Basic Information | |
---|---|
Family ID | F070170 |
Family Type | Metagenome |
Number of Sequences | 123 |
Average Sequence Length | 50 residues |
Representative Sequence | MGNRDVFDGDASVFAEVPKMVPSECSSEVGDNAVRETESMDDIFEEL |
Number of Associated Samples | 60 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Eukaryota |
% of genes with valid RBS motifs | 7.37 % |
% of genes near scaffold ends (potentially truncated) | 56.91 % |
% of genes from short scaffolds (< 2000 bps) | 77.24 % |
Associated GOLD sequencing projects | 60 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.13 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Eukaryota (52.033 % of family members) |
NCBI Taxonomy ID | 2759 |
Taxonomy | All Organisms → cellular organisms → Eukaryota |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.309 % of family members) |
Environment Ontology (ENVO) | Unclassified (94.309 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (94.309 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 52.03 % |
Unclassified | root | N/A | 47.97 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300006358|Ga0068871_101992421 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 553 | Open in IMG/M |
3300011119|Ga0105246_11424851 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 647 | Open in IMG/M |
3300013297|Ga0157378_11677922 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 682 | Open in IMG/M |
3300013297|Ga0157378_13240084 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 506 | Open in IMG/M |
3300015274|Ga0182188_1052070 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 528 | Open in IMG/M |
3300015274|Ga0182188_1057883 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 513 | Open in IMG/M |
3300015275|Ga0182172_1036372 | Not Available | 625 | Open in IMG/M |
3300015275|Ga0182172_1071819 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 513 | Open in IMG/M |
3300015276|Ga0182170_1041492 | Not Available | 604 | Open in IMG/M |
3300015277|Ga0182128_1022265 | Not Available | 720 | Open in IMG/M |
3300015277|Ga0182128_1043006 | Not Available | 601 | Open in IMG/M |
3300015277|Ga0182128_1070005 | Not Available | 522 | Open in IMG/M |
3300015282|Ga0182124_1019607 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 751 | Open in IMG/M |
3300015283|Ga0182156_1087614 | Not Available | 502 | Open in IMG/M |
3300015286|Ga0182176_1079000 | All Organisms → cellular organisms → Eukaryota | 516 | Open in IMG/M |
3300015288|Ga0182173_1058434 | All Organisms → cellular organisms → Eukaryota | 565 | Open in IMG/M |
3300015289|Ga0182138_1027817 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 703 | Open in IMG/M |
3300015296|Ga0182157_1019569 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 816 | Open in IMG/M |
3300015298|Ga0182106_1036031 | Not Available | 688 | Open in IMG/M |
3300015299|Ga0182107_1023382 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 782 | Open in IMG/M |
3300015300|Ga0182108_1105543 | Not Available | 504 | Open in IMG/M |
3300015303|Ga0182123_1042318 | Not Available | 643 | Open in IMG/M |
3300015303|Ga0182123_1051027 | Not Available | 610 | Open in IMG/M |
3300015304|Ga0182112_1074850 | Not Available | 560 | Open in IMG/M |
3300015307|Ga0182144_1072574 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 570 | Open in IMG/M |
3300015308|Ga0182142_1046345 | All Organisms → cellular organisms → Eukaryota | 663 | Open in IMG/M |
3300015308|Ga0182142_1096546 | All Organisms → cellular organisms → Eukaryota | 532 | Open in IMG/M |
3300015321|Ga0182127_1024176 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 827 | Open in IMG/M |
3300015321|Ga0182127_1056250 | Not Available | 646 | Open in IMG/M |
3300015321|Ga0182127_1075613 | Not Available | 591 | Open in IMG/M |
3300015322|Ga0182110_1031623 | Not Available | 763 | Open in IMG/M |
3300015322|Ga0182110_1078094 | Not Available | 583 | Open in IMG/M |
3300015322|Ga0182110_1110729 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 522 | Open in IMG/M |
3300015322|Ga0182110_1118719 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 510 | Open in IMG/M |
3300015323|Ga0182129_1108991 | Not Available | 512 | Open in IMG/M |
3300015341|Ga0182187_1148877 | Not Available | 561 | Open in IMG/M |
3300015342|Ga0182109_1165114 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 565 | Open in IMG/M |
3300015343|Ga0182155_1206791 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 519 | Open in IMG/M |
3300015344|Ga0182189_1104997 | Not Available | 673 | Open in IMG/M |
3300015344|Ga0182189_1107905 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 667 | Open in IMG/M |
3300015345|Ga0182111_1200476 | All Organisms → cellular organisms → Eukaryota | 544 | Open in IMG/M |
3300015346|Ga0182139_1201299 | Not Available | 543 | Open in IMG/M |
3300015347|Ga0182177_1220031 | All Organisms → cellular organisms → Eukaryota | 527 | Open in IMG/M |
3300015351|Ga0182161_1251561 | Not Available | 515 | Open in IMG/M |
3300015355|Ga0182159_1205950 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 635 | Open in IMG/M |
3300015361|Ga0182145_1148689 | Not Available | 550 | Open in IMG/M |
3300017404|Ga0182203_1120621 | All Organisms → cellular organisms → Eukaryota | 557 | Open in IMG/M |
3300017407|Ga0182220_1085882 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 538 | Open in IMG/M |
3300017410|Ga0182207_1114680 | Not Available | 583 | Open in IMG/M |
3300017411|Ga0182208_1034519 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 752 | Open in IMG/M |
3300017411|Ga0182208_1041463 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 713 | Open in IMG/M |
3300017411|Ga0182208_1062784 | All Organisms → cellular organisms → Eukaryota | 631 | Open in IMG/M |
3300017411|Ga0182208_1080363 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 585 | Open in IMG/M |
3300017413|Ga0182222_1011128 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 901 | Open in IMG/M |
3300017413|Ga0182222_1036483 | All Organisms → cellular organisms → Eukaryota | 667 | Open in IMG/M |
3300017413|Ga0182222_1041896 | Not Available | 644 | Open in IMG/M |
3300017413|Ga0182222_1098205 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 515 | Open in IMG/M |
3300017415|Ga0182202_1030035 | Not Available | 811 | Open in IMG/M |
3300017417|Ga0182230_1089423 | Not Available | 562 | Open in IMG/M |
3300017420|Ga0182228_1088938 | All Organisms → cellular organisms → Eukaryota | 576 | Open in IMG/M |
3300017424|Ga0182219_1054625 | All Organisms → cellular organisms → Eukaryota | 674 | Open in IMG/M |
3300017424|Ga0182219_1114679 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 536 | Open in IMG/M |
3300017424|Ga0182219_1124364 | All Organisms → cellular organisms → Eukaryota | 522 | Open in IMG/M |
3300017424|Ga0182219_1140582 | All Organisms → cellular organisms → Eukaryota | 502 | Open in IMG/M |
3300017425|Ga0182224_1130404 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 544 | Open in IMG/M |
3300017427|Ga0182190_1045699 | All Organisms → cellular organisms → Eukaryota | 776 | Open in IMG/M |
3300017427|Ga0182190_1052965 | All Organisms → cellular organisms → Eukaryota | 740 | Open in IMG/M |
3300017427|Ga0182190_1089541 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 621 | Open in IMG/M |
3300017427|Ga0182190_1115281 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 569 | Open in IMG/M |
3300017427|Ga0182190_1143113 | All Organisms → cellular organisms → Eukaryota | 528 | Open in IMG/M |
3300017427|Ga0182190_1147835 | All Organisms → cellular organisms → Eukaryota | 522 | Open in IMG/M |
3300017430|Ga0182192_1115566 | Not Available | 580 | Open in IMG/M |
3300017430|Ga0182192_1137885 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 545 | Open in IMG/M |
3300017433|Ga0182206_1125760 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 543 | Open in IMG/M |
3300017433|Ga0182206_1128488 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 539 | Open in IMG/M |
3300017438|Ga0182191_1010729 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1242 | Open in IMG/M |
3300017438|Ga0182191_1070089 | Not Available | 693 | Open in IMG/M |
3300017438|Ga0182191_1128840 | All Organisms → cellular organisms → Eukaryota | 567 | Open in IMG/M |
3300017442|Ga0182221_1037092 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 801 | Open in IMG/M |
3300017442|Ga0182221_1048747 | All Organisms → cellular organisms → Eukaryota | 739 | Open in IMG/M |
3300017442|Ga0182221_1054543 | Not Available | 715 | Open in IMG/M |
3300017443|Ga0182193_1114669 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 607 | Open in IMG/M |
3300017680|Ga0182233_1080496 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 591 | Open in IMG/M |
3300017683|Ga0182218_1071358 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 638 | Open in IMG/M |
3300017683|Ga0182218_1120283 | Not Available | 543 | Open in IMG/M |
3300017684|Ga0182225_1104270 | Not Available | 557 | Open in IMG/M |
3300017684|Ga0182225_1138337 | All Organisms → cellular organisms → Eukaryota | 509 | Open in IMG/M |
3300017685|Ga0182227_1095020 | All Organisms → cellular organisms → Eukaryota | 575 | Open in IMG/M |
3300017686|Ga0182205_1058542 | Not Available | 719 | Open in IMG/M |
3300017686|Ga0182205_1087089 | All Organisms → cellular organisms → Eukaryota | 632 | Open in IMG/M |
3300017686|Ga0182205_1113827 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 578 | Open in IMG/M |
3300017686|Ga0182205_1138005 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 541 | Open in IMG/M |
3300017686|Ga0182205_1172267 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 501 | Open in IMG/M |
3300017689|Ga0182231_1083015 | All Organisms → cellular organisms → Eukaryota | 612 | Open in IMG/M |
3300025927|Ga0207687_11809945 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 523 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 94.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068871_1019924212 | 3300006358 | Miscanthus Rhizosphere | MSNGDVFDGDAMVFAEVPKVMASKCSSEVGDDAVRETKSVDDVFEELDCFLCSSRDERFILD |
Ga0105246_114248511 | 3300011119 | Miscanthus Rhizosphere | MGNGDVFDRDASVFVEIPKMMTSECGFEVGDSAVRETESVDDIFEELDCFLCS |
Ga0157374_118277761 | 3300013296 | Miscanthus Rhizosphere | MGNRDVFDRDASVFAEVPKMMTSECSSEVSDNAIRETESVD |
Ga0157374_124989352 | 3300013296 | Miscanthus Rhizosphere | MGNRDVFDGDASIFAEVPKMMACEYSSKVGDNAVQETESV |
Ga0157378_116779221 | 3300013297 | Miscanthus Rhizosphere | MSNGDVFDGDGTVFAEVPKVMASKCSFEVGDDAVRETKSVDDIFEELDCF |
Ga0157378_132400841 | 3300013297 | Miscanthus Rhizosphere | MGNRDVFDRDASVFADIPKMMTSEYSSEIGDNAIRETESMNDIYEE |
Ga0182113_10614411 | 3300015269 | Miscanthus Phyllosphere | MGNRDVFNGDASVFAEVPKMVTGECSSEVGDNAVRETKS |
Ga0182188_10520701 | 3300015274 | Miscanthus Phyllosphere | MGNGDIFDGDASIFVEVPKVMASKRSFEVGDDAVWETESVDDIFEELDCFLCSSRDEW |
Ga0182188_10578831 | 3300015274 | Miscanthus Phyllosphere | MGNRNIFDGDASFFAEVPKMVTSECSFEVSDNAVRETESMDDIFKELD |
Ga0182172_10363721 | 3300015275 | Miscanthus Phyllosphere | MGNRDVFDGDASVFVEVPKMVTHECSSEVDDNAIWETESMDDIFEE |
Ga0182172_10580831 | 3300015275 | Miscanthus Phyllosphere | MGNRDVFDGDASVFVEVSKMMTGECSSEVGDNTVRETESVDGIFE* |
Ga0182172_10718191 | 3300015275 | Miscanthus Phyllosphere | MSFDLAVGSRMGNGDVFDRDAPVFTEVPKVMASKRSSKVGDDTVQETESVENIFEELNCSLCGSRDKR |
Ga0182170_10414922 | 3300015276 | Miscanthus Phyllosphere | MGNGDIFDEDASVFIEVLKMMTSECGSEVGDNAVWETESMDDIFEELDCFLCSG* |
Ga0182170_10519451 | 3300015276 | Miscanthus Phyllosphere | MGNRDVFDGDASVFAEVPKMVASECSSEVGDNAVRETKSVDDIF |
Ga0182128_10222651 | 3300015277 | Miscanthus Phyllosphere | MGNRDVFDRDASVFTENPKMVASECSSEVGDNAIWETESMDDIFEELD |
Ga0182128_10430062 | 3300015277 | Miscanthus Phyllosphere | MGNGDVLDGDASVFVEVPKVMASKCSSEVGDDAVWETESVDDVFEKLYRLLCSSRNEWFILNPLG* |
Ga0182128_10483942 | 3300015277 | Miscanthus Phyllosphere | MSNGDVFDGDAMIFVEVPKVMTSKYSSEVDDDAVWVTESVD |
Ga0182128_10700052 | 3300015277 | Miscanthus Phyllosphere | MGNGDIFDGDATVFAEVPEVMASKCSFEVGDDAVRETKSMDDVLEELDCFIYSS* |
Ga0182124_10196072 | 3300015282 | Miscanthus Phyllosphere | MSNKDVFDGDAMVFAEVPKVMASKCSAEVGDDAVRETESMDDVFEELGCFLCSSRDERFILNP |
Ga0182124_10451162 | 3300015282 | Miscanthus Phyllosphere | MGNGDVFDGDASVFAEVLNMMTSKCSSKVSDDAVR |
Ga0182156_10876141 | 3300015283 | Miscanthus Phyllosphere | VFDGDATVFAEVPKVMASKCSSEVGDDAVRETESVYDIFKELDCFSLQ* |
Ga0182176_10790001 | 3300015286 | Miscanthus Phyllosphere | SRMGNGDIFDGDASVFVEVPKMMASKHSSEVGDNAVRETESIDDIFKELDCLL* |
Ga0182173_10584341 | 3300015288 | Miscanthus Phyllosphere | MGKRDVFDGDALVFIEVPKMVASECSSKVGDNAVWETESVGDIFEKLNCLLCSGRNKRLL |
Ga0182173_10664162 | 3300015288 | Miscanthus Phyllosphere | MGNRDVFDRGASVFIEVPKMVTSECSSEVGDNAVRETKSMDD |
Ga0182138_10278171 | 3300015289 | Miscanthus Phyllosphere | MGNGDIFDRDAMVFTEVPEVMASKCSSEVGDDAVRETKSVDDIFEELDCFLCSSQDERFILDLF* |
Ga0182141_10545741 | 3300015292 | Miscanthus Phyllosphere | MGNRDVFDGDASVFAKVPKMVASECSPEVGDNAVLETKS |
Ga0182157_10195692 | 3300015296 | Miscanthus Phyllosphere | MGNGDVFDGDASIFAEVLKMMASKCSSEVGDNAIWETESVDIFEELDCLLSSS* |
Ga0182106_10360311 | 3300015298 | Miscanthus Phyllosphere | MGNRHVFDGDASVFIEVPKMVTSECSSEVGDNAVRETKSMDDIFKELDCL |
Ga0182107_10233821 | 3300015299 | Miscanthus Phyllosphere | MGNGDVIDGDTTVFAEIPKVMASECSSEVDDDAVWETKSVDDIFKELDCFLYSS* |
Ga0182108_11055431 | 3300015300 | Miscanthus Phyllosphere | GSRMGNRDIFHGDTPVFIEVPKVMASKCSSEVGDDAVRETESMDDVFEELDLFLCSS* |
Ga0182123_10423182 | 3300015303 | Miscanthus Phyllosphere | MGNRDIFDGDASVFAEVPKMMTSECSSEVSDNVVWETESMDDTFEELDCLLCSG |
Ga0182123_10510272 | 3300015303 | Miscanthus Phyllosphere | MGNEDVFDGDASVFVEVPKMVTSEISSEVSDNVVRKTKS |
Ga0182123_10921951 | 3300015303 | Miscanthus Phyllosphere | MGNRDVFDRDASIFVEVPKIMTSECSFEVGDNAVRETESV |
Ga0182112_10748501 | 3300015304 | Miscanthus Phyllosphere | DLAIVSRMGNRDVFDGDALVFAEVPKMMTSECSSEVSDNAIRETEFVDDNFKELDCLLGSG* |
Ga0182144_10725743 | 3300015307 | Miscanthus Phyllosphere | MGNRDVFDGDASVFVEVPKMVTSECSSEVSDNAVRETESMDDIFKEL |
Ga0182142_10463452 | 3300015308 | Miscanthus Phyllosphere | MGNRDVFDGDASVFTEFPKMMTSKCSSEVGDNAIREIESMDDIFEELDCLLCSG* |
Ga0182142_10965462 | 3300015308 | Miscanthus Phyllosphere | MGNRDVFDGDASVFAEVPKLMTSKCSSEIGDNAVQETESVDDIFE* |
Ga0182127_10241761 | 3300015321 | Miscanthus Phyllosphere | MGNGDIFDGDGMVFAEVLEVMASKCSFEVGDDAVWETKSVDDIFEELDCFLYSS* |
Ga0182127_10562501 | 3300015321 | Miscanthus Phyllosphere | MSNRDVFDEDASIFVEVPKMVTSECSSKVGDNAVRETVSMDDIFEGLD |
Ga0182127_10756131 | 3300015321 | Miscanthus Phyllosphere | MGNGDVFDGDASVFVEVPKMMTSECSFEVGDNAVRDTESVDDIFEELECLF |
Ga0182110_10316231 | 3300015322 | Miscanthus Phyllosphere | MSNGDVFDGDATVFAEVPKVMASKCSFVVGDDAVRETKSMDDVFEELDCFLCSSRDERFI |
Ga0182110_10780941 | 3300015322 | Miscanthus Phyllosphere | MGNRDIFDRDASVFVEVPKMMTSECSSEVGDNVVRETESMDDIFEELDCLLCSS* |
Ga0182110_11107292 | 3300015322 | Miscanthus Phyllosphere | MSNRDVFDGDASVFVEVPKMMTNECSSEVGDNAIRETKSMDNIFEELDCLLSSSQNKRF |
Ga0182110_11187192 | 3300015322 | Miscanthus Phyllosphere | MGNGEIFDGDASVFAEVLEMMASKCSSKVGDNAVWETESVYDIFEELDCFLCSG* |
Ga0182129_10751881 | 3300015323 | Miscanthus Phyllosphere | MDNGDVFDGDASVFIEVPKMMTSECSSEVGDNAVLETKSV |
Ga0182129_11089911 | 3300015323 | Miscanthus Phyllosphere | MVKREVFDGDASVFTEVPKMVTNEYSFEVGDNAVRETKSMDDIFEELDCLLCSG* |
Ga0182187_11488771 | 3300015341 | Miscanthus Phyllosphere | MGNGDIFDGDATVFTEVLEVMDSKCTFEVGDDAVQETKSVDNIFE* |
Ga0182109_11651142 | 3300015342 | Miscanthus Phyllosphere | MGNGDVFDGDASVFVEVPKMMTSKCISEVGDNAVWETESVDDIFE* |
Ga0182155_11848401 | 3300015343 | Miscanthus Phyllosphere | MGNRDVFARDASVFIEVPKMMTSECSSEVGDNVVR |
Ga0182155_12067911 | 3300015343 | Miscanthus Phyllosphere | MGNRDVFDGDASVFAEVPKMVTSECSSEVSDNAVRETDSVDDIFKELVCLLSSS* |
Ga0182189_11049971 | 3300015344 | Miscanthus Phyllosphere | MGNRDIFDGDATVFVEVPKMVTSEYSSKVGDNAIRETESMDDIFEELDCL |
Ga0182189_11079051 | 3300015344 | Miscanthus Phyllosphere | MGNGDVFNRDAPVFVEVPKVMASKRSFEVGDDAVREAESVYDIFKELDC |
Ga0182189_12068772 | 3300015344 | Miscanthus Phyllosphere | MGNRDVFDGDASVFTEAPKMVTSECSSEVGDNAIR |
Ga0182111_10726282 | 3300015345 | Miscanthus Phyllosphere | MSNGDIFDRDVTIFAEVPEVMASKCSSEVGDDAVRETES |
Ga0182111_12004762 | 3300015345 | Miscanthus Phyllosphere | GSRMGNRDVFDRDALVFVEVSKMMTSKCSFEVGDNAIWETKSMDDIFE* |
Ga0182139_12012991 | 3300015346 | Miscanthus Phyllosphere | MDNRDVFDRDASVFVEVPKIVTSERSFEVGDNAVRETKSMDDIFEELDC |
Ga0182177_12200312 | 3300015347 | Miscanthus Phyllosphere | MGNRDVFDGDASVFIEVPKMMTSECSSEVYDNAVRETKSMDDIF* |
Ga0182161_10867861 | 3300015351 | Miscanthus Phyllosphere | MGNRDVFDRDASIFVEVPKMVPSECSSEVGDNAVWETKSM |
Ga0182161_12515613 | 3300015351 | Miscanthus Phyllosphere | MSNGDIFDGDATVFAEVPKVMASKCSFEVGDDAIRETESMDDVFEELDCFLCSS* |
Ga0182159_12059501 | 3300015355 | Miscanthus Phyllosphere | MGNRDIFDGDASVFVEVPKMMASKCSSEFGDNAVRETKSMDDIFKELDCFLCSG |
Ga0182145_10835032 | 3300015361 | Miscanthus Phyllosphere | MGNGDIFDGDASIFTEVPKMMTSECGSEIGDNAVQETEYVDDI |
Ga0182145_11365032 | 3300015361 | Miscanthus Phyllosphere | MGNREVFDRDASIFAEGPKMVTSECSFEVGDNAIRETESMDDIFEEL |
Ga0182145_11486892 | 3300015361 | Miscanthus Phyllosphere | EDIFDRDASVFVEVSKMMTSKCSSEVSDNAVQETESVDDIFEELDCLFCNS* |
Ga0182203_11206211 | 3300017404 | Miscanthus Phyllosphere | MGNRDVFDGDAWVFVEVPKMVTSECSSEVGDNAIRETESMDDIFEE |
Ga0182220_10858822 | 3300017407 | Miscanthus Phyllosphere | MGNGDVFEGDALVFAEVPKMMTSECSSEIGDNAVWETESMDDIFEELDCFLCSS |
Ga0182207_11146801 | 3300017410 | Miscanthus Phyllosphere | VFDGDASVFAELPKMMTSKCSSKVGDNVVRETESMDDIFEELDCLLCSS |
Ga0182208_10345192 | 3300017411 | Miscanthus Phyllosphere | MGNRDVFDEDASVFTEVPKMMTSECSFEVGDNAVRETESMDDIFEEL |
Ga0182208_10414632 | 3300017411 | Miscanthus Phyllosphere | MGNRDVFDGDASVLAEVPKVMASKRSAKVRDNAVRETESVDDIFEELDCFLCSSR |
Ga0182208_10627841 | 3300017411 | Miscanthus Phyllosphere | MGNGDVFDEDASVFVEVPKMMTSECGSEVGDNAVRETESVDDILKEPDCFLCSSRDKRFVLDPL |
Ga0182208_10803631 | 3300017411 | Miscanthus Phyllosphere | MSNGDVFDGDAMVFAEVPKVMASKCSSEVSDDVVRETKSVDDIFEELD |
Ga0182222_10111281 | 3300017413 | Miscanthus Phyllosphere | MGNEDVFDEDTTVFAEIPKVMASECSSEVGDNAIRETESMDDIFEELDYLL |
Ga0182222_10364832 | 3300017413 | Miscanthus Phyllosphere | MGNGDIFEGDATVFAEVLEVMASKCSSKVGDDAVWEIKSMDDVFEELDYLLCSG |
Ga0182222_10418962 | 3300017413 | Miscanthus Phyllosphere | MGNRDVFDGDASVFVEVPKMMASKYSSKVGDNAIQETESVNDIFKELD |
Ga0182222_10982052 | 3300017413 | Miscanthus Phyllosphere | MGNGDVFDGDASVFAEVSKMVPSECSSEVGDNAIRETESMDDIF |
Ga0182202_10300352 | 3300017415 | Miscanthus Phyllosphere | MDNRDVIDGDASVFAEVLKMVTSECSSEVSDNAVRETESMDDIFEELACLLCSR |
Ga0182202_11220402 | 3300017415 | Miscanthus Phyllosphere | MGNRDVFDGDASVFIEVPKMMTSESSSKVGDNAVRKTESVDNIFKEL |
Ga0182230_10894232 | 3300017417 | Miscanthus Phyllosphere | MGNRDVFDEDASVFVEVPKMVTSECSSEVGDNAVRETESMDDIFKELDCLLYSG |
Ga0182228_10889381 | 3300017420 | Miscanthus Phyllosphere | MGNGDILDGDATVFVEVPKVMASKCSSEVDDDAVRETESVDDVLEELDCFLCSS |
Ga0182228_11103651 | 3300017420 | Miscanthus Phyllosphere | MSKGHVFDGDAMVFVEVPKVMVSKCSSKVGDDAVRETE |
Ga0182219_10546252 | 3300017424 | Miscanthus Phyllosphere | MGNGDVLHGDASVFVEVLKVMANKRSSKVGDDAVWETESVDDVFEELDCFLCSSR |
Ga0182219_11146792 | 3300017424 | Miscanthus Phyllosphere | MGNRDVFDRDASVFVEVPKMVTSECSFKVGDNAVRETESMDDIFEELDCLLCSSGN |
Ga0182219_11243641 | 3300017424 | Miscanthus Phyllosphere | MGNGDVFDGDATVFTEVPEVMASKCSSKVGDDAVWETESMDDVFEELDCFLCS |
Ga0182219_11405822 | 3300017424 | Miscanthus Phyllosphere | MVNRDVLEGDASVFVEVPKVMASKRSSKVGDDVVRETESVDDIFEELDYFLCSS |
Ga0182224_10360511 | 3300017425 | Miscanthus Phyllosphere | MGNRDVFDEDASVFAEVPKIMASECSSEVGDNAIRETESMDDI |
Ga0182224_11178951 | 3300017425 | Miscanthus Phyllosphere | ASVFIEVPKMMTSECSFEVSDNAVQETKSVDDIFKELDCLLSSS |
Ga0182224_11304042 | 3300017425 | Miscanthus Phyllosphere | METFNGDASVFTEVLKMMTSECSSEVGDNAVWETESVDDIFKELD |
Ga0182190_10456992 | 3300017427 | Miscanthus Phyllosphere | MGNEDVFDGDASVFADVSKMMTSKCSSEVSDNVVRETKSMDDVFEELDRFLCSG |
Ga0182190_10529652 | 3300017427 | Miscanthus Phyllosphere | MGNGDIIDRDTMVFIEIPKVMASECSSEVGDDAVRETKSMDDVFEELDCFLCSSGDERFILNP |
Ga0182190_10895412 | 3300017427 | Miscanthus Phyllosphere | MGNRDVFDGDASVFIEVPKMVTSECGSEVSDNVVRDTESMDDIFEEFDCLLCS |
Ga0182190_11152812 | 3300017427 | Miscanthus Phyllosphere | MGNRDVFDGDASVFTEVQKMMASECSFDVGDNAIRETESVDDIFEEL |
Ga0182190_11431131 | 3300017427 | Miscanthus Phyllosphere | MGNRDVFDRDASVFVEVPKMVTSECSSEVGDNAIRATESMDDIFEELDCLLCSSQNKRLV |
Ga0182190_11478352 | 3300017427 | Miscanthus Phyllosphere | MGNEDVFDGDASVFAEIPKMMTSECSSEVSDNAVRETESVDDIFEELD |
Ga0182192_11155662 | 3300017430 | Miscanthus Phyllosphere | MSNGNVFDEDATVFAEVPKVMASKCSFEVSDDAVQETESMYDVFEELDC |
Ga0182192_11378851 | 3300017430 | Miscanthus Phyllosphere | MGNRDIFNGDASVFVEVRKMMTSEYGFEVSDNAVQETESVDDIFEE |
Ga0182206_11257601 | 3300017433 | Miscanthus Phyllosphere | MSNGDVFDRDATVFTEVPEVMASKCSSEVGDDAIRETKSVDDIFEELDYFL |
Ga0182206_11284882 | 3300017433 | Miscanthus Phyllosphere | MGNGDIFDEDATIFAEVPKVMASERSSEVGDDVVRETESVDDIFEELDCFLWVAE |
Ga0182209_11239211 | 3300017436 | Miscanthus Phyllosphere | MGNKDVFDGDASVFTQVPKMMTSECSFEVGDNAIRETESMNDI |
Ga0182191_10107291 | 3300017438 | Miscanthus Phyllosphere | MGNRDVFDGDASVFIEVPKVMTSKCSSEVGDDAVRETESMNDVFEELDCFLCSSRD |
Ga0182191_10693442 | 3300017438 | Miscanthus Phyllosphere | MGNRDVFDGDASVFAEVPKMVPSECSSEVGDNAVRETESMDDIFEEL |
Ga0182191_10700892 | 3300017438 | Miscanthus Phyllosphere | MGNRDAFDEDASIFVEVPKMVTSECSSEVGDNAVRETESMDYIFEELNCLLCSSQNQR |
Ga0182191_11288402 | 3300017438 | Miscanthus Phyllosphere | MSNGDVFDGDAPVFVEVPKVRASKRSSEVGDNAVRETEYEDDIFEELDCFLCSSRDERF |
Ga0182221_10370921 | 3300017442 | Miscanthus Phyllosphere | MGNRDVFDGNASVFAEVLEMMPSECSSEVGDNAIWETESMDNIFE |
Ga0182221_10487471 | 3300017442 | Miscanthus Phyllosphere | MGNGDIFDRDAMVFAEVPEVMASKCSSEVGDDAVRETESVDDIFEELDCFLCSR |
Ga0182221_10545431 | 3300017442 | Miscanthus Phyllosphere | MGNGDALDGDASVFAEVPKVMASKCSFEVGDDAVRETESVDDVFEELD |
Ga0182193_10810851 | 3300017443 | Miscanthus Phyllosphere | MGNRDVFDGDASIFIEVPKMVTSECSSKVGDNAVRETESVEHI |
Ga0182193_11146692 | 3300017443 | Miscanthus Phyllosphere | MGNGDVFDGDTTVFAEIPKVMESECSSEVGDDAVRETKSMDDVFEELDCFLCSSGDERFI |
Ga0182233_10804961 | 3300017680 | Miscanthus Phyllosphere | MSNGDIFDGDATVFAEVPEVMASKCSSEVGDDAVWETKSVDDIFEELDCFL |
Ga0182218_10713581 | 3300017683 | Miscanthus Phyllosphere | MGNRDVFDGDASVFADVPKMVTSECSSEVGDDAVWETESMDDIFEELDCFLCSGLNK |
Ga0182218_11143341 | 3300017683 | Miscanthus Phyllosphere | MGNGDVFDGDASVFIEVPKIMTSECSSEVGDNVVWETEY |
Ga0182218_11202832 | 3300017683 | Miscanthus Phyllosphere | MGNRDIFNEDALAFVEVLEMMTSECGSEVGDDVVREIESVDDIFEELDYFLCSG |
Ga0182225_10885501 | 3300017684 | Miscanthus Phyllosphere | MGNRDVFDGDASIFIEVPKIMTSKCSSKVGDNAVRENEFV |
Ga0182225_11042701 | 3300017684 | Miscanthus Phyllosphere | MGNRDVFDRDASVFVEAPKMMTSECSSEIGDNAVWETESMDDIFEELDCLLCSG |
Ga0182225_11383372 | 3300017684 | Miscanthus Phyllosphere | MSNGDIFDGDATVFAEVPKLMASKCSSEVSDDAIWETKSMDDVFEELDCFLCNS |
Ga0182227_10950201 | 3300017685 | Miscanthus Phyllosphere | MGNLDIFDRDAPVFAEVPKMMAGKRSSKVGDDAVRETESVNGIFEELDCFLCSSRDERFILDPL |
Ga0182205_10585422 | 3300017686 | Miscanthus Phyllosphere | DASVFVEISKMVTSECSSQVGDNAVRETESMDDVFEELDCLLCSS |
Ga0182205_10870892 | 3300017686 | Miscanthus Phyllosphere | MGNRDVFDGDAWVFVEVPKMVPSECSSEVGDNAIRETESMDDIFEELDCLLCSS |
Ga0182205_11138271 | 3300017686 | Miscanthus Phyllosphere | MGNGDIFDGDATVFAEVLEVMASKCSSEVGDDAVWETKSVDDIFEELDCF |
Ga0182205_11300932 | 3300017686 | Miscanthus Phyllosphere | MGNRDVFDGDASVFIEVPKIMTSACGSEVGDNAVRETEYVDDIFKELDCLLYSS |
Ga0182205_11380051 | 3300017686 | Miscanthus Phyllosphere | MLFDLPIGSRMSNKDVFDGDAMVFAEVPKVMASKCSSKVGDDAVWETESVDDIFEEL |
Ga0182205_11722672 | 3300017686 | Miscanthus Phyllosphere | VGNGDVFDRDAPIFTEITKVMASKHSSEVGDDAVRETESVDDIFEELDCF |
Ga0182231_10571422 | 3300017689 | Miscanthus Phyllosphere | MGNRDVFDGDASVFAEVLEMMASKCSSKVGDNAVWETESVYD |
Ga0182231_10830152 | 3300017689 | Miscanthus Phyllosphere | MGNGDVFDRDASVFTEVPKMVTSECSSEVGDNAVRETKSMDDIFEELDYLLCSG |
Ga0207687_118099451 | 3300025927 | Miscanthus Rhizosphere | MGNGDVFDGDASVFVEVPKMMASKCSSEVGDNAVREAESVDDIFEEL |
⦗Top⦘ |