NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F070063

Metagenome Family F070063

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070063
Family Type Metagenome
Number of Sequences 123
Average Sequence Length 44 residues
Representative Sequence DDNEKVAGPPEMEFSFNVGVQFGLTDATSDTALKFQGSLSF
Number of Associated Samples 110
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.69 %
% of genes near scaffold ends (potentially truncated) 94.31 %
% of genes from short scaffolds (< 2000 bps) 86.99 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.992 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.195 % of family members)
Environment Ontology (ENVO) Unclassified
(29.268 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.772 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF12706Lactamase_B_2 34.96
PF13537GATase_7 3.25
PF01569PAP2 2.44
PF13522GATase_6 2.44
PF00196GerE 1.63
PF02239Cytochrom_D1 1.63
PF01641SelR 1.63
PF04966OprB 1.63
PF03734YkuD 1.63
PF05532CsbD 0.81
PF05690ThiG 0.81
PF05235CHAD 0.81
PF12625Arabinose_bd 0.81
PF00535Glycos_transf_2 0.81
PF02696SelO 0.81
PF04226Transgly_assoc 0.81
PF13460NAD_binding_10 0.81
PF10282Lactonase 0.81
PF01699Na_Ca_ex 0.81
PF08241Methyltransf_11 0.81
PF07730HisKA_3 0.81
PF13411MerR_1 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 1.63
COG1376Lipoprotein-anchoring transpeptidase ErfK/SrfKCell wall/membrane/envelope biogenesis [M] 1.63
COG3034Murein L,D-transpeptidase YafKCell wall/membrane/envelope biogenesis [M] 1.63
COG3659Carbohydrate-selective porin OprBCell wall/membrane/envelope biogenesis [M] 1.63
COG0214Pyridoxal 5'-phosphate synthase subunit PdxSCoenzyme transport and metabolism [H] 0.81
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 0.81
COG0397Protein adenylyltransferase (AMPylase) SelO/YdiU (selenoprotein O)Posttranslational modification, protein turnover, chaperones [O] 0.81
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 0.81
COG2022Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)Coenzyme transport and metabolism [H] 0.81
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.81
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.81
COG3025Inorganic triphosphatase YgiF, contains CYTH and CHAD domainsInorganic ion transport and metabolism [P] 0.81
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.81
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.81
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.81
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.81
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.81
COG5607CHAD domain, binds inorganic polyphosphatesFunction unknown [S] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.99 %
UnclassifiedrootN/A13.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0625148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans839Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1029843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales700Open in IMG/M
3300000787|JGI11643J11755_11692296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus699Open in IMG/M
3300000891|JGI10214J12806_11338710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium601Open in IMG/M
3300000893|AP72_2010_repI_A001DRAFT_1014272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1337Open in IMG/M
3300004003|Ga0055445_10331473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium529Open in IMG/M
3300004063|Ga0055483_10208991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium635Open in IMG/M
3300004156|Ga0062589_100760223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus871Open in IMG/M
3300004479|Ga0062595_100074366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Parvularculales → Parvularculaceae → Aquisalinus → Aquisalinus flavus1686Open in IMG/M
3300005093|Ga0062594_102989838All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium528Open in IMG/M
3300005332|Ga0066388_105481914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium643Open in IMG/M
3300005332|Ga0066388_106292750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales599Open in IMG/M
3300005332|Ga0066388_107168035Not Available560Open in IMG/M
3300005340|Ga0070689_100371794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans1203Open in IMG/M
3300005340|Ga0070689_100699039All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria885Open in IMG/M
3300005436|Ga0070713_101301209Not Available704Open in IMG/M
3300005547|Ga0070693_101640816All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005607|Ga0070740_10280476All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium672Open in IMG/M
3300005615|Ga0070702_100173642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1404Open in IMG/M
3300005616|Ga0068852_101461593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium706Open in IMG/M
3300005719|Ga0068861_102110862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales563Open in IMG/M
3300005764|Ga0066903_100924598Not Available1582Open in IMG/M
3300005764|Ga0066903_104501753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans743Open in IMG/M
3300005764|Ga0066903_107054162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales582Open in IMG/M
3300005764|Ga0066903_107582870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales559Open in IMG/M
3300005764|Ga0066903_108051353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales540Open in IMG/M
3300005840|Ga0068870_11092974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales573Open in IMG/M
3300005840|Ga0068870_11446300All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005843|Ga0068860_101844646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria626Open in IMG/M
3300006635|Ga0075526_1007215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans766Open in IMG/M
3300006846|Ga0075430_100472868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans1034Open in IMG/M
3300006846|Ga0075430_100516596All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans985Open in IMG/M
3300006880|Ga0075429_101952195All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria508Open in IMG/M
3300006903|Ga0075426_10309330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans1156Open in IMG/M
3300006904|Ga0075424_100373535All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300006954|Ga0079219_11184723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales659Open in IMG/M
3300006954|Ga0079219_12015337Not Available549Open in IMG/M
3300006969|Ga0075419_10142391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1564Open in IMG/M
3300007076|Ga0075435_100236506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1553Open in IMG/M
3300007076|Ga0075435_101195316All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300009081|Ga0105098_10566307All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009092|Ga0105250_10018983All Organisms → cellular organisms → Bacteria2781Open in IMG/M
3300009098|Ga0105245_11324917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans769Open in IMG/M
3300009100|Ga0075418_10174778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae2287Open in IMG/M
3300009146|Ga0105091_10194624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans964Open in IMG/M
3300009157|Ga0105092_10153325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans1280Open in IMG/M
3300009488|Ga0114925_10028562All Organisms → cellular organisms → Bacteria3241Open in IMG/M
3300009778|Ga0116151_10456490All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300009792|Ga0126374_10212424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1234Open in IMG/M
3300009815|Ga0105070_1097765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium577Open in IMG/M
3300010362|Ga0126377_12984230Not Available546Open in IMG/M
3300010397|Ga0134124_12729342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales537Open in IMG/M
3300010403|Ga0134123_12571219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium576Open in IMG/M
3300012895|Ga0157309_10279880All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium555Open in IMG/M
3300012899|Ga0157299_10208599Not Available594Open in IMG/M
3300012901|Ga0157288_10008647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1620Open in IMG/M
3300012908|Ga0157286_10051441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1058Open in IMG/M
3300012948|Ga0126375_10320705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1085Open in IMG/M
3300012951|Ga0164300_11148148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales511Open in IMG/M
3300012958|Ga0164299_10610932Not Available747Open in IMG/M
3300012958|Ga0164299_10611693Not Available747Open in IMG/M
3300012964|Ga0153916_12129805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium630Open in IMG/M
3300012987|Ga0164307_10009089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4757Open in IMG/M
3300012989|Ga0164305_10329996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1140Open in IMG/M
3300013297|Ga0157378_10075757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3030Open in IMG/M
3300013307|Ga0157372_11551434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus763Open in IMG/M
3300014317|Ga0075343_1095932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium670Open in IMG/M
3300014320|Ga0075342_1085429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans807Open in IMG/M
3300014324|Ga0075352_1084959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans808Open in IMG/M
3300014325|Ga0163163_11048458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales879Open in IMG/M
3300014745|Ga0157377_10358497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales981Open in IMG/M
3300015371|Ga0132258_13491032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Bauldia → Bauldia litoralis1077Open in IMG/M
3300018053|Ga0184626_10240396All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria761Open in IMG/M
3300018429|Ga0190272_11525075All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium681Open in IMG/M
3300018920|Ga0190273_11723018Not Available566Open in IMG/M
3300019487|Ga0187893_10531397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis760Open in IMG/M
(restricted) 3300024519|Ga0255046_10063919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi1483Open in IMG/M
3300025167|Ga0209642_10336026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans854Open in IMG/M
3300025174|Ga0209324_10031903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi3622Open in IMG/M
3300025321|Ga0207656_10207941Not Available947Open in IMG/M
3300025544|Ga0208078_1044471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans952Open in IMG/M
3300025566|Ga0210140_1108288All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium570Open in IMG/M
3300025912|Ga0207707_11581005All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium517Open in IMG/M
3300025928|Ga0207700_11573508Not Available582Open in IMG/M
3300025938|Ga0207704_11910522All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium511Open in IMG/M
3300025940|Ga0207691_11537873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales543Open in IMG/M
3300025945|Ga0207679_11813468All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300025949|Ga0207667_10339092All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae1534Open in IMG/M
3300025960|Ga0207651_10196318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1613Open in IMG/M
3300025961|Ga0207712_10028176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3755Open in IMG/M
3300026035|Ga0207703_11318160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria694Open in IMG/M
3300026041|Ga0207639_10028995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4047Open in IMG/M
3300026075|Ga0207708_10077104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2558Open in IMG/M
3300027379|Ga0209842_1062719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium661Open in IMG/M
3300027706|Ga0209581_1180670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium672Open in IMG/M
3300027723|Ga0209703_1257527All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300027765|Ga0209073_10339207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium604Open in IMG/M
(restricted) 3300027872|Ga0255058_10391885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium674Open in IMG/M
3300027880|Ga0209481_10262698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans871Open in IMG/M
3300028379|Ga0268266_10087552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2725Open in IMG/M
3300030003|Ga0302172_10119255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans810Open in IMG/M
3300030006|Ga0299907_10308802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans1288Open in IMG/M
3300030619|Ga0268386_10013698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi6303Open in IMG/M
3300031226|Ga0307497_10139546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans994Open in IMG/M
3300031232|Ga0302323_100225963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi1905Open in IMG/M
3300031539|Ga0307380_10209381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1875Open in IMG/M
3300031563|Ga0307436_1121127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium733Open in IMG/M
3300031565|Ga0307379_10325824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis1503Open in IMG/M
3300031566|Ga0307378_10518506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans1065Open in IMG/M
3300031673|Ga0307377_10448338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter marginalis950Open in IMG/M
3300031747|Ga0318502_10498074All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans730Open in IMG/M
3300031847|Ga0310907_10404076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans712Open in IMG/M
3300031902|Ga0302322_103463192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium540Open in IMG/M
3300032003|Ga0310897_10380658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium663Open in IMG/M
3300032041|Ga0318549_10077335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi1421Open in IMG/M
3300032076|Ga0306924_11925657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales612Open in IMG/M
3300032273|Ga0316197_10153337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → Hyphomicrobium denitrificans1375Open in IMG/M
3300032516|Ga0315273_13190497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales507Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.20%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.13%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil6.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.06%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.06%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.25%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil3.25%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.44%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.44%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.44%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.44%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.44%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.44%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.63%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.63%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.63%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.63%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.63%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.63%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.81%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.81%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.81%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.81%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.81%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.81%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.81%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000893Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001EnvironmentalOpen in IMG/M
3300004003Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1EnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006635Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-threeEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009778Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaGEngineeredOpen in IMG/M
3300009788Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014317Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025174Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025544Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025566Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027706Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)EnvironmentalOpen in IMG/M
3300027723Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027872 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300030003Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031563Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032273Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxicEnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_062514822228664021SoilNAPEPAGTEFSMNIGYQFGLTDVTSDGALKLQGSLAF
AP72_2010_repI_A10DRAFT_102984323300000651Forest SoilAAGSPNLELSFNVGVQFGLTDATSDGALKFQGTFSW*
JGI11643J11755_1169229613300000787SoilEGDEEEVKGDKDNDKASGPSEMQLSFNIGLQFGVTDATSDTALKFQGSLSF*
JGI10214J12806_1133871023300000891SoilVPAGMELTFNLGVQFGLTDATSDTALKFQGSLSF*
AP72_2010_repI_A001DRAFT_101427213300000893Forest SoilGPTLFWKPVGGEDEAKNEGGENDNRAAGSPNLELSFNVGVQFGLTDATSDGALKFQGTFSW*
Ga0055445_1033147313300004003Natural And Restored WetlandsGGEGDADEDDVASAPEMELYLNVGLQFGLTDATSDTALKFQGSLQF*
Ga0055483_1020899113300004063Natural And Restored WetlandsADEGDADGAQGTSLSLNVGVQFGLTDATSDTALKFQGSLQF*
Ga0062589_10076022313300004156SoilKKSDDNEKVAGPPEMEFSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0062595_10007436643300004479SoilMYQTTGKDNDKASGPSEMQLSFNIGLQFGLMDATSDTALKFQGSLSF*
Ga0062594_10298983823300005093SoilEAKGGDEDEDNNKVPGPPNLELSFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0066388_10548191413300005332Tropical Forest SoilAEGGNDDRVAGPAQMAFSMNLGVQFGLTDATSDTALKLQGSLSF*
Ga0066388_10629275013300005332Tropical Forest SoilGKEDNDNEKVAGTPEMELSFNVGVQFGLTDATSDAALKFQGTISF*
Ga0066388_10716803513300005332Tropical Forest SoilAGGDEDENEAKSPAPLELSFNVGVQFGLTDATSDTTLKFQGSLSF*
Ga0070689_10037179413300005340Switchgrass RhizosphereGGDDDDKATEAPAMKFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0070689_10069903913300005340Switchgrass RhizosphereGGEGDDDDENNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF*
Ga0070713_10130120913300005436Corn, Switchgrass And Miscanthus RhizosphereEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0068853_10133139323300005539Corn RhizosphereGDDDEAEGEGKKKGGDDDDKATEAPAMKFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0070693_10164081623300005547Corn, Switchgrass And Miscanthus RhizosphereKKGGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF*
Ga0070740_1028047623300005607Surface SoilTKKQEDVGDAAGGEDEENGTPGPEPLELSFNVGVQFGLTDATSDGALKFQGSLSW*
Ga0070702_10017364233300005615Corn, Switchgrass And Miscanthus RhizosphereEGEGKKKGGDDDDKATEAPPMKFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0068852_10146159313300005616Corn RhizosphereNAPEPASTEFSMNVGVQFGLTDATSDTALKFQGSLAF*
Ga0068861_10211086223300005719Switchgrass RhizosphereDDDENKKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF*
Ga0066903_10092459813300005764Tropical Forest SoilEKVAGASEMELSFNVGVQFGLTDATSDTALKFQGTISF*
Ga0066903_10450175313300005764Tropical Forest SoilAAGPPKMEFSLNVGVQFGLTDATSDTAPKFQGSLSF*
Ga0066903_10705416223300005764Tropical Forest SoilKEVKQGKEDNDNEKVAGASEMELSFNVGVQFGLTDATSDTALKFQGTFSF*
Ga0066903_10758287013300005764Tropical Forest SoilESEEREGKEDNDNEKVAGQPKLELSFNVGVQFGLTDATSDTALKFQGTVSF*
Ga0066903_10805135323300005764Tropical Forest SoilNDNEKVAGAPEMELSFNVGLQFGLTDATSDTALKFQGSLSF*
Ga0068870_1109297413300005840Miscanthus RhizosphereNHNPEPAKMEFSMNVGVQFGLTDVTSDSALKFQGSLAF*
Ga0068870_1144630023300005840Miscanthus RhizosphereGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF*
Ga0068860_10184464613300005843Switchgrass RhizosphereENKKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF*
Ga0075526_100721523300006635Arctic Peat SoilDDDDERKVGGPPEMEVSFNVGVQFGLTDFTSDTALKFQGSLGF*
Ga0075430_10047286823300006846Populus RhizosphereAEAPEMEVSLNVGVQFGLTDATSDTAVKFQGSIGF*
Ga0075430_10051659623300006846Populus RhizosphereGSEEEEAKGGDEDEDNNKVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0075429_10195219513300006880Populus RhizosphereAPEPAKTEFSMNFGVQFGLTDVTSDGALKFQGSLAF*
Ga0075426_1030933013300006903Populus RhizosphereVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0075424_10037353543300006904Populus RhizosphereDAAGGDEDENKGPGPAPLELSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0079219_1118472323300006954Agricultural SoilDEEEAKGDKDNDKASGPSEMQLSFNIGLQFGVTDATSDTALKFQGSLSF*
Ga0079219_1201533713300006954Agricultural SoilEGEEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGLLSF*
Ga0075419_1014239113300006969Populus RhizosphereEEEAKGGDEDEDNNKVPGPPNMELSFNVGVQSGLTDVTSDGALKFQGSLAW*
Ga0075435_10023650623300007076Populus RhizosphereLQGDGDEAEEKGAGPAPLELSLNVGVQFGLTDATSDVALKFQGSLAF*
Ga0075435_10119531623300007076Populus RhizosphereNKSQGPAPLELSFNVGVQLGLTDATSDTALKFQGSLSF*
Ga0105098_1056630713300009081Freshwater SedimentNGKFTAEAPEMEVSLNIGVQFGLTDATSDTALKFQGSLAF*
Ga0105250_1001898363300009092Switchgrass RhizosphereEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0105245_1132491723300009098Miscanthus RhizosphereDKDEDNNKVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0075418_1017477853300009100Populus RhizosphereGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0105091_1019462413300009146Freshwater SedimentEEGEGENGDDDDGATEAAEMEFSLNVGVQFGLTDVTSDSALKFQGSLAF*
Ga0105092_1015332513300009157Freshwater SedimentDDENGVAEAPEMEVSLNVGVQFGLTVATSDTAVKFQGSIGF*
Ga0114925_1002856243300009488Deep SubsurfaceGDDDDEKVGGPPEMELSLNIGVQFGLTDVTSDTALKFQGSLAF*
Ga0116151_1045649013300009778Anaerobic Digestor SludgeDDGDEGELELDDDVVAGPPEMELSFNVGVQFGLTDNTSDSALKFQDSLEF*
Ga0114923_1107995523300009788Deep SubsurfaceGDDDAVGGEGKGAEDEVAGPRKMEFFLNVGVQFGLTDMTSDTALKFQGSLEF*
Ga0126374_1021242423300009792Tropical Forest SoilEEEEAKAGDEDEDNNKIPGPPNMELSFNVGVQFGLTDVTSDGALKFQGTFSW*
Ga0105070_109776513300009815Groundwater SandVGAPPEMEFSLNVGVQFGLTDVTSDTALKFQGTLEF*
Ga0126377_1298423023300010362Tropical Forest SoilGDAAGGDENENKGPGPAPLELSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0134124_1272934213300010397Terrestrial SoilIGLRLVAGTRAMELSFNVGVQFGLTDATSDTALKIQGSLSF*
Ga0134122_1167247613300010400Terrestrial SoilLFYNPGGYDDEAEGEGKKKGGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF*
Ga0134123_1257121913300010403Terrestrial SoilPEPAKTEFSMNVGVQFGLTDVTSDSALKFQGSLAF*
Ga0157309_1027988013300012895SoilEAKGGDEDEDNNKVRGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW*
Ga0157299_1020859913300012899SoilDKDNDKASGPSEMQLSFNIGLQFGVTDATSDTALKFQGSLSF*
Ga0157288_1000864733300012901SoilKGGDEDEDNNKVPGPPNMELSFNVGVQFGLTDVTSDGALKFQGSIAW*
Ga0157286_1005144113300012908SoilVGDAAGGDEEENKGPGPAPLELSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0126375_1032070533300012948Tropical Forest SoilDKEKVAGAPEMELSFNVGVQFGLTDATSDTALKFQGTVSF*
Ga0164300_1114814813300012951SoilHQAAKAEFSMNVGVQFGLTDATSDTALKFQGSLAF*
Ga0164299_1061093223300012958SoilGEEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0164299_1061169313300012958SoilTGKKHQAAKAEFSMNVGVQFGLTDATSDTALKFQGSLAF*
Ga0153916_1212980513300012964Freshwater WetlandsKGSDDDDKAIEAPDMEFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0164307_1000908983300012987SoilEGKEDKDTEKVAGPPKMELSFNVGVQLGLTDATSDAALKFQGSLSF*
Ga0164307_1177598523300012987SoilKAKARGQEQASEPSAMAFSMNVGVQFGLTDATSDTALKFQGSLAF*
Ga0164305_1032999613300012989SoilKDNEKVAGPPKMELSFNVGVQFGLTDATFDAALKFQGSLSF*
Ga0157378_1007575713300013297Miscanthus RhizosphereENVGGEGDDDDENNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF*
Ga0163162_1295221623300013306Switchgrass RhizosphereDEESEGEGKKKGGDDDDKATEAPAMKFSLNVGVQFGLTDATSDTALKFQGSLSF*
Ga0157372_1155143413300013307Corn RhizosphereDDNEKVAGPPEMEFSFNVGVQFGLTDATSDTALKFQGSLSF*
Ga0075343_109593213300014317Natural And Restored WetlandsDVGEDDDDDNGGVTKAPETEFSMNVGLQFGLTDMTSDTAMKFQGSLAF*
Ga0075342_108542923300014320Natural And Restored WetlandsGKGDDDGDKRVAGPSKMDFSLNVGVQFGLTDLTSDTALKFQGSLAF*
Ga0075352_108495923300014324Natural And Restored WetlandsKVAGPPDMELSFNVGVQFGLTDATSDGALKFQGSLTW*
Ga0163163_1104845833300014325Switchgrass RhizosphereGSSEMELSFNIGLQFGLTDATSDTALKFQGSLSF*
Ga0157377_1035849713300014745Miscanthus RhizosphereNPEPAKMEFSMNVGVQFGLTDVTSDSALRFQGSLAF*
Ga0132258_1349103233300015371Arabidopsis RhizosphereEKKKEGGGPADMEFSLNVGVQFGLTDATSDTALKFQGELDF*
Ga0184626_1024039613300018053Groundwater SedimentNEKVASPPEMEFSLNVGVQFGLTEVTSDTALKFQGSLAF
Ga0190272_1152507523300018429SoilSGPPEMEFSLNVGVQFGLSDVTSDTALKFQGSLAF
Ga0190273_1172301813300018920SoilKKVGGAPEMEFSLNVGLQFGLTDVTSDTALKFQGTLEF
Ga0187893_1053139723300019487Microbial Mat On RocksEVEIYDDEQAGGAVAMTFSMNVGVQFGLTDSTSDTALKFQGAVQF
(restricted) Ga0255046_1006391933300024519SeawaterNDDDEIAGEPEMEFVFNVGLQFGLTDATSDTALKFQGAMEF
Ga0209642_1033602613300025167SoilGGPPEMEFSMNVGVQFGLTDVTSDTALKFQGTLEF
Ga0209324_1003190313300025174SoilGDDNGNGKGPGDDDDKKKVGGPPEMEFSMNVGVQFGLTDVTSDTALKFQGTLEF
Ga0207656_1020794123300025321Corn RhizosphereEGEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF
Ga0208078_104447123300025544Arctic Peat SoilGDDDEKGGGGAETEFSMNIGVQFGLTDATSEGALKVQGSLQF
Ga0210140_110828823300025566Natural And Restored WetlandsVPGGPVEMEVSFNVGVQFGLTDETSDSALKFQGMLEF
Ga0207707_1158100513300025912Corn RhizosphereARCRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0207700_1157350813300025928Corn, Switchgrass And Miscanthus RhizosphereEEEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF
Ga0207704_1191052213300025938Miscanthus RhizosphereEDEDNNKVPGPPNLELSFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0207691_1153787313300025940Miscanthus RhizosphereNNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLNF
Ga0207679_1181346813300025945Corn RhizosphereEGKKKGGDDDDKATEAPAMEFSLNVGLQFGLTDATSDTALKFQGSLSF
Ga0207667_1033909213300025949Corn RhizosphereEAKGDNDNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF
Ga0207651_1019631813300025960Switchgrass RhizosphereNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0207712_1002817613300025961Switchgrass RhizosphereDEDEDNNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0207703_1131816023300026035Switchgrass RhizosphereGGEGDDDDENKKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF
Ga0207639_1002899593300026041Corn RhizosphereNGNEKASGPSEMQLSFNIGLQFGLTDATSDTALKFQGSLSF
Ga0207708_1007710433300026075Corn, Switchgrass And Miscanthus RhizosphereEKDENVGGEGDDDDENNKKASGPAEMEFSFNVGVQFGLTDVTSDTALKFQGSLSF
Ga0209842_106271913300027379Groundwater SandDNGNGNGDDDNKIAGPAKVEFSMNVGVQFGLTDLTSDTALKFQGTLEF
Ga0209581_118067023300027706Surface SoilTKKQEDVGDAAGGEDEENGTPGPEPLELSFNVGVQFGLTDATSDGALKFQGSLSW
Ga0209703_125752713300027723Freshwater SedimentNGNAPEPAKTEFSMNVGVQFGLTDVTSDGALKFQGSLAF
Ga0209073_1033920713300027765Agricultural SoilEGGDDDKKAAGPPDMELSFNVGVQLGLTDAASDGALKFQGSLSW
(restricted) Ga0255058_1039188523300027872SeawaterEIAGEPEMEFVFNVGLQFGLTDATSDTALKFQGGVEF
Ga0209481_1026269823300027880Populus RhizosphereEEEAKGGDEDEDNNKVPGPPNMELSFNVGVQSGLTDVTSDGALKFQGSLAW
Ga0268266_1008755213300028379Switchgrass RhizospherePGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0302172_1011925513300030003FenDKVAGPPPLELSFNVGVQFGLTDVTSDTALKFQGELNF
Ga0299907_1030880213300030006SoilDDDDDDNGNRNGNHEVAGPAKPEFSMNVGVQFGLTDFTSETALKFQGALEF
Ga0268386_1001369873300030619SoilDDERKVGGPPEMEVSLNVGVQFGLTDFTSDTALKFQGSLGF
Ga0307497_1013954613300031226SoilSAGGPAAMEFSMNVGVQFGLTDATSDTALKFQGSLAF
Ga0302323_10022596313300031232FenNDEDGVGKAEGGDDDKVAGPPPLELSFNVGVQFGLTDVTSDTALKFQGELNF
Ga0307380_1020938113300031539SoilDGDDDDGDNGATKAPEMEFSMNVGLQFGLTDLTSDGAVKFQGSLAF
Ga0307436_112112723300031563Salt MarshGEGDADEDDAAGASQASLSLNVGVQFGLTDATSDTALKFQGSFQF
Ga0307379_1032582413300031565SoilGDDDEEDDVAGPPDMEFSLNVGLQFGLTDAASDTALKFQGSLAF
Ga0307378_1051850623300031566SoilGDDDDDDRKVGGPPEIEFSLNVGVQFGLIDVTSDGALKFQGSLAF
Ga0307377_1044833823300031673SoilAVAGPPEMEFSFNVGLQFGLTDATSDTALKFQGSLGF
Ga0318502_1049807423300031747SoilPREGDDEKVAGPPKMELSLNVGVQFGLTDATSDLQLKFQTSLSF
Ga0310907_1040407623300031847SoilSEEEEAKGGDEDEDNNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0302322_10346319223300031902FenKVAGPPPLELSFNVGVQFGLTDVTSDTALKFQGELNF
Ga0310897_1038065823300032003SoilNNKVPGRPNMELCFNVGVQFGLTDVTSDGALKFQGSLAW
Ga0318549_1007733513300032041SoilARAGPDALSMNVGYQFGLADATSDSALKFQGSLSF
Ga0306924_1192565723300032076SoilDEKAAGPPATELALNVGVQFGLTDATSDTALKFQGSIGF
Ga0316197_1015333723300032273SedimentDLDEDFVPGGPVEMEMSFNVGVQFGLTDETSDSALKFQGKLEF
Ga0315273_1319049723300032516SedimentDDKESQKSTEFQMNVGVQFGLTELASDAALKVQGALQF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.