Metagenome / Metatranscriptome Family F070070

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F070070
Family Type	Metagenome / Metatranscriptome
Number of Sequences	123
Average Sequence Length	43 residues
Representative Sequence	LDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR
Number of Associated Samples	113
Number of Associated Scaffolds	123

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	2.44 %
% of genes near scaffold ends (potentially truncated)	96.75 %
% of genes from short scaffolds (< 2000 bps)	92.68 %
Associated GOLD sequencing projects	108
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (67.480 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (12.195 % of family members)
Environment Ontology (ENVO)	Unclassified (37.398 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (44.715 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.20
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 123 Family Scaffolds
PF00528	BPD_transp_1	57.72
PF12911	OppC_N	7.32
PF04392	ABC_sub_bind	1.63
PF08484	Methyltransf_14	0.81
PF13561	adh_short_C2	0.81
PF00496	SBP_bac_5	0.81
PF01979	Amidohydro_1	0.81
PF06114	Peptidase_M78	0.81

COG ID	Name	Functional Category	% Frequency in 123 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.63

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	67.48 %
Unclassified	root	N/A	32.52 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	67.48 %
Unclassified	root	N/A	32.52 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	67.48 %
Unclassified	root	N/A	32.52 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	45.53 %
Unclassified	root	N/A	32.52 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.63 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.81 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	45.53 %
Unclassified	root	N/A	32.52 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.63 %
unclassified Terrabacteria group	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	45.53 %
Unclassified	root	N/A	32.52 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.63 %
Terrabacteria group bacterium ANGP1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	0.81 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	45.53 %
Unclassified	root	N/A	32.52 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.63 %
Terrabacteria group bacterium ANGP1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	45.53 %
Unclassified	root	N/A	32.52 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.63 %
Terrabacteria group bacterium ANGP1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000890\|JGI11643J12802_11380387	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300002245\|JGIcombinedJ26739_101009876	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	717	Open in IMG/M
3300003203\|JGI25406J46586_10006243	All Organisms → cellular organisms → Bacteria	5500	Open in IMG/M
3300004479\|Ga0062595_101433849	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	632	Open in IMG/M
3300005180\|Ga0066685_10353861	Not Available	1019	Open in IMG/M
3300005331\|Ga0070670_102066755	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	525	Open in IMG/M
3300005335\|Ga0070666_11230394	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	558	Open in IMG/M
3300005347\|Ga0070668_100936224	Not Available	776	Open in IMG/M
3300005363\|Ga0008090_15455990	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	581	Open in IMG/M
3300005366\|Ga0070659_101737925	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	558	Open in IMG/M
3300005440\|Ga0070705_100726786	Not Available	782	Open in IMG/M
3300005444\|Ga0070694_100812890	Not Available	767	Open in IMG/M
3300005456\|Ga0070678_101322094	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	671	Open in IMG/M
3300005471\|Ga0070698_101289373	Not Available	680	Open in IMG/M
3300005471\|Ga0070698_101462582	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	634	Open in IMG/M
3300005518\|Ga0070699_101874179	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	548	Open in IMG/M
3300005560\|Ga0066670_10536625	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	716	Open in IMG/M
3300005576\|Ga0066708_10923115	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	544	Open in IMG/M
3300005578\|Ga0068854_102048745	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	528	Open in IMG/M
3300005617\|Ga0068859_100373998	All Organisms → cellular organisms → Bacteria	1520	Open in IMG/M
3300005718\|Ga0068866_10617591	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	734	Open in IMG/M
3300005719\|Ga0068861_101968375	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	582	Open in IMG/M
3300005764\|Ga0066903_100148216	All Organisms → cellular organisms → Bacteria	3362	Open in IMG/M
3300005844\|Ga0068862_101107925	Not Available	787	Open in IMG/M
3300006028\|Ga0070717_11807878	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	552	Open in IMG/M
3300006031\|Ga0066651_10240979	Not Available	959	Open in IMG/M
3300006049\|Ga0075417_10266817	Not Available	824	Open in IMG/M
3300006058\|Ga0075432_10273181	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	693	Open in IMG/M
3300006580\|Ga0074049_12041557	Not Available	541	Open in IMG/M
3300006846\|Ga0075430_100796669	Not Available	779	Open in IMG/M
3300006847\|Ga0075431_101638209	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	601	Open in IMG/M
3300006914\|Ga0075436_101173595	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	579	Open in IMG/M
3300006954\|Ga0079219_10062406	All Organisms → cellular organisms → Bacteria	1664	Open in IMG/M
3300006969\|Ga0075419_10071843	All Organisms → cellular organisms → Bacteria	2194	Open in IMG/M
3300009089\|Ga0099828_10180995	All Organisms → cellular organisms → Bacteria	1875	Open in IMG/M
3300009090\|Ga0099827_10622271	Not Available	931	Open in IMG/M
3300009147\|Ga0114129_12606022	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	603	Open in IMG/M
3300009148\|Ga0105243_11256963	Not Available	756	Open in IMG/M
3300009177\|Ga0105248_12612621	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	576	Open in IMG/M
3300009792\|Ga0126374_11401596	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300009810\|Ga0105088_1031141	Not Available	862	Open in IMG/M
3300010043\|Ga0126380_10949670	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	719	Open in IMG/M
3300010043\|Ga0126380_11716509	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	565	Open in IMG/M
3300010046\|Ga0126384_11300075	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	674	Open in IMG/M
3300010046\|Ga0126384_11704661	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	596	Open in IMG/M
3300010047\|Ga0126382_10684096	Not Available	858	Open in IMG/M
3300010047\|Ga0126382_11603972	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	603	Open in IMG/M
3300010159\|Ga0099796_10550359	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	519	Open in IMG/M
3300010335\|Ga0134063_10301052	Not Available	771	Open in IMG/M
3300010360\|Ga0126372_10293313	All Organisms → cellular organisms → Bacteria	1424	Open in IMG/M
3300010360\|Ga0126372_12476851	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300010362\|Ga0126377_10583154	Not Available	1161	Open in IMG/M
3300010362\|Ga0126377_11807836	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	686	Open in IMG/M
3300010376\|Ga0126381_100522369	All Organisms → cellular organisms → Bacteria	1678	Open in IMG/M
3300010397\|Ga0134124_10012470	All Organisms → cellular organisms → Bacteria → Proteobacteria	6868	Open in IMG/M
3300010398\|Ga0126383_10451539	Not Available	1335	Open in IMG/M
3300010399\|Ga0134127_12270594	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	622	Open in IMG/M
3300010403\|Ga0134123_11997563	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	638	Open in IMG/M
3300012096\|Ga0137389_10085582	All Organisms → cellular organisms → Bacteria	2474	Open in IMG/M
3300012205\|Ga0137362_10825967	Not Available	793	Open in IMG/M
3300012349\|Ga0137387_11054409	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	581	Open in IMG/M
3300012359\|Ga0137385_11492656	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	540	Open in IMG/M
3300012360\|Ga0137375_10132085	All Organisms → cellular organisms → Bacteria	2473	Open in IMG/M
3300012362\|Ga0137361_10588372	Not Available	1020	Open in IMG/M
3300012582\|Ga0137358_10221977	Not Available	1288	Open in IMG/M
3300012917\|Ga0137395_10046977	All Organisms → cellular organisms → Bacteria	2696	Open in IMG/M
3300012918\|Ga0137396_11315540	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	501	Open in IMG/M
3300012922\|Ga0137394_10485005	Not Available	1050	Open in IMG/M
3300012930\|Ga0137407_10695045	Not Available	958	Open in IMG/M
3300012957\|Ga0164303_11231517	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	549	Open in IMG/M
3300012971\|Ga0126369_11828908	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	696	Open in IMG/M
3300012987\|Ga0164307_10579808	Not Available	861	Open in IMG/M
3300012988\|Ga0164306_10705388	Not Available	802	Open in IMG/M
3300013297\|Ga0157378_10191268	All Organisms → cellular organisms → Bacteria	1930	Open in IMG/M
3300013297\|Ga0157378_11006293	Not Available	868	Open in IMG/M
3300014326\|Ga0157380_10422450	Not Available	1272	Open in IMG/M
3300014745\|Ga0157377_11116413	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	605	Open in IMG/M
3300014881\|Ga0180094_1137554	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	571	Open in IMG/M
3300015054\|Ga0137420_1324983	All Organisms → cellular organisms → Bacteria → Proteobacteria	2503	Open in IMG/M
3300015359\|Ga0134085_10631829	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	500	Open in IMG/M
3300015372\|Ga0132256_100973845	Not Available	964	Open in IMG/M
3300015372\|Ga0132256_103918610	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	501	Open in IMG/M
3300015374\|Ga0132255_100578132	All Organisms → cellular organisms → Bacteria	1659	Open in IMG/M
3300016270\|Ga0182036_10383538	Not Available	1091	Open in IMG/M
3300016319\|Ga0182033_10335446	Not Available	1259	Open in IMG/M
3300016422\|Ga0182039_12179536	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	511	Open in IMG/M
3300017792\|Ga0163161_10300016	All Organisms → cellular organisms → Bacteria	1265	Open in IMG/M
3300017792\|Ga0163161_11489885	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	594	Open in IMG/M
3300017973\|Ga0187780_11245112	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	546	Open in IMG/M
3300018084\|Ga0184629_10155875	Not Available	1160	Open in IMG/M
3300018482\|Ga0066669_10742909	Not Available	866	Open in IMG/M
3300019887\|Ga0193729_1073261	All Organisms → cellular organisms → Bacteria	1347	Open in IMG/M
3300020002\|Ga0193730_1083720	Not Available	900	Open in IMG/M
3300021560\|Ga0126371_12150119	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	673	Open in IMG/M
3300025899\|Ga0207642_10471987	Not Available	764	Open in IMG/M
3300026023\|Ga0207677_10921321	Not Available	789	Open in IMG/M
3300026089\|Ga0207648_10882454	Not Available	835	Open in IMG/M
3300026121\|Ga0207683_11215459	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	698	Open in IMG/M
3300026297\|Ga0209237_1022901	All Organisms → cellular organisms → Bacteria	3531	Open in IMG/M
3300026361\|Ga0257176_1011978	Not Available	1158	Open in IMG/M
3300026523\|Ga0209808_1101327	All Organisms → cellular organisms → Bacteria	1215	Open in IMG/M
3300027654\|Ga0209799_1025441	All Organisms → cellular organisms → Bacteria	1304	Open in IMG/M
3300027681\|Ga0208991_1206102	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	569	Open in IMG/M
3300028380\|Ga0268265_11138964	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	776	Open in IMG/M
3300028792\|Ga0307504_10313407	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	594	Open in IMG/M
3300028809\|Ga0247824_10448995	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	753	Open in IMG/M
3300028878\|Ga0307278_10135330	Not Available	1106	Open in IMG/M
3300031198\|Ga0307500_10156965	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	654	Open in IMG/M
3300031547\|Ga0310887_10058440	All Organisms → cellular organisms → Bacteria	1764	Open in IMG/M
3300031682\|Ga0318560_10804219	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	508	Open in IMG/M
3300031736\|Ga0318501_10536137	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	640	Open in IMG/M
3300031740\|Ga0307468_101416443	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	639	Open in IMG/M
3300031771\|Ga0318546_11241636	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	523	Open in IMG/M
3300031805\|Ga0318497_10296687	Not Available	900	Open in IMG/M
3300031912\|Ga0306921_10340243	All Organisms → cellular organisms → Bacteria	1755	Open in IMG/M
3300031912\|Ga0306921_12423073	All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1	547	Open in IMG/M
3300032067\|Ga0318524_10688566	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	539	Open in IMG/M
3300032180\|Ga0307471_102867087	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	612	Open in IMG/M
3300032211\|Ga0310896_10071949	All Organisms → cellular organisms → Bacteria	1468	Open in IMG/M
3300033004\|Ga0335084_11583021	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	646	Open in IMG/M
3300033158\|Ga0335077_10790161	Not Available	968	Open in IMG/M
3300033433\|Ga0326726_10446852	Not Available	1231	Open in IMG/M
3300033550\|Ga0247829_11188141	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	632	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	72.36%
Host-Associated	Host-Associated	27.64%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	70.73%
Plants	Host-Associated → Plants	27.64%
Aquatic	Environmental → Aquatic	1.63%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	69.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.45%
Rhizoplane	Host-Associated → Plants → Rhizoplane	12.20%
Sediment	Environmental → Aquatic → Sediment	1.63%
Peat	Environmental → Terrestrial → Peat	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.54%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.57%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.76%
Loam	Environmental → Terrestrial → Soil → Loam	8.13%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.88%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.44%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.63%
Soil	Host-Associated → Plants → Rhizoplane → Soil	1.63%
Sand	Environmental → Terrestrial → Soil → Sand	0.81%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	35.77%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.76%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.88%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.25%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.25%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.44%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.63%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	1.63%
Tropical Rainforest	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest	0.81%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.81%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.81%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	12.20%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	12.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.50%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.88%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.06%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.25%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.25%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.25%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.44%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.44%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.63%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.63%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.63%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.63%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.63%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.63%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	1.63%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	1.63%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.81%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.81%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.81%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.81%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.81%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.81%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.81%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005180	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006580	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009810	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300014881	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da	Environmental	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300020002	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026297	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026361	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B	Environmental	Open in IMG/M
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental	Open in IMG/M
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027681	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300028809	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48	Environmental	Open in IMG/M
3300028878	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117	Environmental	Open in IMG/M
3300031198	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental	Open in IMG/M
3300031736	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031805	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300032067	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033158	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI11643J12802_113803871	3300000890	Soil	IAQLALDEALTVPLVDELSVWAYRTGVQGVKYNFNAYPVLGDATLRK*
JGIcombinedJ26739_1010098762	3300002245	Forest Soil	IAAERLALDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDAIIRR*
JGI25406J46586_100062431	3300003203	Tabebuia Heterophylla Rhizosphere	LAIAHQALDEALTVPLVDELSVWAFRSGVQAVKYNFTAFPILGDATLRR*
Ga0062595_1014338492	3300004479	Soil	VQITRLLLDDAASVPLVDELAVWAYRSTVQGTKYNFNAYPVLSDAHIVRR*
Ga0066685_103538612	3300005180	Soil	ALDEALTVPLVDELAVWAFRANVQGVKYNFNAYPVLSDATTRR*
Ga0070670_1020667552	3300005331	Switchgrass Rhizosphere	LALDEALTVPLVDELSVWAYQAGVQGIKYNFNAYPILGDATLRK*
Ga0070666_112303941	3300005335	Switchgrass Rhizosphere	EALTVPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK*
Ga0070668_1009362241	3300005347	Switchgrass Rhizosphere	LDEALTVPLVDELAVWAFRTPVQGVKYNFNAYPVLSDTMIRR*
Ga0008090_154559902	3300005363	Tropical Rainforest Soil	EKLAVDEALTVPLLDDLSVWAYRANVRGAKYNFNAYPVLSDVTIRR*
Ga0070659_1017379252	3300005366	Corn Rhizosphere	ALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVILRK*
Ga0070705_1007267861	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	IEKLALDEALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVILRK*
Ga0070694_1008128902	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	ALDEALTVPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK*
Ga0070678_1013220942	3300005456	Miscanthus Rhizosphere	LAAEKLALDEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR*
Ga0070698_1012893731	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	LDEALTVPLLDELSVWAFRAAVRGVKYNFATYPVLSDAAIQK*
Ga0070698_1014625822	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	LDEALTVPLLDELSVWAFRAAVRGVKYNFATYPVLSDAAIR*
Ga0070699_1018741791	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	LDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR*
Ga0066670_105366251	3300005560	Soil	IEKLAIEEALTVPLLDDLSVWAYRANVQGTKYNFNAYPVLSDVTIRR*
Ga0066708_109231152	3300005576	Soil	IEQMVLDEALTVPLVDELSVWAFRANIRGVKYNFATYPVLSDAAIQK*
Ga0068854_1020487451	3300005578	Corn Rhizosphere	AIEKLALDEALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDAILRK*
Ga0068859_1003739981	3300005617	Switchgrass Rhizosphere	LVDDLSVWAFRANVQGTKYNFNAYPVLSDVTLRK*
Ga0068866_106175911	3300005718	Miscanthus Rhizosphere	IYLAIEKLALDEALTVPLVDELAVWAFRTPVQGVKYNFNAYPVLSDTMIRR*
Ga0068861_1019683752	3300005719	Switchgrass Rhizosphere	EDALTVPLVDDLAVWAFRAGVQRVKYNFNAYPLLSDTTISK*
Ga0066903_1001482165	3300005764	Tropical Forest Soil	VIDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR*
Ga0068862_1011079251	3300005844	Switchgrass Rhizosphere	LDEALTVPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK*
Ga0070717_118078782	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	LTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDAIVRR*
Ga0066651_102409792	3300006031	Soil	SIAQLALDEALTAPLVDELSVWAFRAGVQGVRYNFNAYPSLADATLRR*
Ga0075417_102668172	3300006049	Populus Rhizosphere	LALDEALTVPLVDELSVWAFRSGVQAVKYNFNAFPILGDATLRR*
Ga0075432_102731811	3300006058	Populus Rhizosphere	VPLVDELSVWAFRSGVQAVKYNFNAFPILGDATLRR*
Ga0074049_120415571	3300006580	Soil	LVDELSVWAFRAGVQGVKYNFNAYPLLSDTTLRR*
Ga0075430_1007966692	3300006846	Populus Rhizosphere	LAIDEALTVPLVDELSVWAFRAGVQGVKYNFNAYPILGDATLRK*
Ga0075431_1016382091	3300006847	Populus Rhizosphere	LLLDDAASVPLVDELAVWAYRSSVQGTKYNFNAYPVLSDAHIVRR*
Ga0075436_1011735951	3300006914	Populus Rhizosphere	YVSIEQFAIEEALAVPLVDELSVWAYRSGVQGVKYNFNAYPILGDATLRK*
Ga0079219_100624061	3300006954	Agricultural Soil	DEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR*
Ga0075419_100718431	3300006969	Populus Rhizosphere	LALDEALTVPLVDELSVWAFRSGVQAVKYNFTALPILGDATLRR*
Ga0099828_101809953	3300009089	Vadose Zone Soil	EALTVPLVDELAVWAFRANVQGVKYNFNAYPLLSDATTRR*
Ga0099827_106222711	3300009090	Vadose Zone Soil	TVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR*
Ga0114129_126060221	3300009147	Populus Rhizosphere	TIYRDVQKLVLDDAMAAPLVDDLAVWAFRANVQGTKYNFNAYPVLSDAFIKQ*
Ga0105243_112569631	3300009148	Miscanthus Rhizosphere	VYLAIEKLAVDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDTMIRR*
Ga0105248_126126212	3300009177	Switchgrass Rhizosphere	EALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVILRK*
Ga0126374_114015962	3300009792	Tropical Forest Soil	ASVPLVDELAVWAYRSNVQGTKYNFNAYPVLSDAYLVRR*
Ga0105088_10311411	3300009810	Groundwater Sand	DEALAVPLIDELSVWAFRATVQGVKYNFNAYPILSDTTVRR*
Ga0126380_109496702	3300010043	Tropical Forest Soil	ALTVPLVDELSVWAFRSNVTGIVYNFNAYPVLSDTTIKR*
Ga0126380_117165092	3300010043	Tropical Forest Soil	EALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRK*
Ga0126384_113000751	3300010046	Tropical Forest Soil	TVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK*
Ga0126384_117046612	3300010046	Tropical Forest Soil	VPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK*
Ga0126382_106840962	3300010047	Tropical Forest Soil	EDALTVPLVDELAVWAFRAGVQKVKYNFNTYPVLSDAVIKK*
Ga0126382_116039722	3300010047	Tropical Forest Soil	PLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRK*
Ga0099796_105503591	3300010159	Vadose Zone Soil	ALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR*
Ga0134063_103010521	3300010335	Grasslands Soil	LALDEALTVPLVDELAVWAFRANVQGVKYNFNAYPVLSDATTRR*
Ga0126372_102933131	3300010360	Tropical Forest Soil	IEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK*
Ga0126372_124768512	3300010360	Tropical Forest Soil	QLTRLLLDDAASVPLVDELAVWAYRSNVQGTKYNFNAYPVLSDVHIVRR*
Ga0126377_105831543	3300010362	Tropical Forest Soil	DALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRT*
Ga0126377_118078362	3300010362	Tropical Forest Soil	TVPLVDELSVWAFRAGVQGVKYNFNAYPILGDATLRK*
Ga0126381_1005223693	3300010376	Tropical Forest Soil	SIEQFAIEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK*
Ga0134124_100124701	3300010397	Terrestrial Soil	TVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR*
Ga0126383_104515392	3300010398	Tropical Forest Soil	ALDEALTVPLVDELSVWAFRSNVQGVKYNFNAYPVMSDATIRR*
Ga0134127_122705942	3300010399	Terrestrial Soil	LTVPLVDELSVWAYRTGVQGIKYNFNAYPILGDATLRK*
Ga0134123_119975631	3300010403	Terrestrial Soil	TRLALDEALTVPLVDELSVWAYQAGVQGIKYNFNAYPILGDATLRK*
Ga0137389_100855821	3300012096	Vadose Zone Soil	LTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR*
Ga0137362_108259672	3300012205	Vadose Zone Soil	IYLSIEQMALDEALTVPLLDELSVWAFRATVSGVKYNFATYPVLSDAAIQK*
Ga0137387_110544091	3300012349	Vadose Zone Soil	LTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR*
Ga0137385_114926561	3300012359	Vadose Zone Soil	IEKFALEEALTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR*
Ga0137375_101320854	3300012360	Vadose Zone Soil	SIAQLALDEALTVPLVDELSVWAFRSGVQAVKYNFNAYPILGDATLRK*
Ga0137361_105883721	3300012362	Vadose Zone Soil	LTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR*
Ga0137358_102219773	3300012582	Vadose Zone Soil	VPLVDELAVWAFRANVQGVKYNFNAYPVLSDATTRR*
Ga0137395_100469775	3300012917	Vadose Zone Soil	TVPLVDELAVWAFRAGVQRVKYNFNAYPVLSDAVIVKK*
Ga0137396_113155402	3300012918	Vadose Zone Soil	LYLAIEKFALEEALTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR*
Ga0137394_104850051	3300012922	Vadose Zone Soil	AIEKLALDEALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVVLRK*
Ga0137407_106950452	3300012930	Vadose Zone Soil	YLSIAQLALDEALTVPLVDELSVWAFRAGVQGVRYNFNAYPSLADATLRR*
Ga0164303_112315172	3300012957	Soil	IYVAVEKLALDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR*
Ga0126369_118289082	3300012971	Tropical Forest Soil	YLAIEKLALDDALAVPLVDELSVWAFRSTVTGTVYNFNAYPVLSDTTIKR*
Ga0164307_105798082	3300012987	Soil	YLAAEKLALDEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR*
Ga0164306_107053882	3300012988	Soil	KLALDEALPVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR*
Ga0157378_101912683	3300013297	Miscanthus Rhizosphere	VPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK*
Ga0157378_110062932	3300013297	Miscanthus Rhizosphere	LTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR*
Ga0157380_104224503	3300014326	Switchgrass Rhizosphere	KLALDEALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVTLRK*
Ga0157377_111164131	3300014745	Miscanthus Rhizosphere	QALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVILRK*
Ga0180094_11375542	3300014881	Soil	DQALTVPLVDKLSVWAFRASVQRITYNFNAYPLLSDVTVRR*
Ga0137420_13249838	3300015054	Vadose Zone Soil	VPLVDELSVWAFRSNVGGVKYNFNAYPVLSDAVIRK*
Ga0134085_106318292	3300015359	Grasslands Soil	QMALDEALTVPLLDELSVWAFRAGVRGVKYNFATYPVLSDAAIQK*
Ga0132256_1009738451	3300015372	Arabidopsis Rhizosphere	KLALDDALTVPLVDELSVWAFRSTVTGVSYNFNAYPVLSDATIKR*
Ga0132256_1039186102	3300015372	Arabidopsis Rhizosphere	SIIRLALDEALTVPLVDELSVWAYQAGVQGIKYNFNAYPILGDATLRK*
Ga0132255_1005781323	3300015374	Arabidopsis Rhizosphere	VPLVDELAVWAYRSTVQGTKYNFNAYPVLSDAHIVRR*
Ga0182036_103835382	3300016270	Soil	EQLAIEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK
Ga0182033_103354462	3300016319	Soil	VEIGPGLGALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRK
Ga0182039_121795361	3300016422	Soil	IEKLAVDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR
Ga0163161_103000163	3300017792	Switchgrass Rhizosphere	PLVDELSVWAFRSGVQGVKYNFNAYPILGDAALRK
Ga0163161_114898852	3300017792	Switchgrass Rhizosphere	IEKLALEDALTVPLVDDLAVWAFRAGVQRVKYNFNAYPLLSDTTISK
Ga0187780_112451122	3300017973	Tropical Peatland	AVEKLALDQALTVPLVDELALWAYRAPVQGVKYNFNAYPVLSDATIRR
Ga0184629_101558751	3300018084	Groundwater Sediment	QLALDEALTVPLVDELSVWAFRSGVQGVKFNFNAYPILGDATLRK
Ga0066669_107429091	3300018482	Grasslands Soil	VYLAIGKLAIAEALTVPLLDDLSVWADRANVQGAKYNFNAYPVLSDVTIRR
Ga0193729_10732613	3300019887	Soil	LAVEKLALDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR
Ga0193730_10837202	3300020002	Soil	KLALEEALTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR
Ga0126371_121501192	3300021560	Tropical Forest Soil	ALTVPLLDDLSVWVYRANVQGAKYNFNAYPVLSDVTIRK
Ga0207642_104719871	3300025899	Miscanthus Rhizosphere	KLALDEALTVPLVDELAVWAFRTPVQGVKYNFNAYPVLSDTMIRR
Ga0207677_109213211	3300026023	Miscanthus Rhizosphere	EKLAVDEALTVPLRDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR
Ga0207648_108824542	3300026089	Miscanthus Rhizosphere	LAVDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR
Ga0207683_112154592	3300026121	Miscanthus Rhizosphere	LAAEKLALDEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR
Ga0209237_10229015	3300026297	Grasslands Soil	EMALDEALTVPLLDELSVWAFRAAVRGVKYNFATYPVLSDTAIQK
Ga0257176_10119783	3300026361	Soil	TVPLVDELAVWAFRANVQGVKYNFNAYPVLSDATTRR
Ga0209808_11013273	3300026523	Soil	VPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR
Ga0209799_10254411	3300027654	Tropical Forest Soil	EQLAIEDALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK
Ga0208991_12061021	3300027681	Forest Soil	AIEKFALEEALTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR
Ga0268265_111389641	3300028380	Switchgrass Rhizosphere	LLDEAASVPLVDELAVWAYRSSVQGTKYNFNAYPVLSDAHLVRR
Ga0307504_103134071	3300028792	Soil	IVQLALDEALTVPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK
Ga0247824_104489951	3300028809	Soil	YLAAEKLALDEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR
Ga0307278_101353301	3300028878	Soil	LALDEALTVPLVDELSVWAFRSGVQAVKYNFNAYPILGDATLRK
Ga0307500_101569652	3300031198	Soil	TVPLVDELSVWAFRGGVQGVKYNFNAYPVLGDATLRK
Ga0310887_100584403	3300031547	Soil	TLEEALTVPLLDDLSVWAFRANVQGAKYNFNAYPVLSDVTIRK
Ga0318560_108042192	3300031682	Soil	IEQLAIEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK
Ga0318501_105361371	3300031736	Soil	IYVSIEQLAIEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK
Ga0307468_1014164432	3300031740	Hardwood Forest Soil	TVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR
Ga0318546_112416361	3300031771	Soil	ASVPLVDELAVWAFRSGVEGTKYNFNAYPVMSDAFIRK
Ga0318497_102966872	3300031805	Soil	LAIEDALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRK
Ga0306921_103402431	3300031912	Soil	IYLAIEKLAVDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR
Ga0306921_124230731	3300031912	Soil	VPLFDELAVYVSRSTVQGTKYNYSAYPVLSDVSMQK
Ga0318524_106885661	3300032067	Soil	LSKLLLDDAASVPLVDELAVWAFRSGVEGTKYNFNAYPVMSDAFIRK
Ga0307471_1028670871	3300032180	Hardwood Forest Soil	EALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK
Ga0310896_100719491	3300032211	Soil	PLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK
Ga0335084_115830212	3300033004	Soil	DEALTVPLVDELSVWAFRANVQGVKYNFNAYPVMSDAAIRR
Ga0335077_107901611	3300033158	Soil	PLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK
Ga0326726_104468521	3300033433	Peat Soil	IEKLALDEALTVPLVDELSVWAFRATVQGVKYNFNAYPVLSDAALRR
Ga0247829_111881412	3300033550	Soil	DAASVPLVDELAVWAYRSSVQGTKYNFNAYPVLSDAHIVRR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F070070

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences