NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069891

Metagenome / Metatranscriptome Family F069891

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069891
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 40 residues
Representative Sequence MTFDDILDQVIALLKRQGRVSYGAMKRRFDLDDAYLEDLK
Number of Associated Samples 94
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 93.33 %
% of genes near scaffold ends (potentially truncated) 85.37 %
% of genes from short scaffolds (< 2000 bps) 94.31 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.545 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil
(20.325 % of family members)
Environment Ontology (ENVO) Unclassified
(29.268 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.902 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.12%    β-sheet: 0.00%    Coil/Unstructured: 55.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF01726LexA_DNA_bind 4.07
PF01494FAD_binding_3 3.25
PF00903Glyoxalase 2.44
PF13374TPR_10 2.44
PF01070FMN_dh 2.44
PF00582Usp 1.63
PF02615Ldh_2 1.63
PF13714PEP_mutase 1.63
PF04909Amidohydro_2 1.63
PF13700DUF4158 1.63
PF13424TPR_12 1.63
PF13669Glyoxalase_4 1.63
PF13191AAA_16 0.81
PF00106adh_short 0.81
PF12862ANAPC5 0.81
PF05443ROS_MUCR 0.81
PF03781FGE-sulfatase 0.81
PF01738DLH 0.81
PF03050DDE_Tnp_IS66 0.81
PF01966HD 0.81
PF07992Pyr_redox_2 0.81
PF01609DDE_Tnp_1 0.81
PF04986Y2_Tnp 0.81
PF00211Guanylate_cyc 0.81
PF14279HNH_5 0.81
PF07592DDE_Tnp_ISAZ013 0.81
PF03372Exo_endo_phos 0.81
PF13522GATase_6 0.81
PF10049DUF2283 0.81
PF13384HTH_23 0.81
PF13452MaoC_dehydrat_N 0.81
PF00296Bac_luciferase 0.81
PF04952AstE_AspA 0.81
PF05107Cas_Cas7 0.81
PF12681Glyoxalase_2 0.81
PF13358DDE_3 0.81
PF07721TPR_4 0.81
PF07883Cupin_2 0.81
PF12974Phosphonate-bd 0.81
PF03400DDE_Tnp_IS1 0.81
PF03683UPF0175 0.81
PF01844HNH 0.81
PF00561Abhydrolase_1 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 6.50
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 3.25
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 3.25
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 3.25
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 2.44
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 2.44
COG2055Malate/lactate/ureidoglycolate dehydrogenase, LDH2 familyEnergy production and conversion [C] 1.63
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.81
COG1662Transposase and inactivated derivatives, IS1 familyMobilome: prophages, transposons [X] 0.81
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.81
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.81
COG2886Predicted antitoxin, contains HTH domainGeneral function prediction only [R] 0.81
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.81
COG3293TransposaseMobilome: prophages, transposons [X] 0.81
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.81
COG3436TransposaseMobilome: prophages, transposons [X] 0.81
COG3649CRISPR-Cas system type I effector complex subunit Cas7, RAMP superfamilyDefense mechanisms [V] 0.81
COG4957Predicted transcriptional regulatorTranscription [K] 0.81
COG5421TransposaseMobilome: prophages, transposons [X] 0.81
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.81
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.54 %
UnclassifiedrootN/A28.46 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459021|G14TP7Y01ENX0ZAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium657Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0638149All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100335918Not Available1108Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100838313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1735Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105522221All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300000787|JGI11643J11755_11779324Not Available722Open in IMG/M
3300000858|JGI10213J12805_10242072All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300004268|Ga0066398_10114920All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005331|Ga0070670_101158332All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300005332|Ga0066388_103249735All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300005332|Ga0066388_104830427All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300005332|Ga0066388_105369172All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300005447|Ga0066689_10701379All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005598|Ga0066706_11108728All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300005719|Ga0068861_100337132All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300006058|Ga0075432_10093657All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300006796|Ga0066665_11191410All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium581Open in IMG/M
3300006845|Ga0075421_100467004All Organisms → cellular organisms → Bacteria1505Open in IMG/M
3300006846|Ga0075430_100164955All Organisms → cellular organisms → Bacteria1843Open in IMG/M
3300006852|Ga0075433_11187120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium663Open in IMG/M
3300006853|Ga0075420_100081874All Organisms → cellular organisms → Bacteria2856Open in IMG/M
3300006853|Ga0075420_100411103All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300006853|Ga0075420_100478457All Organisms → cellular organisms → Bacteria1076Open in IMG/M
3300006853|Ga0075420_101043540All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7703Open in IMG/M
3300006854|Ga0075425_101512078All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300006954|Ga0079219_12111027All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300007255|Ga0099791_10336800All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300007265|Ga0099794_10404647All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Handelsmanbacteria → Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10713Open in IMG/M
3300009012|Ga0066710_101721067All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300009038|Ga0099829_10364469All Organisms → cellular organisms → Bacteria → Proteobacteria1191Open in IMG/M
3300009089|Ga0099828_10390071All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300009090|Ga0099827_11471028All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300009098|Ga0105245_10175133All Organisms → cellular organisms → Bacteria2046Open in IMG/M
3300009137|Ga0066709_100518770All Organisms → cellular organisms → Bacteria1681Open in IMG/M
3300009137|Ga0066709_101469047All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300009147|Ga0114129_13258728Not Available526Open in IMG/M
3300009156|Ga0111538_11258773Not Available934Open in IMG/M
3300009162|Ga0075423_11222489All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300009444|Ga0114945_10509107Not Available725Open in IMG/M
3300009610|Ga0105340_1542970Not Available519Open in IMG/M
3300009792|Ga0126374_10545496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4845Open in IMG/M
3300009821|Ga0105064_1111650Not Available566Open in IMG/M
3300010047|Ga0126382_12102018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium540Open in IMG/M
3300010359|Ga0126376_10580335Not Available1056Open in IMG/M
3300010359|Ga0126376_12465552All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010360|Ga0126372_10434393All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300010360|Ga0126372_11651982Not Available681Open in IMG/M
3300010360|Ga0126372_12322372Not Available586Open in IMG/M
3300010362|Ga0126377_10726381All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300010362|Ga0126377_10900568Not Available947Open in IMG/M
3300010362|Ga0126377_13051244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium541Open in IMG/M
3300010366|Ga0126379_10794699All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300010366|Ga0126379_12270191All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300010366|Ga0126379_12831452All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis580Open in IMG/M
3300010366|Ga0126379_13233232All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina545Open in IMG/M
3300010376|Ga0126381_102866955All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300010398|Ga0126383_10314349All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300010398|Ga0126383_10371250All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300010398|Ga0126383_13440605Not Available517Open in IMG/M
3300011269|Ga0137392_11116009All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300012199|Ga0137383_11041436All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300012202|Ga0137363_11600862Not Available543Open in IMG/M
3300012206|Ga0137380_10787943All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300012359|Ga0137385_10998090All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella690Open in IMG/M
3300012361|Ga0137360_10408822All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina1145Open in IMG/M
3300012361|Ga0137360_10527090All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1007Open in IMG/M
3300012685|Ga0137397_10573317Not Available840Open in IMG/M
3300012917|Ga0137395_10511499All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300012917|Ga0137395_10540912Not Available840Open in IMG/M
3300012925|Ga0137419_11903382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19510Open in IMG/M
3300012927|Ga0137416_10955777All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Handelsmanbacteria → Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10764Open in IMG/M
3300012929|Ga0137404_11101219All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300012930|Ga0137407_12167565Not Available531Open in IMG/M
3300012948|Ga0126375_10619243All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300012948|Ga0126375_11411562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium591Open in IMG/M
3300012948|Ga0126375_11443789Not Available585Open in IMG/M
3300012948|Ga0126375_11654167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium553Open in IMG/M
3300012971|Ga0126369_11618366All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Limnoglobus → Limnoglobus roseus737Open in IMG/M
3300012971|Ga0126369_12136083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium647Open in IMG/M
3300014154|Ga0134075_10587809Not Available504Open in IMG/M
3300014325|Ga0163163_11551776All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300015241|Ga0137418_10524276All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella943Open in IMG/M
3300015371|Ga0132258_13349784All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella1102Open in IMG/M
3300016357|Ga0182032_10437605All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300017997|Ga0184610_1146713All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300018077|Ga0184633_10551142Not Available551Open in IMG/M
3300018082|Ga0184639_10306267Not Available834Open in IMG/M
3300018433|Ga0066667_12355650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium500Open in IMG/M
3300019238|Ga0180112_1281512Not Available624Open in IMG/M
3300021073|Ga0210378_10352399All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300021560|Ga0126371_11937967All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis sulfate-reducing endosymbiont708Open in IMG/M
3300022195|Ga0222625_1175316Not Available1076Open in IMG/M
3300025961|Ga0207712_10443413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium1100Open in IMG/M
3300025981|Ga0207640_11159520All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300026142|Ga0207698_12022821All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300027655|Ga0209388_1235988Not Available500Open in IMG/M
3300027873|Ga0209814_10137122Not Available1047Open in IMG/M
3300027874|Ga0209465_10454599All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300027882|Ga0209590_10589675Not Available715Open in IMG/M
3300027907|Ga0207428_10894395Not Available627Open in IMG/M
3300027952|Ga0209889_1099800All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300028536|Ga0137415_10481712All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300028536|Ga0137415_10527573All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Handelsmanbacteria → Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10990Open in IMG/M
3300028608|Ga0247819_10394886All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium797Open in IMG/M
3300030006|Ga0299907_10306860All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300030006|Ga0299907_11346694All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis505Open in IMG/M
3300030570|Ga0247647_1000564All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella2357Open in IMG/M
3300030570|Ga0247647_1003629All Organisms → cellular organisms → Bacteria1631Open in IMG/M
3300031573|Ga0310915_11267895Not Available508Open in IMG/M
3300031740|Ga0307468_101779494Not Available583Open in IMG/M
3300031912|Ga0306921_10128277All Organisms → cellular organisms → Bacteria2959Open in IMG/M
3300031946|Ga0310910_11316819All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300031965|Ga0326597_12081431All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300032075|Ga0310890_10209874All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300032075|Ga0310890_10788915Not Available751Open in IMG/M
3300032075|Ga0310890_11846449Not Available503Open in IMG/M
3300032076|Ga0306924_10954006Not Available945Open in IMG/M
3300032211|Ga0310896_10262678Not Available878Open in IMG/M
3300032261|Ga0306920_100549246All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1712Open in IMG/M
3300033551|Ga0247830_10220717All Organisms → cellular organisms → Bacteria1424Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil20.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.06%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.25%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.44%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.63%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.81%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459021Litter degradation NP4EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009821Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027952Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030570Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4NP_009102202170459021Switchgrass, Maize And Mischanthus LitterMTFDEILEQVIALLKRQGRVSYPALKIRFSLDDEYLEALKAELLYV
ICChiseqgaiiDRAFT_063814913300000033SoilMTFDDILDQILDLLRRQGRVSYWALKRRFDLHDDDIAGLKD
INPhiseqgaiiFebDRAFT_10033591813300000364SoilMSFDDILEQVITLLKRQGRVSYPDLKIRFTLDDEY
INPhiseqgaiiFebDRAFT_10083831313300000364SoilMDFADILEQTIALLQHQGRISYGALKRRFGLDDAYLD
INPhiseqgaiiFebDRAFT_10552222123300000364SoilMTFDDLLAQVLTLLQQQGRVSYGALKRRFGLDDAYLDDLKAELIDA
JGI11643J11755_1177932413300000787SoilMTFDEIHAQITDLLKRQGRVSYGALKRRYDLDDAYL
JGI10213J12805_1024207223300000858SoilMTFDEILEQVLALLKRQGRVSYSAIKRRFDLNDDYL
Ga0066398_1011492023300004268Tropical Forest SoilMSFDEILAQIIEVLKTQGRVSYGALKRRYNLEDAYLDDLKDEIIHA
Ga0070670_10115833223300005331Switchgrass RhizosphereMEFDEILTQAIELLQRQGRISYGALKRRFHLDDEHLADLK
Ga0066388_10324973523300005332Tropical Forest SoilMEFEDVLAQTIALLQRQGRISYSALKRRFQLDDTYLDDLKVELIEGV*
Ga0066388_10483042713300005332Tropical Forest SoilMTFDDILDQILDLLRRQGRVSYWALKRRFALHDDDIAGLK
Ga0066388_10536917213300005332Tropical Forest SoilMEFEAVLEQIIALLQSQGRVSYGALKRRFKLDDAYLEDLK
Ga0066689_1070137913300005447SoilMEFEAVLEQTIALLQRQGRISYGALKRRFNLDDAYLEDLK
Ga0066695_1082038323300005553SoilMTFDEILDQVRDLRQQRGRVSSQALKRRFELDDAYLD
Ga0066706_1110872823300005598SoilMEFEAVLEQTIALLQRQGRISYGALKRRFNLDDAYLEDL
Ga0068861_10033713223300005719Switchgrass RhizosphereMTFDEILEQVIALLWCQKRVAYGALQRRFNLDDAYLEDPKADLILL*
Ga0075024_10090350813300006047WatershedsMSFDEILDQVRELLRQRGRLSYGALKRRFDLDDAYVE
Ga0075432_1009365713300006058Populus RhizosphereMTFDDILDQILDLLRRQGRVSYWALKRRFDLHDDDIVGLK
Ga0066665_1119141023300006796SoilMTFDEILDQIITLLKRQGRVSYSALKRRFDLNDDYLNDLK
Ga0075421_10046700413300006845Populus RhizosphereMTFDDVLEQLVTLLKRQGRVSYRALKMRFNLDDEY
Ga0075430_10016495513300006846Populus RhizosphereMTFDDILDQVITLLKRQGRVSYRALKMRFNLDDEY
Ga0075433_1118712023300006852Populus RhizosphereMTFDEILDQGITLLKRQGRVSYTALKIRFSLDDDSS*
Ga0075420_10008187413300006853Populus RhizosphereMTFDEILEQVITLLKRQGRVLYPALKIRFSLDDEYLEALK
Ga0075420_10041110313300006853Populus RhizosphereMEFEAVLEQTIALLQRQGRISYGALKRRFQLDDAY
Ga0075420_10047845733300006853Populus RhizosphereMTFDDILDQVITLLKRQGRVSYSALKRRFDLDDDYL
Ga0075420_10104354013300006853Populus RhizosphereMTFDEMLEQVITLLKRQERVSSSALKRRFDLGDDYLKDLKDELLHGG*
Ga0075425_10151207823300006854Populus RhizosphereMTFDDLLAQVLTLLQQQGRVSYGALKRRFGLDDAYLDDLKAELI
Ga0079219_1211102723300006954Agricultural SoilMTFDEILAQIIDLLKRQGRVSYPALKIRFSLDDDYLEALKA
Ga0099791_1033680023300007255Vadose Zone SoilMTFDELLEQVVDLLQRQDRVSYGALKRRFALDDDYLRI*
Ga0099794_1040464733300007265Vadose Zone SoilADILEQTIVLLQHQGRISYGALKRRFSLDDAYLEDLTRLW*
Ga0066710_10172106733300009012Grasslands SoilVNFDEMLEQVLALVQRQGRVSYRALKRRFDLDDAYLEGHWFS
Ga0099829_1036446913300009038Vadose Zone SoilMTFDEILTQVVELLQRQGRVSYGALKRRFALDDDY
Ga0099828_1039007113300009089Vadose Zone SoilMEFAEILEQTIALLQHQGRISYGALKRRFGLHDAYL
Ga0099827_1147102823300009090Vadose Zone SoilMTFDDILDQVIALLKRQGRVSYGAMKRRFDLDDAYLEDLK
Ga0105245_1017513313300009098Miscanthus RhizosphereMTFDDILDQVIALLQRQGRVSYGAMKRRFALDDAYLEDLKGEILF
Ga0066709_10051877033300009137Grasslands SoilMTFDELLTQVLDLLQRQGRVSYGARKRRFDLDGAYREYLKTEII*
Ga0066709_10146904733300009137Grasslands SoilVNFDEMLEQVLALVQRQGRVSYRALKRRFDLDDAYLEGHWFS*
Ga0114129_1325872823300009147Populus RhizosphereMTFDDILNQVIALLKRQGRVSYGAMKRRFDLDDAYLEDLK
Ga0111538_1125877313300009156Populus RhizosphereMTFDEILAQIIDLLRYQGRVSYGALKYWYTLDNAYLEDLKDVIIK
Ga0075423_1122248913300009162Populus RhizosphereVTFDDILAQVITLLKRQGRVSYPALKIRFSLDDEYLEALRAELL
Ga0114945_1050910733300009444Thermal SpringsMTFDDTLDQILTLLRHQGRVSYWALKRRFDLHDDDIAGLK
Ga0105340_154297013300009610SoilMDRGAAMTFMTFDEILEQVSMLLQRQKRVAYGALKRRFDLDEAYLEDLYERA*
Ga0126374_1054549613300009792Tropical Forest SoilMMFDEILEQVILLLKRQGRVSYPALKIRFSLDDEYLEALK
Ga0105064_111165023300009821Groundwater SandMTFDDVLAQVLALLQRQGRVSYGALKRRFDLDEAYLNDLKTELID
Ga0126382_1210201823300010047Tropical Forest SoilMTFDEILEQVIALLKHQGRVSYPALKIRFSLDDEYLEALK
Ga0126376_1058033513300010359Tropical Forest SoilMTFDELLAQVLDLLQRQGRVSYGALKRRFDLDDAYLASLKT
Ga0126376_1246555213300010359Tropical Forest SoilVTFDDILAQVIALLKRQGRVSYPALKIRFSLDDEY
Ga0126372_1043439313300010360Tropical Forest SoilMTFDDLLTQVLTLLQQQGRIAYGALKRRFGLDDAYLDDLKAELID
Ga0126372_1165198223300010360Tropical Forest SoilMTFDEILDQVITILKRQGRVSYPALKRRFALDDTYIEALK
Ga0126372_1232237213300010360Tropical Forest SoilGGSRMEFEDVLAQTIALLQRQGRISYSALKRRFQLDDTYLDDLKVELIEGV*
Ga0126377_1072638113300010362Tropical Forest SoilMEFEDILEQVIALLQHQGRVSYGALKRRLKLDDDYLED
Ga0126377_1090056823300010362Tropical Forest SoilVTVMTFDDILEQVIALLKRQGRVSYRALTMRFALDD
Ga0126377_1305124423300010362Tropical Forest SoilMTFDEILDQVITLLKRQGRVSYPALKIRFSLDDEYLEALKAEI
Ga0126379_1079469913300010366Tropical Forest SoilMTFEDILAQVLTLLQQQGRVSYGALKRRFGLDDAYLDDLKAELIDV*
Ga0126379_1227019123300010366Tropical Forest SoilVDFDTLLAQITALLQRQGRVSYGALKRRFALDGDYVQDL
Ga0126379_1283145223300010366Tropical Forest SoilMTFDDVLDQVIILLKRQGRVSYPALKIRFSLDDEYLEALK
Ga0126379_1323323213300010366Tropical Forest SoilMTFDDVLEQVVTLLKRQGRVSYRALKMRFNLDDEYLD
Ga0126381_10286695533300010376Tropical Forest SoilVTFDDILAQVIDLLKRQGRVSYPALKIRFGLDDEYLEAL
Ga0126383_1031434923300010398Tropical Forest SoilMTFDDILVQIIDLLKRQGRVSYGALKRRYHLDDAYLED
Ga0126383_1037125013300010398Tropical Forest SoilMTFDEILEQVIALLKHQGRVSYPALKIRFSLDDEYLE
Ga0126383_1344060513300010398Tropical Forest SoilMTFDELRAQILTLLQQQGRVSYGAVTRGYGLDEDYLDDLKAELID
Ga0137392_1111600923300011269Vadose Zone SoilMTFDELLEQVIDLLQRQGRVSYGALKRRFALDDDYLRI*
Ga0137383_1104143623300012199Vadose Zone SoilMTFDELLAQVLDLLQRQGRISYGALKRRFDLDDAYL
Ga0137363_1160086213300012202Vadose Zone SoilMEFADILEQTSVLLQHQGRISYGALKRRFSLDDAYLEDLTRL
Ga0137380_1078794313300012206Vadose Zone SoilMNGGAAMTFDDILEQVIVLLQRQRRVAYGALRRRFALDDAYLED
Ga0137385_1099809013300012359Vadose Zone SoilMTFDDILEQVIALLKRQGRVSYRALRICFDLADAYLD
Ga0137360_1040882213300012361Vadose Zone SoilMTFDEVLAQIIDVLKRQGRVSYGALKRRYALDDAY
Ga0137360_1052709013300012361Vadose Zone SoilMEFAYTLEQTIALLHHQGRISYGALKRRFGLDDAYLEDLTRLW*
Ga0137397_1057331713300012685Vadose Zone SoilMEFADVLEQTMALLEQQGRISYGALKRRFGLDDAYLDDLKIELI
Ga0137395_1051149923300012917Vadose Zone SoilMEFEVVLEQTIALLQRQGRISYGALKRRFQLDDAYLEDLKVE
Ga0137395_1054091213300012917Vadose Zone SoilMTFDEILVQIIDLLKSQGRVSYGAIKRRYHLDDAYLEDLK
Ga0137419_1190338223300012925Vadose Zone SoilMTFDELLAQVLELLQRQGRVSYGALKRRFDLDDAYLQDLKDE
Ga0137416_1095577733300012927Vadose Zone SoilILEQTIVLLQHQGRISYGALKRRFSLDDAYLEDLTRLW*
Ga0137404_1110121923300012929Vadose Zone SoilMRGGAIVTFDDILAQIIDLLKRQGRVSYSALKRRF
Ga0137407_1216756523300012930Vadose Zone SoilMEFAEILTQVIELLQRQGRISYGALKRRFHLDAEYLQDLKDELI
Ga0126375_1061924323300012948Tropical Forest SoilMTFDEILVQIIDLLKRQGRVSYGALKRRFDLDDDYL
Ga0126375_1141156213300012948Tropical Forest SoilMTFDEILEHVITLLKRQGRVSYPALKIRFSLNDEYLEALKAELLYV
Ga0126375_1144378913300012948Tropical Forest SoilMTFDDMLAHIIDLLKRQGRISYGALKRRYNLDDAYLED
Ga0126375_1165416723300012948Tropical Forest SoilMTFDEILDQVITLLKRQGRVSYPALKIRFSLDDEYLE
Ga0126369_1161836613300012971Tropical Forest SoilMTFDDILAQIIDLLKRQGRVSYGALKRRFDLDDAY
Ga0126369_1213608313300012971Tropical Forest SoilMTFDEILEQVIALLKRQGRVSYPALKVRFSLDDEYLEALKAE
Ga0134075_1058780913300014154Grasslands SoilMTFDEILEQVITLLKRQGRVSYPALKIRFSLDDEYLEA
Ga0163163_1155177613300014325Switchgrass RhizosphereMEFDEILTQAIELLQRQGRISYGALKRRFHLDDEY
Ga0137418_1052427613300015241Vadose Zone SoilMTFDEILAQIIDLLKRQGRVSYSALKLRFHLDDDYLNDL
Ga0132258_1334978423300015371Arabidopsis RhizosphereMTFDEILAQITDLLKRQGRVSYGALKRRYDLDDAYLE
Ga0182032_1043760523300016357SoilMTFDDILAQIIDLLKRQGRVSYSALKRRFDLNDDYLN
Ga0184610_114671313300017997Groundwater SedimentMEFDDILGQIIALLQSQGRVSYGALKRRFQLDDDYL
Ga0184633_1055114213300018077Groundwater SedimentMTFDELLAHVLELLQRQGRVSYGALKRRFDLDDAYLDDLKTEL
Ga0184639_1030626723300018082Groundwater SedimentMTFDELLAQVVELLQHQGRVSYGALKRRFALGDDYLQDLKDELIDAQR
Ga0066667_1235565013300018433Grasslands SoilMTFDEILDQIITLLKRQGRVSYSALKRRFDLNDDYLNDLKDE
Ga0180112_128151223300019238Groundwater SedimentMTFDAILDQILDVLRHQGRVSYWALKRRFDLHDDDIA
Ga0210378_1035239923300021073Groundwater SedimentMTFDDVLVQVIALLQRQGRVSYGALKRRFGLDEVYLDDLKTELIDA
Ga0126371_1193796713300021560Tropical Forest SoilMTFDEILEQVIALLKRQGRVSYGALKRRFDLDDTY
Ga0222625_117531623300022195Groundwater SedimentMTFDELLAQVLELLQPQGRVSYGALKRRFSIDDAY
Ga0207712_1044341323300025961Switchgrass RhizosphereMTFDEILEQVIALLWCQKRVAYGALQRRFNLDDAYLEDPKADLILL
Ga0207640_1115952013300025981Corn RhizosphereMEFDEILAQVIELLQRQGRISYGALKRRFHLDDEY
Ga0207698_1202282113300026142Corn RhizosphereMEFDEILTQAIELLQRQGRISYGALKRRFHLDDEYLQ
Ga0209388_123598813300027655Vadose Zone SoilMTFDDILAQVIDLLKSQGRVSYGAIKRRYNLDDAYL
Ga0209814_1013712213300027873Populus RhizosphereMSFDDILEQVITLLKRQGRVSYPALKIRFTLDDEYLEA
Ga0209465_1045459933300027874Tropical Forest SoilVTFDDILAQVIALLKRQGRVSYPALKIRFSLDDEYLEALKA
Ga0209590_1058967523300027882Vadose Zone SoilMEFEEVLEQTIALLQHQGRVSYGALKRRFKLDDTYL
Ga0207428_1089439523300027907Populus RhizosphereMTFDELLSQITDLLQRQGRVSYGALRRRYALDDVYLQDL
Ga0209889_109980013300027952Groundwater SandMTFDDVLVQVIALLQRQGRVSYGALNRRFGLDEVYLDDLKTEL
Ga0137415_1048171233300028536Vadose Zone SoilMTFDEILAQIIDLLKRQGRVSYSALKRRFDLNDDYLNDLKDE
Ga0137415_1052757313300028536Vadose Zone SoilFAYSLQQPIALLQHQGRISYGALKRRFGLDDAYLEDLTRLW
Ga0247819_1039488623300028608SoilMEFADILEQIITLLQHQGRISYGALKRRFGLDDAYLDDLKIELIEA
Ga0299907_1030686013300030006SoilMNFDDILEQVITLLKRQGRVSYSALRRRFEIDEAYLN
Ga0299907_1134669423300030006SoilMNFDEILEQVIALLKRQGRVSYRALKMRFEEIDDEYLDVL
Ga0247647_100056453300030570SoilMTCMTFDEILEQVIMLLQRQKRVAYGALKRRFDLDDAYLEDLYEQA
Ga0247647_100362943300030570SoilMTFDDLLAHVLEILQRQGRVSYGALKRRFALDDAYLEDLK
Ga0310915_1126789523300031573SoilMTFDAILAQVLDLLQHQGRVAYRALKVRFNLDNDYLEAL
Ga0307468_10177949423300031740Hardwood Forest SoilMEFEEVLEQTIALLQRQGRVSYGALKRRFKLDDAYLEDLK
Ga0306921_1012827713300031912SoilMTFDEILAQIIDLLKRQGRVSYPALKIRFSLDDEYLDSIGIFIFCD
Ga0310910_1131681913300031946SoilVTFDDILEQVIALLKRQGRVSYPALKIRFSLDDAYL
Ga0326597_1208143123300031965SoilMTFEEILNQAIALLQRQGRVSYRTLKRQVDLDEAYVEDIKLELIEGHQV
Ga0310890_1020987423300032075SoilMTFDELLSQITDLLQRQGRVSYGALRRRYALDDVYL
Ga0310890_1078891513300032075SoilVTFDEILEQIIALLKRQGRVSYSALKIRFNLTDAYLEAFK
Ga0310890_1184644913300032075SoilMEFEAVLEQTIALLQRQGRISYGALKRRFQLDDAYLE
Ga0306924_1095400613300032076SoilMTFDEILAQIIDLLKRQGRVSYPALKIRFSLDDEYLDSIGI
Ga0310896_1026267813300032211SoilMTFDELLSQITDLLQLQGRVSYGALRRRFDLDEDYLED
Ga0306920_10054924613300032261SoilMTFDAILAQVLDLLQHQGRVAYRALKVRFNLDNDYLEALKDEL
Ga0214471_1091967833300033417SoilMTFDEILDQVRELLRQRGRLTYGAVKRRFDLDEAYLEDIKGELI
Ga0247830_1022071713300033551SoilMTFDDILDQILDVLRRQGRVSYWALKRRFDLHDDDIAGLK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.