADFEERTFRRWERASLGDLRCAVERRRDVGR* |
| Ga0068860_1020330941 | 3300005843 | Switchgrass Rhizosphere | VKLVATMGPDELADFEARTFKQWDRASLSALRIAIDRRRRELAG* |
| Ga0075428_1001457915 | 3300006844 | Populus Rhizosphere | MDGAQLDDFERRTFRDWDRASLSDVWIAIDRRRRELAG* |
| Ga0075428_1018655422 | 3300006844 | Populus Rhizosphere | VNVVAAMGPDELADFEARTFRQWDRESLGDLRWAIERRRRELAQ* |
| Ga0075431_1008804861 | 3300006847 | Populus Rhizosphere | VASMGPDELADFEERTFRQWNRASLFDLRRAIERRRQELAG* |
| Ga0075431_1009918162 | 3300006847 | Populus Rhizosphere | MGPDELADFEERTFKQWDRASLGNLRHAIDRRRRELFG* |
| Ga0075420_1001644265 | 3300006853 | Populus Rhizosphere | TLVAAMGPDELHDFEERTFRQWDRTSLGDLRRAIERRRRELAG* |
| Ga0075434_1000487105 | 3300006871 | Populus Rhizosphere | QEVASMGPDELDAFEHETFRQWDRASLIPVRRAIDQRRRELAG* |
| Ga0068865_1001575552 | 3300006881 | Miscanthus Rhizosphere | MGPDELADFEARTFKQWDRASLSALRIAIDRRRKELAR* |
| Ga0075424_1015126141 | 3300006904 | Populus Rhizosphere | PDELADFEARTFKQWDRGSLGELRRAIQARRRELAG* |
| Ga0079218_116305262 | 3300007004 | Agricultural Soil | VKLVASMGPDELHDFEARTFRQWDRASLSEVRRAVDRRRRELAR* |
| Ga0079218_117003692 | 3300007004 | Agricultural Soil | VASMGPDELESFEERTFRQWDRASLGELRRAIERRRKELAG* |
| Ga0079218_133663552 | 3300007004 | Agricultural Soil | ELADFEERTFRQWDRSSLGELRGAIEYRRRQLAR* |
| Ga0111539_101505382 | 3300009094 | Populus Rhizosphere | MGPDELADFEERTFRQWDRASLFDLRRAIERRRRELGS* |
| Ga0075418_103088984 | 3300009100 | Populus Rhizosphere | VGHARCDDGPDELADFEERTFRQWDRASLFDLRRAIERRRRELGS* |
| Ga0114129_119486821 | 3300009147 | Populus Rhizosphere | VKLVATMGPDELADFEARTFKQWDRASLAALRIAIDRRRKEMAR* |
| Ga0105243_113957062 | 3300009148 | Miscanthus Rhizosphere | DELESFEERSFRQWDRASLGDLRRTIDRRRRELGG* |
| Ga0111538_138045472 | 3300009156 | Populus Rhizosphere | MGPDEFESFELRTFPTCDRASLGDLRRAAELELRRKEFAG* |
| Ga0075423_104994521 | 3300009162 | Populus Rhizosphere | MGPDELADFEARTFRQWDRESLGDLRWAIERRRRELAQ* |
| Ga0105248_101285991 | 3300009177 | Switchgrass Rhizosphere | NLVATMGPDELADFEERTFRQWDRASLRALRIAIDRRRQELLR* |
| Ga0105248_101415436 | 3300009177 | Switchgrass Rhizosphere | MGPDELDSFEERTFRQWDPASLGDLRRAIDRRRGELSR* |
| Ga0126307_111676332 | 3300009789 | Serpentine Soil | MGPDDLESFERRTVAAWDRALLGDPRRAIERRRKELAG* |
| Ga0126305_100091855 | 3300010036 | Serpentine Soil | MGPDDLESFERRTFAAWDRALLGDPRRAIERRRKELAG* |
| Ga0126304_109162271 | 3300010037 | Serpentine Soil | MGPDDLESFERRTFAAWDRALLGDPRRAIERRRKEL |
| Ga0126312_103103562 | 3300010041 | Serpentine Soil | MTATMGLDELESFKRRTFAQSDRASLGDLRRAIERRRKELAG* |
| Ga0126314_112709201 | 3300010042 | Serpentine Soil | MGPDELESFAQRTFATWDRGSLGELRRAIERRRKELGQ* |
| Ga0105239_106248764 | 3300010375 | Corn Rhizosphere | ATMGPDELADFEERTFRQWDRASLRALRIAIDRRRQELLR* |
| Ga0134123_108696701 | 3300010403 | Terrestrial Soil | MGPDEFADFEARTFKQWDRASLSALRIAIDRRRKELAR* |
| Ga0105246_104322272 | 3300011119 | Miscanthus Rhizosphere | MGPDELADFDERTFRQWDRASLFDLRRAIERRRREFAG* |
| Ga0157323_10521492 | 3300012495 | Arabidopsis Rhizosphere | MGPDELADFDERTFRQWDCASLFDLRRAIERRRRELAE* |
| Ga0157352_10615353 | 3300012519 | Unplanted Soil | MGPDELADFDERTFRHWDRASLFDLRRAIERRRRELAE* |
| Ga0157296_100739263 | 3300012905 | Soil | DELADFDERTFRQWDRASLFDLRRAIERRRREFAG* |
| Ga0157297_100610911 | 3300012914 | Soil | MGPDELADFEERTFRQWNRASLFDLRRAIERRRQELAG* |
| Ga0126375_104969052 | 3300012948 | Tropical Forest Soil | LRSVAEGPDELADFEARTFKQWDRASLSAVRIAIDRRRREL |
| Ga0126375_108403411 | 3300012948 | Tropical Forest Soil | VDLVATIGPDELADFEAGTFRQWDRPSLTAVRIAIDKRRREHGGIS* |
| Ga0164299_101281522 | 3300012958 | Soil | MGPDELADFEARTFKQWARASLSALRIAIDRRRREVGA* |
| Ga0164309_102254081 | 3300012984 | Soil | PDEIDDFERRTFAAWDRSSLGDLRRAIERRRRELAG* |
| Ga0157374_101996583 | 3300013296 | Miscanthus Rhizosphere | MSPDELADFDERTFRQWDRASLLDLRRAIERRRREFAG* |
| Ga0157374_125022662 | 3300013296 | Miscanthus Rhizosphere | MGPGELTDFEARTFKQWDRASLSALRVAIDRTRQELGDRR* |
| Ga0157378_117886632 | 3300013297 | Miscanthus Rhizosphere | MGRDELADFEARTFKQWDRVSLGELRRAIERRTKELAG* |
| Ga0163162_104472751 | 3300013306 | Switchgrass Rhizosphere | LVKSMGPDELESFEERTFRQWDRASLGDLRRTIDRRRRELGG* |
| Ga0157372_132247962 | 3300013307 | Corn Rhizosphere | KLVASMGPDELTPFEERTFKQWDRTSLSAVRIAIDRRRRELGT* |
| Ga0157380_105870562 | 3300014326 | Switchgrass Rhizosphere | MGPDELESFERRTFSASDRASLGDLRLAIERRRRELAG* |
| Ga0157380_117859792 | 3300014326 | Switchgrass Rhizosphere | VKLVATMGPDELEDFEARTFKQWDRASLSALRIAIDRRRKELDR* |
| Ga0157380_133457731 | 3300014326 | Switchgrass Rhizosphere | MAPDALADFEERTFKQWDRASLGDLRVAIQRRHRELAR* |
| Ga0157377_117277362 | 3300014745 | Miscanthus Rhizosphere | KLIATTGADELADFKARTFKQWDRASLVAVRRSIDARRRELAS* |
| Ga0173483_105568101 | 3300015077 | Soil | DELADFDERTFRQWDRASLLDLRRAIERRRREFAG* |
| Ga0132258_104961012 | 3300015371 | Arabidopsis Rhizosphere | VKLVATMGPDELADFEARTFKQWDRVSLSALRVAIDRRRKELAG* |
| Ga0132258_115006642 | 3300015371 | Arabidopsis Rhizosphere | MASDELTDFERRTFAAWNRASLGDVRRAIERRRRDLAGG* |
| Ga0132258_123964004 | 3300015371 | Arabidopsis Rhizosphere | VKLIATMGPDELADFEARTFKQWDRASLSALRIAIDRRRREFGA* |
| Ga0132255_10001555313 | 3300015374 | Arabidopsis Rhizosphere | MGPDELADFDERTFRQWDRASLFDLRRATERRRRELAE* |
| Ga0132255_1025953632 | 3300015374 | Arabidopsis Rhizosphere | VKLVATMGPDELTDFEARTFKQWDRASLSALRIAIDRRRRELAG* |
| Ga0190274_118974332 | 3300018476 | Soil | LPDELESFAEHTFAMWDRASLGDLRRAIERRRKKLAG |
| Ga0207697_105446431 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | RLYGPHELTDFEKRTFKQWDRASPSAVRIAIDRRRREIGA |
| Ga0207656_101382613 | 3300025321 | Corn Rhizosphere | MGPDELADFDERTFRQWDRASLLDLRRAIERRRREFAG |
| Ga0207642_100051733 | 3300025899 | Miscanthus Rhizosphere | MGPDELADFEARTFKQWDRASLSALRIAIDRRRKELAR |
| Ga0207645_100000961 | 3300025907 | Miscanthus Rhizosphere | PDELADFEERTFRQWNRASLFDLRRAIERRRQELAG |
| Ga0207645_100276525 | 3300025907 | Miscanthus Rhizosphere | TMRPDELEDFEARTFKQWDRASLTALRIAIDRRRKELDR |
| Ga0207660_103126263 | 3300025917 | Corn Rhizosphere | GMGPDELADFEARTFRQWDRASLGALRIAIDRRRRELSA |
| Ga0207662_105064912 | 3300025918 | Switchgrass Rhizosphere | MGPDELADFDERTFRQWDRASLFDLRRATERRRRELAE |
| Ga0207649_101364462 | 3300025920 | Corn Rhizosphere | VKLVATMGPDELADFEARTFKQWDRASLVAVRRAIDARRRELAS |
| Ga0207649_101653811 | 3300025920 | Corn Rhizosphere | VKLVATMGPDELTDFEARTFKQWDRSSLSAVRIAIDRRRKDLAG |
| Ga0207659_106684432 | 3300025926 | Miscanthus Rhizosphere | MGPDELESFERRTFAAWDRASLGALSRAIERRRKELAR |
| Ga0207659_108936843 | 3300025926 | Miscanthus Rhizosphere | DALEDFEGRTFAVWDRASLGDLRRAIDRRRREFDRDANRP |
| Ga0207644_110648272 | 3300025931 | Switchgrass Rhizosphere | MGRDELDAFERRTFAAWDRASLGDLRISIQRRRRELAG |
| Ga0207706_115994981 | 3300025933 | Corn Rhizosphere | MGPDELESFERRTFTASDRASLGDLRLAIERRRRELAG |
| Ga0207670_112743173 | 3300025936 | Switchgrass Rhizosphere | NLVATMGPDELADFEERTFRQWDRASLRALRIAIDRRRQELLR |
| Ga0207704_101037543 | 3300025938 | Miscanthus Rhizosphere | VGEVGRVDGPDELADFEERTFKQWDRASLSTLRIAIDRRRRELAG |
| Ga0207711_106974711 | 3300025941 | Switchgrass Rhizosphere | MGPDELDSFEERTFRQWDPASLGDLRRAIDRRRGELSR |
| Ga0207661_109031421 | 3300025944 | Corn Rhizosphere | MGPDELADFEERTFRTWDRASLSNLRIAIDRRRRELAR |
| Ga0207679_101440414 | 3300025945 | Corn Rhizosphere | GPDELESFAQRTFATWDRASLGDLRRAIERRRRELAG |
| Ga0207668_101469621 | 3300025972 | Switchgrass Rhizosphere | DELESFEERTFRQWDRASLGDLRRTIDRRRRELGG |
| Ga0207658_112477851 | 3300025986 | Switchgrass Rhizosphere | PDELADFDERTFRQWDRASLLDLRRAIERRRREFAG |
| Ga0207641_115499011 | 3300026088 | Switchgrass Rhizosphere | LVATIGPDELADFDERTFRQWDRASLLDLRRAIERRRREFAG |
| Ga0207674_101283593 | 3300026116 | Corn Rhizosphere | MGPDELTDFEARTFKQWDRSSLSAVRIAIDRRRKDLAG |
| Ga0207428_102705471 | 3300027907 | Populus Rhizosphere | GPDELADFEARTFKQWDRASLAALRIAIDRRRKEMAR |
| Ga0207428_113178692 | 3300027907 | Populus Rhizosphere | ATMGPDELADFEARTFKQWDRASLVAVRRSIDARRRELAS |
| Ga0209382_101176322 | 3300027909 | Populus Rhizosphere | MDGAQLDDFERRTFRDWDRASLSDVWIAIDRRRRELAG |
| Ga0310888_100456232 | 3300031538 | Soil | MGPDELADFDERTFCQWDRASLFDLRRAIERRRRELAE |
| Ga0310887_108505842 | 3300031547 | Soil | LWVNLVAKMGPDELADFEERTFRQWNRASLFDLRRAIERRRQELAG |
| Ga0307408_1000036669 | 3300031548 | Rhizosphere | MCPDELADFEERTFRQWDRASLSVVRIAIDRRRRELGGKA |
| Ga0310886_101180171 | 3300031562 | Soil | ATMGPDELADFEARTFKQRDRASLSAVRIAIDRRRRELAG |
| Ga0310813_106924391 | 3300031716 | Soil | MGQHKLAGFETRTFRQWDRSSLGNLRRAIQQRRRELAR |
| Ga0310813_111114562 | 3300031716 | Soil | MGPDELADFDERTFRQWDRASLFDLRRAIERRRRELA |
| Ga0307410_120357911 | 3300031852 | Rhizosphere | DELESFEHRTFTAWDRASLGDLRRAIERRRKELAG |
| Ga0310904_102369792 | 3300031854 | Soil | MGPTKLADFEARTFKQWDRASLSAVRIAIDRRRRELAG |
| Ga0307407_112107081 | 3300031903 | Rhizosphere | MGPDELESFEERTFRQWDRASLGDVRRAIERRRREFAG |
| Ga0310891_100658222 | 3300031913 | Soil | MGPDELADFDERTFRQWDRASLFDLRRAIERRRRELAE |
| Ga0310891_103322982 | 3300031913 | Soil | SRELDEFQRRTFAAWDAASLGDLRRAIERRRRELAR |
| Ga0307409_1017645482 | 3300031995 | Rhizosphere | RWLFGRPSLKSSQERTFRRWDHASLGDLRRAIERRRRELAG |
| Ga0307409_1026883931 | 3300031995 | Rhizosphere | MGPDELESFAERTYRQWDRASLGELRRAIERRRREFAG |
| Ga0310906_113446891 | 3300032013 | Soil | MRPDELAGFEERTFRQWDRASLSALRIAIDHRRKELAR |
| Ga0373958_0090903_571_702 | 3300034819 | Rhizosphere Soil | ETRRHDESRELDEFQRRTFAAWDSASLGDLRRAIERRRRELAR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |