Basic Information | |
---|---|
Family ID | F069963 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 123 |
Average Sequence Length | 45 residues |
Representative Sequence | WPAALQQLTGLLADGTWVPMATVHFAAMTAALLAGWMAVRAKG |
Number of Associated Samples | 113 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 13.01 % |
% of genes near scaffold ends (potentially truncated) | 75.61 % |
% of genes from short scaffolds (< 2000 bps) | 86.18 % |
Associated GOLD sequencing projects | 110 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.56 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.309 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (12.195 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.829 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (34.959 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.52% β-sheet: 0.00% Coil/Unstructured: 46.48% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF04014 | MazE_antitoxin | 4.88 |
PF10012 | DUF2255 | 4.07 |
PF00903 | Glyoxalase | 2.44 |
PF02826 | 2-Hacid_dh_C | 2.44 |
PF04909 | Amidohydro_2 | 2.44 |
PF01425 | Amidase | 2.44 |
PF13091 | PLDc_2 | 1.63 |
PF13379 | NMT1_2 | 1.63 |
PF13483 | Lactamase_B_3 | 1.63 |
PF01850 | PIN | 1.63 |
PF00067 | p450 | 1.63 |
PF08240 | ADH_N | 1.63 |
PF02604 | PhdYeFM_antitox | 0.81 |
PF05016 | ParE_toxin | 0.81 |
PF13489 | Methyltransf_23 | 0.81 |
PF00583 | Acetyltransf_1 | 0.81 |
PF05598 | DUF772 | 0.81 |
PF05015 | HigB-like_toxin | 0.81 |
PF09084 | NMT1 | 0.81 |
PF16868 | NMT1_3 | 0.81 |
PF09907 | HigB_toxin | 0.81 |
PF02371 | Transposase_20 | 0.81 |
PF13333 | rve_2 | 0.81 |
PF02668 | TauD | 0.81 |
PF05988 | DUF899 | 0.81 |
PF01381 | HTH_3 | 0.81 |
PF13416 | SBP_bac_8 | 0.81 |
PF00296 | Bac_luciferase | 0.81 |
PF04828 | GFA | 0.81 |
PF00999 | Na_H_Exchanger | 0.81 |
PF08241 | Methyltransf_11 | 0.81 |
PF07690 | MFS_1 | 0.81 |
PF04028 | DUF374 | 0.81 |
PF10592 | AIPR | 0.81 |
PF13343 | SBP_bac_6 | 0.81 |
PF13328 | HD_4 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 2.44 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 1.63 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.81 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.81 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
COG2121 | Uncharacterized conserved protein, lysophospholipid acyltransferase (LPLAT) superfamily | Function unknown [S] | 0.81 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.81 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.81 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.81 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.81 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.81 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.81 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.31 % |
Unclassified | root | N/A | 5.69 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000787|JGI11643J11755_11330260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
3300000891|JGI10214J12806_12139986 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300002223|C687J26845_10242591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
3300004022|Ga0055432_10118654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
3300004145|Ga0055489_10067347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 990 | Open in IMG/M |
3300004463|Ga0063356_106013446 | Not Available | 520 | Open in IMG/M |
3300004643|Ga0062591_101157729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
3300005177|Ga0066690_10787268 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 619 | Open in IMG/M |
3300005180|Ga0066685_10741635 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 670 | Open in IMG/M |
3300005187|Ga0066675_11371007 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 519 | Open in IMG/M |
3300005446|Ga0066686_10238092 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
3300005526|Ga0073909_10248925 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300005558|Ga0066698_10810783 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 605 | Open in IMG/M |
3300005575|Ga0066702_10652412 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300005576|Ga0066708_10619938 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 691 | Open in IMG/M |
3300005873|Ga0075287_1007880 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
3300006049|Ga0075417_10003446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5022 | Open in IMG/M |
3300006049|Ga0075417_10719450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
3300006755|Ga0079222_11820151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 590 | Open in IMG/M |
3300006796|Ga0066665_10489854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1009 | Open in IMG/M |
3300006797|Ga0066659_10146449 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300006806|Ga0079220_12048937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
3300006844|Ga0075428_100063003 | All Organisms → cellular organisms → Bacteria | 4059 | Open in IMG/M |
3300006845|Ga0075421_100210945 | All Organisms → cellular organisms → Bacteria | 2398 | Open in IMG/M |
3300006845|Ga0075421_102190150 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 584 | Open in IMG/M |
3300006845|Ga0075421_102615365 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
3300006847|Ga0075431_100073569 | All Organisms → cellular organisms → Bacteria | 3525 | Open in IMG/M |
3300006854|Ga0075425_100074868 | All Organisms → cellular organisms → Bacteria | 3819 | Open in IMG/M |
3300006854|Ga0075425_100199003 | All Organisms → cellular organisms → Bacteria | 2302 | Open in IMG/M |
3300006865|Ga0073934_10057137 | All Organisms → cellular organisms → Bacteria | 3305 | Open in IMG/M |
3300006876|Ga0079217_10223753 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300006880|Ga0075429_100957793 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 748 | Open in IMG/M |
3300006904|Ga0075424_100884869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
3300007076|Ga0075435_100845185 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
3300007255|Ga0099791_10446512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
3300009078|Ga0105106_11343218 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300009094|Ga0111539_13021042 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300009131|Ga0115027_11558318 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
3300009153|Ga0105094_10333905 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300009162|Ga0075423_10683806 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300009162|Ga0075423_12263085 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300009609|Ga0105347_1111200 | All Organisms → cellular organisms → Bacteria → Calditrichaeota → Calditrichia → Calditrichales → Calditrichaceae → Caldithrix → unclassified Caldithrix → Caldithrix sp. | 1041 | Open in IMG/M |
3300009691|Ga0114944_1255301 | Not Available | 712 | Open in IMG/M |
3300010040|Ga0126308_11349583 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300010322|Ga0134084_10413536 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 529 | Open in IMG/M |
3300010371|Ga0134125_12702306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
3300010397|Ga0134124_11086426 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300010399|Ga0134127_10304751 | All Organisms → cellular organisms → Bacteria | 1536 | Open in IMG/M |
3300010400|Ga0134122_10669028 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300010401|Ga0134121_10260771 | Not Available | 1520 | Open in IMG/M |
3300011119|Ga0105246_11804968 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 584 | Open in IMG/M |
3300011434|Ga0137464_1083888 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300012134|Ga0137330_1034817 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 652 | Open in IMG/M |
3300012179|Ga0137334_1127310 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 576 | Open in IMG/M |
3300012204|Ga0137374_10076827 | All Organisms → cellular organisms → Bacteria | 3257 | Open in IMG/M |
3300012351|Ga0137386_11088189 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
3300012469|Ga0150984_105214125 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
3300012486|Ga0157331_1019063 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300012486|Ga0157331_1020015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
3300012487|Ga0157321_1011402 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300012498|Ga0157345_1029672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 606 | Open in IMG/M |
3300012503|Ga0157313_1008867 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300012511|Ga0157332_1083101 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300012582|Ga0137358_10236745 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300012582|Ga0137358_10396505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 934 | Open in IMG/M |
3300012903|Ga0157289_10045211 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300012931|Ga0153915_10295225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1808 | Open in IMG/M |
3300012931|Ga0153915_11130396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 914 | Open in IMG/M |
3300012961|Ga0164302_10123272 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1478 | Open in IMG/M |
3300012972|Ga0134077_10301604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 673 | Open in IMG/M |
3300013306|Ga0163162_10067323 | All Organisms → cellular organisms → Bacteria | 3632 | Open in IMG/M |
3300014259|Ga0075311_1164230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 516 | Open in IMG/M |
3300015254|Ga0180089_1101125 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 598 | Open in IMG/M |
3300015372|Ga0132256_100276892 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
3300015373|Ga0132257_100165152 | All Organisms → cellular organisms → Bacteria | 2603 | Open in IMG/M |
3300016341|Ga0182035_10840587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300017994|Ga0187822_10269145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
3300018072|Ga0184635_10014380 | All Organisms → cellular organisms → Bacteria | 2823 | Open in IMG/M |
3300018422|Ga0190265_13292160 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 539 | Open in IMG/M |
3300018481|Ga0190271_12387859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
3300019248|Ga0180117_1293023 | Not Available | 539 | Open in IMG/M |
3300019377|Ga0190264_11600170 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
3300020003|Ga0193739_1006540 | All Organisms → cellular organisms → Bacteria | 3122 | Open in IMG/M |
3300020060|Ga0193717_1196919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
3300020186|Ga0163153_10121286 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium MnTg02 | 1496 | Open in IMG/M |
3300021051|Ga0206224_1056577 | Not Available | 535 | Open in IMG/M |
3300021090|Ga0210377_10402291 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300021418|Ga0193695_1126443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300022756|Ga0222622_10853001 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
3300025155|Ga0209320_10386880 | Not Available | 565 | Open in IMG/M |
3300025164|Ga0209521_10227365 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300025319|Ga0209520_10041951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2892 | Open in IMG/M |
3300025791|Ga0210115_1010549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2193 | Open in IMG/M |
3300025791|Ga0210115_1030352 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
3300025910|Ga0207684_10652406 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 897 | Open in IMG/M |
3300025919|Ga0207657_10762180 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300025922|Ga0207646_11500006 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 584 | Open in IMG/M |
3300025960|Ga0207651_11541983 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300025961|Ga0207712_10050030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 2916 | Open in IMG/M |
3300025971|Ga0210102_1048780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 915 | Open in IMG/M |
3300026088|Ga0207641_11440193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 690 | Open in IMG/M |
3300026088|Ga0207641_11659390 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300026328|Ga0209802_1014791 | All Organisms → cellular organisms → Bacteria | 4446 | Open in IMG/M |
3300026540|Ga0209376_1129173 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
3300026552|Ga0209577_10515328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 786 | Open in IMG/M |
3300027543|Ga0209999_1113912 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 529 | Open in IMG/M |
3300027787|Ga0209074_10124622 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300027821|Ga0209811_10046947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1469 | Open in IMG/M |
3300027877|Ga0209293_10074325 | Not Available | 1472 | Open in IMG/M |
3300028420|Ga0210366_10150208 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
3300028587|Ga0247828_10664276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 644 | Open in IMG/M |
3300028802|Ga0307503_10582065 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300028809|Ga0247824_11050545 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
3300031720|Ga0307469_12320094 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 523 | Open in IMG/M |
3300031740|Ga0307468_101706134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
3300031847|Ga0310907_10747996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 544 | Open in IMG/M |
3300031908|Ga0310900_10696051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 813 | Open in IMG/M |
3300031949|Ga0214473_11958587 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 573 | Open in IMG/M |
3300032163|Ga0315281_12289144 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 509 | Open in IMG/M |
3300032205|Ga0307472_100437095 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1107 | Open in IMG/M |
3300032954|Ga0335083_10904085 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
3300033433|Ga0326726_10096221 | All Organisms → cellular organisms → Bacteria | 2643 | Open in IMG/M |
3300033487|Ga0316630_11808983 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 558 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.76% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.06% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.06% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.06% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.06% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.44% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.44% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.63% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.63% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.63% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.63% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.63% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.63% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.63% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.63% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.81% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.81% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.81% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.81% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.81% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.81% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.81% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
3300012134 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT142_2 | Environmental | Open in IMG/M |
3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300020186 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1 | Environmental | Open in IMG/M |
3300021051 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos A1 | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI11643J11755_113302602 | 3300000787 | Soil | LADGTWVPMAAVHGAAVIGALVAAWMAARAKGQN* |
JGI10214J12806_121399861 | 3300000891 | Soil | PAALQQLTGLLADGTWLPMATVAFAAVTAALLAAWMAAKAKD* |
C687J26845_102425911 | 3300002223 | Soil | PALLSDGTWVPMAAVHFAAVTGALLAGWMAVRAKD* |
Ga0055432_101186541 | 3300004022 | Natural And Restored Wetlands | SGAVVFSQFFWPAALQQLTGLLADGTWVPMATVHFAAMSAALLAGWMAVRAKD* |
Ga0055489_100673472 | 3300004145 | Natural And Restored Wetlands | ALQQLTGLLADGTWVPMATVNFFAVTGALFAGWIAVRAES* |
Ga0063356_1060134461 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LQEITGLLADGTWVPMAAVHFAAVAVALLAGWVAARSDI* |
Ga0062591_1011577291 | 3300004643 | Soil | PAALQQLTALLANGSWVPMATVHLAAMIAALFAGWIAVRTER* |
Ga0066690_107872681 | 3300005177 | Soil | GAVVFSQFFWPAAQQQLTGLLANGTWVPMATVRFAAVATALHAGCMAVPAKG* |
Ga0066685_107416351 | 3300005180 | Soil | RDDNRIRCAAVFSQFLWPAALQQLTRLLADGTWVPMATVHFAAMTAALLAGWMAVRARG* |
Ga0066675_113710072 | 3300005187 | Soil | VFSQFFWPAALQQLTGLLADGTWVPRATVHFAAVTAALLAGWMAVRARG* |
Ga0066686_102380921 | 3300005446 | Soil | VFSQFLWPAALQQLTRLLADGTWVPMATVHFAAMTAALLAGWMAVRARG* |
Ga0073909_102489252 | 3300005526 | Surface Soil | MRSNTAEQLTGLLADGTWVPMATVHFAAVTAALLAGWMAARASD* |
Ga0066698_108107831 | 3300005558 | Soil | QLTGLLANGTWVPMATVRFAAVATALHAGCMAVPAKG* |
Ga0066702_106524122 | 3300005575 | Soil | ALQQLTGLLADGTWVPMAAVHFAAVTVALLTGWMAVRAKD* |
Ga0066708_106199382 | 3300005576 | Soil | NRIRCAAVFSQFLWPAALQQLTRLLADGTWVPMATVHFAAMTAALLAGWMAVRARG* |
Ga0075287_10078801 | 3300005873 | Rice Paddy Soil | WPAALQQLTGWLADGTWVPMAAVHFSAVTGALLAGWMAVRAKD* |
Ga0075417_100034466 | 3300006049 | Populus Rhizosphere | VSVVAEADHALGFWASALQQFTGLLPDGTWVPMATVHFVAMTGVLLAGCMAVRAKG* |
Ga0075417_107194501 | 3300006049 | Populus Rhizosphere | VVFSQLFWPAALQQLTGLLADGTWVPMAAVHFAAVTAALLAGWVAVRAKG* |
Ga0079222_118201511 | 3300006755 | Agricultural Soil | QLTGLLADGTWVPMASVHFAAVTVALLAGWMAARAKN* |
Ga0066665_104898542 | 3300006796 | Soil | LGELLSQFLWPAALQQLTGFLANGTWVPMATVHFAAMTAALLAGWMAVRARG* |
Ga0066659_101464495 | 3300006797 | Soil | MSTSNWVALQQLTGLLADVLGSRWRPVHFAVITTALLAGWIAVWAKG* |
Ga0079220_120489372 | 3300006806 | Agricultural Soil | TGLLSDGTWMPMAAVHVASVVGALFAGWMAARGKS* |
Ga0075428_1000630035 | 3300006844 | Populus Rhizosphere | CPRFFWASALQQFTGLLPDGTWVPMATVHFTAMTGAPLAGWMAVRAKG* |
Ga0075421_1002109452 | 3300006845 | Populus Rhizosphere | MPSVLLVSALQQLTGLLTDGTWMPMATVHFAAMTGVLLAGCMAVRAKG* |
Ga0075421_1021901501 | 3300006845 | Populus Rhizosphere | AAGAVVFSQLFWPAALQQLTALLANGSWVPMATVHFTAMTIALLAGWMAVRAER* |
Ga0075421_1026153651 | 3300006845 | Populus Rhizosphere | MPSVLLGAALQQFTGLLPDGTWVPMATVHFTAMTGAPLAGWMAVRAKG* |
Ga0075431_1000735696 | 3300006847 | Populus Rhizosphere | MAEADHALGFWASALQQFTGLLPDGTWVPMATVHFTAMTGAPLAGWMAVRAKG* |
Ga0075425_1000748686 | 3300006854 | Populus Rhizosphere | MPSVLLVSALQQLTGLLPDGTWVPMATVHFAAMTGVLLAGCMAVRAKG* |
Ga0075425_1001990031 | 3300006854 | Populus Rhizosphere | AALQELTGLLADGTWVPMAAVQFAAVTIALLAGWVAARADI* |
Ga0073934_100571372 | 3300006865 | Hot Spring Sediment | VALQQLTGLLADGTWVPMATVHFAAVTAALLAAWIAVRAND* |
Ga0079217_102237532 | 3300006876 | Agricultural Soil | VVFSQFFWPAALQQLTGLLADGTWVPMASVHFAAVTGALLAAWMAAPAKR* |
Ga0075429_1009577932 | 3300006880 | Populus Rhizosphere | VSVVAEADHALFFWASALQQFTGLLPDGTWVPMATVHFVAMTGVLLAGCMAVRAKG* |
Ga0075424_1008848692 | 3300006904 | Populus Rhizosphere | MRSNTAEQLTGLLADGTWVAMATVHFAAVTAALLAGWMVARASD* |
Ga0075435_1008451852 | 3300007076 | Populus Rhizosphere | MAEADHALFFWASALQQFTGLLPDGTWVPMATVHFTAMTGAPLAGWMAVRAKG* |
Ga0099791_104465122 | 3300007255 | Vadose Zone Soil | SQFFWPAALQQLTGLLADGTWVPMATVHFAAMTAALLAGWMAVRAKG* |
Ga0105106_113432182 | 3300009078 | Freshwater Sediment | ASGAVVFSQFFWPAALQQLTGLLADGTWVPMAAVHFFAVTGALLAGWMALRAKT* |
Ga0111539_130210421 | 3300009094 | Populus Rhizosphere | LLPDGTWVPMATVHFVAMTGVLLAGCMAVRLERLKPTR* |
Ga0115027_115583182 | 3300009131 | Wetland | MRSNTAEQLIGLLADGTWVPMAAVHFAAVTVALLTGWMAVRAKD* |
Ga0105094_103339051 | 3300009153 | Freshwater Sediment | QRSGLLAYGTWVPMATVHFAAVTGALLAGWMAVRAKT* |
Ga0075423_106838063 | 3300009162 | Populus Rhizosphere | FSQLFWPAALQELTGLLADGTWVPMAAVQFAAVTIALLAGWVAARADI* |
Ga0075423_122630852 | 3300009162 | Populus Rhizosphere | MPSVLLVSALQQLTGLLPDGTWVPMATVHFVAMTGVLLAGCMAVRA |
Ga0105347_11112001 | 3300009609 | Soil | VFSQCFWPAALEQLTGLLADGTWVPMAAVHFVAVTGALLAG* |
Ga0114944_12553012 | 3300009691 | Thermal Springs | GLLADGTWVPMAAVHFAAVTAALLAAWMAVQAKG* |
Ga0126308_113495831 | 3300010040 | Serpentine Soil | LTGLLADGTWVPMATVAFAAVTAALLAAWMAAQAKD* |
Ga0134084_104135361 | 3300010322 | Grasslands Soil | MALQQLTGLLADGTWVPMAAVHFAAVTVALLTGWMAVRAKD* |
Ga0134125_127023062 | 3300010371 | Terrestrial Soil | GAVVFSQFFWPSALQELTGVLADGTWVPMAAVHFAAVTVALLAGWMAARTTD* |
Ga0134124_110864262 | 3300010397 | Terrestrial Soil | FWPAALQELTGLLADGTWVPMAAVQFAAVTVALLAGWVAARADI* |
Ga0134127_103047513 | 3300010399 | Terrestrial Soil | AALQQLTGLLADGTWVPMASVPFAAVTAALLAAWLAARAET* |
Ga0134122_106690281 | 3300010400 | Terrestrial Soil | MRSNTAEQLTGLLADGTWVAMATVHFAAVTAALLAGWMAARASD* |
Ga0134121_102607712 | 3300010401 | Terrestrial Soil | AALQELTGLLADGTWVPMAAVQFAAVTIALLAGWVAARGDI* |
Ga0105246_118049682 | 3300011119 | Miscanthus Rhizosphere | SQLFWPAALQQLTGMLADGTWVPMATVHFAAVTAALLAGLMAARAKDKWF* |
Ga0137464_10838881 | 3300011434 | Soil | VVVSQFFWTAALQQLTGLVADGTWVPMAAVHFAAMTAALLAGWMAV |
Ga0137330_10348171 | 3300012134 | Soil | LQQLTGLLADGTWVPMAAVHFAAVTGALLAGWMALRAER* |
Ga0137334_11273101 | 3300012179 | Soil | LTALLADGTWVPMATVHFVAMTGALLAGWMAVRAKG* |
Ga0137374_100768271 | 3300012204 | Vadose Zone Soil | VVFSQFFWPAALQQLTGLLADGTSVPMATVHFAAMTAALLAGCMAVRAKG* |
Ga0137386_110881891 | 3300012351 | Vadose Zone Soil | VVFSQFFWPAALQQLTGLLADGTWVPMATVHFTAMTAA |
Ga0150984_1052141251 | 3300012469 | Avena Fatua Rhizosphere | FSQFFWPAALQQLTGVLADGSWVPMAAVHFAAVTVALLAGWMAARAKS* |
Ga0157331_10190632 | 3300012486 | Soil | MRSNTAEQLTGLLADGTWVAMATVHFAAVTAALLAGWMAVRASD* |
Ga0157331_10200152 | 3300012486 | Soil | WPSALQELTGVLADGTWVPMAAVHFTAVTVALLAGWMAARTTD* |
Ga0157321_10114021 | 3300012487 | Arabidopsis Rhizosphere | GAVVFSQLFWPAALQQLTGLLADGSWVPMASVHFAAVTAALLAAWLAVRAET* |
Ga0157345_10296722 | 3300012498 | Arabidopsis Rhizosphere | MRSNTAEQLTGLLADGTWVPMATVHFAAVTAALLAGWMAVRAKD* |
Ga0157313_10088672 | 3300012503 | Arabidopsis Rhizosphere | MRSNTAEQLTGLLADGTWVPMAAVHFAAVTVALLTGWMAVRAKD* |
Ga0157332_10831012 | 3300012511 | Soil | SMRSNTAEQLTGLLADGTWVPMATVHFAAVTAALLAGWMAVRASD* |
Ga0137358_102367451 | 3300012582 | Vadose Zone Soil | AVVFSQFFWPAALQQLTGMLADGTWVAMATVHFAAMTAALLAGWMAVRAKR* |
Ga0137358_103965053 | 3300012582 | Vadose Zone Soil | FFWPAALQQLTGMLADGTWVAMATVHFAAMTAALIAGWMAVRAKT* |
Ga0157289_100452111 | 3300012903 | Soil | QLFWPAALQELTGLLADGTWVPMAAVQFAAVTIALLAGWVAARADI* |
Ga0153915_102952252 | 3300012931 | Freshwater Wetlands | VALQQLAGLRADGTWVPMATVHFAAVIAALLAAWMAVRAKSQTPAE |
Ga0153915_111303962 | 3300012931 | Freshwater Wetlands | VVFSQFFWPAALQQLTGLLADGTWVPMAMVHFIAVTAALLAGWMAVRAET* |
Ga0164302_101232721 | 3300012961 | Soil | MRSNTAEQLTGLLADGTGVPMATVHLAAVTAALLAAWMAVR |
Ga0134077_103016041 | 3300012972 | Grasslands Soil | GFLANGTWVPMATVHFAAMTAALLAGWMAVRARG* |
Ga0163162_100673234 | 3300013306 | Switchgrass Rhizosphere | FWPAALQQLTALLANGSWVPMATVHLVAMIAALLAGWMAVRAEH* |
Ga0075311_11642301 | 3300014259 | Natural And Restored Wetlands | LTGLLADGTWVPMATVHFIAVTAALLAGWMAVRAKG* |
Ga0180089_11011251 | 3300015254 | Soil | LFWPAALQQLTGLLADGTWVPMAAVHCAAVTGALLAAWMAARAEG* |
Ga0132256_1002768921 | 3300015372 | Arabidopsis Rhizosphere | TGLLADGTWVPMAAVHFAAVTVALFTGWMAVRAEG* |
Ga0132257_1001651522 | 3300015373 | Arabidopsis Rhizosphere | MRSNTAEQLTGLLADGTWVPMAAVHFAAVTVALLTGWMAVRASD* |
Ga0182035_108405872 | 3300016341 | Soil | TGMLADNSWVPMAAVHFAAVTGALLAAWVAARAKG |
Ga0187822_102691451 | 3300017994 | Freshwater Sediment | VALQQLAGLRADGTWVPMATVHFAAVIAALLAAWMAARADD |
Ga0184635_100143805 | 3300018072 | Groundwater Sediment | LPLSLGRSDAQFFWPAALQQLTGLLADGTWVPMATVHFGAMTAALLAGWMAVRAKG |
Ga0190265_132921601 | 3300018422 | Soil | AVVFSQFFWPAALQQLTGLLADGTWVPMATVHFAAVTGALLAAWMAMQAKT |
Ga0190271_123878591 | 3300018481 | Soil | LQQLTALLANGSWVPMATVHVAAMIAALFAGWIAVRAER |
Ga0180117_12930232 | 3300019248 | Groundwater Sediment | VFSQFFWPAALQQLTGLLADGTWVPMAAVHFAVVTAALLAGWMAARAET |
Ga0190264_116001703 | 3300019377 | Soil | ALQQLTGLLADGTWVPMATVHFAAVTAALLAAWMAMQAKT |
Ga0193739_10065402 | 3300020003 | Soil | VNSPPVAASAQFFWPAALQQLTGLLADGTWVPMATVHFAAMTGALLAGWMAARAKG |
Ga0193717_11969191 | 3300020060 | Soil | FWPAALQQLTGLLADGSWVPMATVHFAAVTAALLAGWMAVRAKG |
Ga0163153_101212861 | 3300020186 | Freshwater Microbial Mat | QQLTGLLADGTWVPMAAVQFAAVTGALLAGWMAVRAED |
Ga0206224_10565771 | 3300021051 | Deep Subsurface Sediment | QLTALLADGSWVPMAAVQFAAVTGALLAGWMAARDEG |
Ga0210377_104022911 | 3300021090 | Groundwater Sediment | FFWPAALQQLTGLLADGTWVPMATVHFAAVTAALLAGWMAARGKG |
Ga0193695_11264431 | 3300021418 | Soil | WPAALQQLTGLLADGTWVPMATVHFAAMTAALLAGWMAVRAKG |
Ga0222622_108530012 | 3300022756 | Groundwater Sediment | LLTGLLADATWAPMATVHFTAMTAALLAGWMEVRTKG |
Ga0209320_103868802 | 3300025155 | Soil | PSALQQLTGLLADGTWVPMATVHFTAMTAALLAAWMAVRAKD |
Ga0209521_102273654 | 3300025164 | Soil | PAALQQLTGLLADGTWVPMAAVHFAAVTGALLAAWMAVRTET |
Ga0209520_100419513 | 3300025319 | Soil | AALQQLTGLLADGTWVPMAAVHFAAVTGALLAGWMAVRAKD |
Ga0210115_10105493 | 3300025791 | Natural And Restored Wetlands | LTGWLADGTWVPMAAVHFSAVTGALLAGWMAVRVER |
Ga0210115_10303521 | 3300025791 | Natural And Restored Wetlands | LTGWLADGTWVPMAAVHFSAVTGALLAGWMAVRAKD |
Ga0207684_106524062 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VFSQFFWPAALQHLTGLLADGTWVPMATVHFAAMTAPLLAGWMAVRAKGSRLKI |
Ga0207657_107621802 | 3300025919 | Corn Rhizosphere | AALQELTGLLADGTWVPMAAVQFAAVTIALLAGWVAARADI |
Ga0207646_115000061 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VVFSQFFWPAALQQLTGLLADGTWVPMATVHFAAMTAPLLAGWMAVRAKG |
Ga0207651_115419832 | 3300025960 | Switchgrass Rhizosphere | VVFSQLFWPAALQELTGLLADGTWVPMAAVQFAAVTIALLAGWVAARADI |
Ga0207712_100500304 | 3300025961 | Switchgrass Rhizosphere | VFSQLFWPAALQQLTGLLADGTWVPMASVHFAAVTAALLAAWLAARAET |
Ga0210102_10487801 | 3300025971 | Natural And Restored Wetlands | ALQQLTGVLADGSWVPMVAVHFAAVTGALLAGWVAARDET |
Ga0207641_114401931 | 3300026088 | Switchgrass Rhizosphere | TGVLADGTWVPMAAVHFAAVTVALLAGWMAARTTD |
Ga0207641_116593901 | 3300026088 | Switchgrass Rhizosphere | KWTPDSSYQYSMRSNTAEQLTGLLADGTWVPMAAVHFAAVTVALLTGWMAVRASD |
Ga0209802_10147914 | 3300026328 | Soil | VFSQFLWPAALQQLTRLLADGTWVPMATVHFAAMTAALLAGWMAVRARG |
Ga0209376_11291733 | 3300026540 | Soil | RDDNRIRCAAVFSQFLWPAALQQLTRLLADGTWVPMATVHFAAMTAALLAGWMAVRARG |
Ga0209577_105153281 | 3300026552 | Soil | AQQQLTGLLANGTWVPMATVRFAAVATALHAGCMAVPAKG |
Ga0209999_11139121 | 3300027543 | Arabidopsis Thaliana Rhizosphere | PAALQQLTGLLADGTWVPMATVHFAAVSAALLAGWVAVRAKG |
Ga0209074_101246222 | 3300027787 | Agricultural Soil | WPAALQELTGLLADGTWVPMAAVQFAAVTVALLAGWVAARADI |
Ga0209811_100469472 | 3300027821 | Surface Soil | MRSNTAEQLTGLLADGTGVPMATVHLAAVTAALLAAWLAVRASD |
Ga0209293_100743253 | 3300027877 | Wetland | QLTGVLADGTWVPMASVHFAAVTGALLAGWMAARAED |
Ga0210366_101502082 | 3300028420 | Estuarine | FWPSALQQLTGLLADGTWVPMATVNFIAVTGALIAGWMAVRAER |
Ga0247828_106642761 | 3300028587 | Soil | AAGAVVFSQLFWPAALQQLTALLANGSWVPMATVHLAAMIAALFAGWIAVRAER |
Ga0307503_105820651 | 3300028802 | Soil | PAALQQLTGLLADGTWVPMAAVHFAAVTAALLAGWMAARAET |
Ga0247824_110505451 | 3300028809 | Soil | TGLLADGTWVPMASVHFAAVTGALLAAWMAAPATASLFKKN |
Ga0307469_123200942 | 3300031720 | Hardwood Forest Soil | RAVVFSQFFWPAALQHLTGLLADGTWVPMATVHFAAMTAPLLAGWMAVRAKG |
Ga0307468_1017061341 | 3300031740 | Hardwood Forest Soil | AALQQVTGLLADGTWVPMAAVHFAAVTAALLAAWLAARAET |
Ga0310907_107479962 | 3300031847 | Soil | QELTGVLADGTWVPMAAVHFAAVTVALLVGWMAARTTD |
Ga0310900_106960511 | 3300031908 | Soil | SQLFWPAALQQLTALLANGSWVPMATVHLAAMIAALFAGWIAVRAER |
Ga0214473_119585871 | 3300031949 | Soil | VVFSQFFWPAALQQLTGLLADGTWVPMAAVHFAAVAGALLAAWMAVRAKD |
Ga0315281_122891441 | 3300032163 | Sediment | VVFSQFFWPAALQQLTGLLADGTWVPMAAVQFAAVTGALLAAWMAARDKNF |
Ga0307472_1004370952 | 3300032205 | Hardwood Forest Soil | VVFSQFFWPTALQQLTGLLADGTWVPMATVHFAAMTAALLAGWMAVRAKD |
Ga0335083_109040851 | 3300032954 | Soil | ALQQLTALLADGTWVPMATVHFAAMTAALLAGWMAVRAER |
Ga0326726_100962214 | 3300033433 | Peat Soil | VAFSQFLAVCVQQRTGLLAEGTWMPMAAVHLGAMTAALLAGWMAARAKTCSEAALVA |
Ga0316630_118089832 | 3300033487 | Soil | SQFFWPAALQQLTGLLADGTWVPMAAVHFAAVTGALLAGWMALRAER |
⦗Top⦘ |