Basic Information | |
---|---|
Family ID | F070259 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 123 |
Average Sequence Length | 41 residues |
Representative Sequence | MKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIR |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Eukaryota |
% of genes with valid RBS motifs | 12.40 % |
% of genes near scaffold ends (potentially truncated) | 87.80 % |
% of genes from short scaffolds (< 2000 bps) | 91.87 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Eukaryota (89.431 % of family members) |
NCBI Taxonomy ID | 2759 |
Taxonomy | All Organisms → cellular organisms → Eukaryota |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (20.325 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.033 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (79.675 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.24% β-sheet: 0.00% Coil/Unstructured: 47.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.37 % |
Unclassified | root | N/A | 1.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000339|actLayA2DRAFT_102660 | All Organisms → cellular organisms → Eukaryota | 525 | Open in IMG/M |
3300001353|JGI20159J14440_10150397 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300003555|Ga0008453J51685_108693 | All Organisms → cellular organisms → Eukaryota | 1283 | Open in IMG/M |
3300003682|Ga0008456_1008063 | All Organisms → cellular organisms → Eukaryota | 546 | Open in IMG/M |
3300003684|Ga0005851_1012113 | All Organisms → cellular organisms → Eukaryota | 561 | Open in IMG/M |
3300003713|Ga0008274_100669 | All Organisms → cellular organisms → Eukaryota | 2013 | Open in IMG/M |
3300003717|Ga0006766_117083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella cf. planticola B43 | 766 | Open in IMG/M |
3300003733|Ga0008273_1001907 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300004126|Ga0066179_10014585 | All Organisms → cellular organisms → Eukaryota | 1541 | Open in IMG/M |
3300004595|Ga0008278_1046832 | All Organisms → cellular organisms → Eukaryota | 2812 | Open in IMG/M |
3300004769|Ga0007748_10212617 | All Organisms → cellular organisms → Eukaryota | 670 | Open in IMG/M |
3300006229|Ga0082389_116841 | All Organisms → cellular organisms → Eukaryota | 1647 | Open in IMG/M |
3300006356|Ga0075487_1053235 | All Organisms → cellular organisms → Eukaryota | 960 | Open in IMG/M |
3300006356|Ga0075487_1063975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus agalactiae | 610 | Open in IMG/M |
3300006356|Ga0075487_1072374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella cf. planticola B43 | 515 | Open in IMG/M |
3300006373|Ga0075483_1069665 | All Organisms → cellular organisms → Eukaryota | 516 | Open in IMG/M |
3300006373|Ga0075483_1089796 | All Organisms → cellular organisms → Eukaryota | 1066 | Open in IMG/M |
3300006374|Ga0075512_1073550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus agalactiae | 663 | Open in IMG/M |
3300006385|Ga0079050_1348385 | All Organisms → cellular organisms → Eukaryota | 578 | Open in IMG/M |
3300006393|Ga0075517_1000031 | All Organisms → cellular organisms → Eukaryota | 1311 | Open in IMG/M |
3300006393|Ga0075517_1020542 | All Organisms → cellular organisms → Eukaryota | 784 | Open in IMG/M |
3300006394|Ga0075492_1046529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Ligilactobacillus → Ligilactobacillus animalis | 660 | Open in IMG/M |
3300006394|Ga0075492_1061934 | All Organisms → cellular organisms → Eukaryota | 2396 | Open in IMG/M |
3300006397|Ga0075488_1081591 | All Organisms → cellular organisms → Eukaryota | 1837 | Open in IMG/M |
3300006397|Ga0075488_1083685 | All Organisms → cellular organisms → Eukaryota | 590 | Open in IMG/M |
3300006397|Ga0075488_1084194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Anaplasmataceae → Wolbachieae → Wolbachia → unclassified Wolbachia → Wolbachia endosymbiont of Culex molestus | 604 | Open in IMG/M |
3300006400|Ga0075503_1050489 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300006405|Ga0075510_10067430 | All Organisms → cellular organisms → Eukaryota | 517 | Open in IMG/M |
3300006425|Ga0075486_1048788 | All Organisms → cellular organisms → Eukaryota | 584 | Open in IMG/M |
3300006425|Ga0075486_1086668 | All Organisms → cellular organisms → Eukaryota | 566 | Open in IMG/M |
3300006602|Ga0075484_1006805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1395 | Open in IMG/M |
3300006690|Ga0031681_1124807 | All Organisms → cellular organisms → Eukaryota | 737 | Open in IMG/M |
3300006705|Ga0031684_1000698 | All Organisms → cellular organisms → Eukaryota | 518 | Open in IMG/M |
3300006708|Ga0031692_1008426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella cf. planticola B43 | 1502 | Open in IMG/M |
3300006710|Ga0031677_1015814 | All Organisms → cellular organisms → Eukaryota | 1707 | Open in IMG/M |
3300006717|Ga0031665_1334353 | All Organisms → cellular organisms → Eukaryota | 1670 | Open in IMG/M |
3300006720|Ga0031675_1327403 | All Organisms → cellular organisms → Eukaryota | 650 | Open in IMG/M |
3300006869|Ga0075477_10340161 | All Organisms → cellular organisms → Eukaryota | 591 | Open in IMG/M |
3300007328|Ga0079239_1072861 | All Organisms → cellular organisms → Eukaryota | 747 | Open in IMG/M |
3300007333|Ga0079270_1093339 | All Organisms → cellular organisms → Eukaryota | 673 | Open in IMG/M |
3300008917|Ga0103482_1001548 | All Organisms → cellular organisms → Eukaryota | 923 | Open in IMG/M |
3300008919|Ga0103484_1003352 | All Organisms → cellular organisms → Eukaryota | 1162 | Open in IMG/M |
3300008919|Ga0103484_1004627 | All Organisms → cellular organisms → Eukaryota | 962 | Open in IMG/M |
3300009214|Ga0103830_1014743 | All Organisms → cellular organisms → Eukaryota | 678 | Open in IMG/M |
3300009441|Ga0115007_10252389 | All Organisms → cellular organisms → Eukaryota | 1142 | Open in IMG/M |
3300009581|Ga0115600_1032203 | All Organisms → cellular organisms → Eukaryota | 1116 | Open in IMG/M |
3300009606|Ga0115102_10760641 | All Organisms → cellular organisms → Eukaryota | 529 | Open in IMG/M |
3300009725|Ga0123372_136398 | All Organisms → cellular organisms → Eukaryota | 550 | Open in IMG/M |
3300009728|Ga0123371_120831 | All Organisms → cellular organisms → Eukaryota | 608 | Open in IMG/M |
3300009730|Ga0123359_179290 | All Organisms → cellular organisms → Eukaryota | 1750 | Open in IMG/M |
3300009732|Ga0123373_161163 | All Organisms → cellular organisms → Eukaryota | 535 | Open in IMG/M |
3300009738|Ga0123379_1021651 | All Organisms → cellular organisms → Eukaryota | 1838 | Open in IMG/M |
3300009738|Ga0123379_1055812 | All Organisms → cellular organisms → Eukaryota | 519 | Open in IMG/M |
3300009738|Ga0123379_1101241 | All Organisms → cellular organisms → Eukaryota | 2190 | Open in IMG/M |
3300009750|Ga0123368_1069745 | All Organisms → cellular organisms → Eukaryota | 588 | Open in IMG/M |
3300009753|Ga0123360_1012091 | All Organisms → cellular organisms → Eukaryota | 583 | Open in IMG/M |
3300009756|Ga0123366_1074900 | All Organisms → cellular organisms → Eukaryota | 1301 | Open in IMG/M |
3300009757|Ga0123367_1208316 | All Organisms → cellular organisms → Eukaryota | 758 | Open in IMG/M |
3300012394|Ga0123365_1226646 | All Organisms → cellular organisms → Eukaryota | 837 | Open in IMG/M |
3300012470|Ga0129329_1053662 | All Organisms → cellular organisms → Eukaryota | 653 | Open in IMG/M |
3300012472|Ga0129328_1084532 | All Organisms → cellular organisms → Eukaryota | 859 | Open in IMG/M |
3300012523|Ga0129350_1475747 | All Organisms → cellular organisms → Eukaryota | 644 | Open in IMG/M |
3300012524|Ga0129331_1040759 | All Organisms → cellular organisms → Eukaryota | 974 | Open in IMG/M |
3300012711|Ga0157607_1097037 | All Organisms → cellular organisms → Eukaryota | 563 | Open in IMG/M |
3300012720|Ga0157613_1035405 | All Organisms → cellular organisms → Eukaryota | 635 | Open in IMG/M |
3300012755|Ga0138281_1075296 | All Organisms → cellular organisms → Eukaryota | 576 | Open in IMG/M |
3300012766|Ga0138282_1037216 | All Organisms → cellular organisms → Eukaryota | 564 | Open in IMG/M |
3300012769|Ga0138279_1236754 | All Organisms → cellular organisms → Eukaryota | 2311 | Open in IMG/M |
3300012775|Ga0138280_1110725 | All Organisms → cellular organisms → Eukaryota | 575 | Open in IMG/M |
3300012967|Ga0129343_1299247 | All Organisms → cellular organisms → Eukaryota | 566 | Open in IMG/M |
3300016703|Ga0182088_1041882 | All Organisms → cellular organisms → Eukaryota | 563 | Open in IMG/M |
3300018690|Ga0192917_1044678 | All Organisms → cellular organisms → Eukaryota | 670 | Open in IMG/M |
3300018964|Ga0193087_10125150 | All Organisms → cellular organisms → Eukaryota | 833 | Open in IMG/M |
3300019011|Ga0192926_10355990 | All Organisms → cellular organisms → Eukaryota | 623 | Open in IMG/M |
3300019020|Ga0193538_10140065 | All Organisms → cellular organisms → Eukaryota | 869 | Open in IMG/M |
3300019020|Ga0193538_10289763 | All Organisms → cellular organisms → Eukaryota | 511 | Open in IMG/M |
3300019152|Ga0193564_10257236 | All Organisms → cellular organisms → Eukaryota | 503 | Open in IMG/M |
3300019201|Ga0180032_1129389 | All Organisms → cellular organisms → Eukaryota | 584 | Open in IMG/M |
3300019214|Ga0180037_1121677 | All Organisms → cellular organisms → Eukaryota | 599 | Open in IMG/M |
3300020013|Ga0182086_1037404 | All Organisms → cellular organisms → Eukaryota | 556 | Open in IMG/M |
3300020013|Ga0182086_1200551 | All Organisms → cellular organisms → Eukaryota | 590 | Open in IMG/M |
3300020452|Ga0211545_10048770 | All Organisms → cellular organisms → Eukaryota | 2052 | Open in IMG/M |
3300021282|Ga0210303_1091027 | All Organisms → cellular organisms → Eukaryota | 580 | Open in IMG/M |
3300021305|Ga0210296_1074070 | All Organisms → cellular organisms → Eukaryota | 951 | Open in IMG/M |
3300021312|Ga0210306_1077088 | All Organisms → cellular organisms → Eukaryota | 546 | Open in IMG/M |
3300021317|Ga0210309_1093651 | All Organisms → cellular organisms → Eukaryota | 573 | Open in IMG/M |
3300021345|Ga0206688_10874162 | All Organisms → cellular organisms → Eukaryota | 1067 | Open in IMG/M |
3300021350|Ga0206692_1124562 | All Organisms → cellular organisms → Eukaryota | 523 | Open in IMG/M |
3300021353|Ga0206693_1778963 | All Organisms → cellular organisms → Eukaryota | 566 | Open in IMG/M |
3300021355|Ga0206690_10451598 | All Organisms → cellular organisms → Eukaryota | 537 | Open in IMG/M |
3300021355|Ga0206690_10486771 | All Organisms → cellular organisms → Eukaryota | 1566 | Open in IMG/M |
3300021359|Ga0206689_10367811 | All Organisms → cellular organisms → Eukaryota | 1219 | Open in IMG/M |
3300021368|Ga0213860_10094011 | All Organisms → cellular organisms → Eukaryota | 1306 | Open in IMG/M |
3300021849|Ga0210304_1089506 | All Organisms → cellular organisms → Eukaryota | 590 | Open in IMG/M |
3300022367|Ga0210312_115888 | All Organisms → cellular organisms → Eukaryota | 587 | Open in IMG/M |
3300022367|Ga0210312_117489 | All Organisms → cellular organisms → Eukaryota | 561 | Open in IMG/M |
3300023676|Ga0232114_120674 | All Organisms → cellular organisms → Eukaryota | 643 | Open in IMG/M |
3300023695|Ga0228680_1024105 | All Organisms → cellular organisms → Eukaryota | 693 | Open in IMG/M |
3300024322|Ga0228656_1029007 | All Organisms → cellular organisms → Eukaryota | 1264 | Open in IMG/M |
3300024536|Ga0256338_1034064 | All Organisms → cellular organisms → Eukaryota | 1154 | Open in IMG/M |
3300026390|Ga0247558_125617 | All Organisms → cellular organisms → Eukaryota | 576 | Open in IMG/M |
3300026403|Ga0247557_1021545 | All Organisms → cellular organisms → Eukaryota | 730 | Open in IMG/M |
3300026427|Ga0247556_1058217 | All Organisms → cellular organisms → Eukaryota | 844 | Open in IMG/M |
3300026449|Ga0247593_1097399 | All Organisms → cellular organisms → Eukaryota | 574 | Open in IMG/M |
3300026458|Ga0247578_1006846 | All Organisms → cellular organisms → Eukaryota | 1879 | Open in IMG/M |
3300026462|Ga0247568_1015026 | All Organisms → cellular organisms → Eukaryota | 1423 | Open in IMG/M |
3300027238|Ga0208808_1023059 | All Organisms → cellular organisms → Eukaryota | 803 | Open in IMG/M |
3300027833|Ga0209092_10558601 | All Organisms → cellular organisms → Eukaryota | 577 | Open in IMG/M |
3300028106|Ga0247596_1074385 | All Organisms → cellular organisms → Eukaryota | 764 | Open in IMG/M |
3300028109|Ga0247582_1199002 | All Organisms → cellular organisms → Eukaryota | 507 | Open in IMG/M |
3300028137|Ga0256412_1014390 | All Organisms → cellular organisms → Eukaryota | 2370 | Open in IMG/M |
3300028137|Ga0256412_1024850 | All Organisms → cellular organisms → Eukaryota | 1932 | Open in IMG/M |
3300028333|Ga0247595_1051934 | All Organisms → cellular organisms → Eukaryota | 679 | Open in IMG/M |
3300028334|Ga0247597_1001233 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales | 2529 | Open in IMG/M |
3300029659|Ga0206094_101799 | All Organisms → cellular organisms → Eukaryota | 1708 | Open in IMG/M |
3300030728|Ga0308136_1135475 | All Organisms → cellular organisms → Eukaryota | 559 | Open in IMG/M |
3300030937|Ga0138302_1800351 | All Organisms → cellular organisms → Eukaryota | 812 | Open in IMG/M |
3300031005|Ga0073974_1039449 | All Organisms → cellular organisms → Eukaryota | 1530 | Open in IMG/M |
3300031558|Ga0308147_1031242 | All Organisms → cellular organisms → Eukaryota | 668 | Open in IMG/M |
3300031580|Ga0308132_1085016 | All Organisms → cellular organisms → Eukaryota | 650 | Open in IMG/M |
3300032150|Ga0314779_1025433 | All Organisms → cellular organisms → Eukaryota | 585 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.33% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 19.51% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 13.01% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.13% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 7.32% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 6.50% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.25% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.44% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.44% |
Bay Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water | 2.44% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.63% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.81% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.81% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.81% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.81% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.81% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000339 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active layer cDNA A2 Metatranscriptome | Environmental | Open in IMG/M |
3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
3300003555 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_17_M020 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300003682 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300003684 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300003713 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300003717 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only) | Host-Associated | Open in IMG/M |
3300003733 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004595 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006229 | Marine sediment microbial communities, 0.9 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC143 | Environmental | Open in IMG/M |
3300006356 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006373 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006385 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006393 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006394 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006397 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006425 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006602 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006690 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP257 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006705 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP547 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006708 | Metatranscriptome of deep ocean microbial communities from Pacific Ocean - MP1480 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006710 | Metatranscriptome of deep ocean microbial communities from Blanes Bay, Balearic Sea - MPBL120807 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006717 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP0548 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006720 | Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2618 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007328 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 Surf_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007333 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300008917 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KB1 | Environmental | Open in IMG/M |
3300008919 | Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NA1 | Environmental | Open in IMG/M |
3300009214 | Microbial communities of water from the North Atlantic ocean - ACM51 | Environmental | Open in IMG/M |
3300009441 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome | Environmental | Open in IMG/M |
3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009725 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_229_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009728 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_213_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009730 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_177_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009732 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009738 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_244_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009750 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_206_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009753 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_190_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009756 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_202_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009757 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012394 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012470 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012472 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012504 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012523 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012745 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES017 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012755 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012766 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012775 | Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012967 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016703 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300018690 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109) | Environmental | Open in IMG/M |
3300018964 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130) | Environmental | Open in IMG/M |
3300019011 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079) | Environmental | Open in IMG/M |
3300019020 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264) | Environmental | Open in IMG/M |
3300019152 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717 | Environmental | Open in IMG/M |
3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019214 | Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020013 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021305 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021317 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021353 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021355 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021359 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021849 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022367 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023676 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023695 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
3300024536 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026390 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 3R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026403 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026427 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 1R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026449 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026458 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026462 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027238 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 (SPAdes) | Environmental | Open in IMG/M |
3300027833 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028106 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028109 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028137 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028333 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028334 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029659 | Metatranscriptome of soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_5-13C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030728 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_940_32.3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031005 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031558 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031580 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300032150 | Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
actLayA2DRAFT_1026601 | 3300000339 | Soil | MESLVIVNKNVTVNDISNFAHTAHHARRVVSIGNLTKGADC* |
JGI20159J14440_101503971 | 3300001353 | Pelagic Marine | MKLESLVIVNQHVTVNDLSNFAHTAHHARRVVLAG |
Ga0008453J51685_1086933 | 3300003555 | Seawater | MKSESLVIVNQHVTVNDLSNFAHTAHHARKVVPAGHLLGALYTP* |
Ga0008456_10080631 | 3300003682 | Seawater | ELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVGTRT* |
Ga0005851_10121131 | 3300003684 | Freshwater And Sediment | VYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVMF* |
Ga0008274_1006695 | 3300003713 | Marine | MKSESLVIVNQHVTVNDLPNFAHTAHHAQKVVTAGNKPDS* |
Ga0006766_1170831 | 3300003717 | Avena Fatua Rhizosphere | MKMESLVIVNQDVTVNDISNFAHTAHHARRVALFGNLISFVKLSRN* |
Ga0008273_10019072 | 3300003733 | Marine | MKSESLVIVNHHVTVNDLSNFAHTAHHARRVVSAGHLSDC* |
Ga0066179_100145852 | 3300004126 | Freshwater Lake | MKLESLVIVNHHVTVNDLSNFAHTAHHARRVVSAGNYLLSY |
Ga0008278_10468321 | 3300004595 | Marine | MKVESLVIVNQHVTVNDLSNFAHTAHHARRVVTAGNTPLYST* |
Ga0007748_102126171 | 3300004769 | Freshwater Lake | LFFMKLESLVIVNHHVTVNDLSNFAHTAHHARRVVSAGNYPIVKT* |
Ga0082389_1168411 | 3300006229 | Marine | MKSESLVIVNQNVTVNDTSNFAHTAHHARKIVLAGNLVFFFL |
Ga0075487_10532353 | 3300006356 | Aqueous | ELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNLITAYTGSLSQYYLK* |
Ga0075487_10639751 | 3300006356 | Aqueous | DCRLELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVAAGNFIRF* |
Ga0075487_10723741 | 3300006356 | Aqueous | YMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIRA* |
Ga0075483_10696651 | 3300006373 | Aqueous | ELVYMKSESLVIVNHDVTVNDISNFAHTAHHARRVVTAGNLIIL* |
Ga0075483_10897961 | 3300006373 | Aqueous | ELVYMKSESLVIVNHDVTVNDISNFAHTAHHARRVVTAGNFILA* |
Ga0075512_10735501 | 3300006374 | Aqueous | DCRLELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIRA* |
Ga0079050_13483852 | 3300006385 | Marine | MKLESLVIVNQNVTVNDLSNFAHTAHHARRIVLVGS* |
Ga0075517_10000312 | 3300006393 | Aqueous | MKSESLVIVNQHVTVNDLSNFAHTAHHARKVVPAGHFFDIFYNF* |
Ga0075517_10205422 | 3300006393 | Aqueous | CRLELVYMKSESLVIVNHDVTVNDISNFAHTAHHARRVVTA* |
Ga0075492_10465291 | 3300006394 | Aqueous | ELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNLIIA* |
Ga0075492_10619343 | 3300006394 | Aqueous | MKLESLVIANQYVAVNDLSNFAHTAHHARRVVPAGHLSNGFT* |
Ga0075488_10815912 | 3300006397 | Aqueous | MKSESLVIVNHDVTVNDISNFAHTAHHARRVVTAGN |
Ga0075488_10836851 | 3300006397 | Aqueous | ELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVAAGNFIRF* |
Ga0075488_10841941 | 3300006397 | Aqueous | ELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVAAGNLIIA* |
Ga0075503_10504892 | 3300006400 | Aqueous | MKLESLVIVNQHVTVNDLSNFAHTAHHARRVASAGHLSNG* |
Ga0075510_100674301 | 3300006405 | Aqueous | LELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIRA* |
Ga0075486_10487881 | 3300006425 | Aqueous | ESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIRV* |
Ga0075486_10866681 | 3300006425 | Aqueous | YMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIRG* |
Ga0075484_10068051 | 3300006602 | Aqueous | MKLFSMKLESLVIANHNVAVNDLSNFAHTAHHARRVVVAG |
Ga0031681_11248072 | 3300006690 | Deep Ocean | MKSESLVIVNQHVTVNDLSNFAHTAHHARRVVSAGHLLGCVNLYIVG* |
Ga0031684_10006982 | 3300006705 | Deep Ocean | MKLESLVIANQHVTVNDLSNFAHTAHHARKVVLAGNYLGLLIFELFIKK* |
Ga0031692_10084261 | 3300006708 | Deep Ocean | MKSESLVIVNQNVTVNDTSNFAHTAHHARKVVLVGNLVFLFITVISLFIILY |
Ga0031677_10158144 | 3300006710 | Deep Ocean | MKSESLVIVNQYVTVNDVSNFAHTAHHARRVVSAG |
Ga0031665_13343531 | 3300006717 | Deep Ocean | MKLSFMKLESLVIVNHHVTVNDLSNFAHTAHHARRVMLAGHLS* |
Ga0031675_13274031 | 3300006720 | Deep Ocean | MKSESLVIVNHDVTVNDISNFAHTAHHARRVVTAGNFIMS* |
Ga0075477_103401611 | 3300006869 | Aqueous | LVYMKSESLVIVNHDVTVNDLSNFAHTAHHARKVVLGGNLISVDS* |
Ga0079239_10728611 | 3300007328 | Marine | MKLESLVIVNQHVTVNDLSNFAHTAHHARRVVLAGNRLGIFT |
Ga0079270_10933391 | 3300007333 | Marine | MKLESLVIVNQHVTVNDLSNFAHTAHHARRIVLAGHYLGL |
Ga0103482_10015481 | 3300008917 | Bay Water | VIVNHDVTVNDLSNFAHTAHHARRVVTAGNLIGMQI* |
Ga0103484_10033522 | 3300008919 | Bay Water | MKLESLVIVNQHVTVNDLSNFAHTAHHARKVVPAGHLLGALYAI* |
Ga0103484_10046272 | 3300008919 | Bay Water | MKLESLVIVNQHVTVNDLSNFAHTAHHARKVVPAGHLLRD* |
Ga0103830_10147431 | 3300009214 | River Water | ESLVIVNHNVTVNDISNFAHTAHHARRVVTAGNFTIS* |
Ga0115007_102523891 | 3300009441 | Marine | DCRLELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVAAGNLIIA* |
Ga0115600_10322031 | 3300009581 | Wetland | MKAKSLVTVIYYSTVNYMSNFAHTAHHARRIVIKGSY |
Ga0115102_107606411 | 3300009606 | Marine | VIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIIT* |
Ga0123372_1363981 | 3300009725 | Marine | SESLVIVNHDVTVNDLSNFAHTAHHARRVVAAGNFIRF* |
Ga0123371_1208311 | 3300009728 | Marine | KSESLVIVNHDVTVNDLSNFAHTAHHARRVVAAGNFIRF* |
Ga0123359_1792901 | 3300009730 | Marine | MKLESLVIVNQHVTVNDLSNFAHTAHHARRIVLAGHYLGLLVLVYGVFP |
Ga0123373_1611631 | 3300009732 | Marine | SESLVIVNHDVTVNDLSNFAHTAHHARRVVMAGNLIEE* |
Ga0123379_10216511 | 3300009738 | Marine | MKLESLVIVNHDVTVNDLSNFAHTAHHARRVVMAGN |
Ga0123379_10558121 | 3300009738 | Marine | ESLVIVNHDVTVNDLSNFAHTAHHARRVVMAGNFIEE* |
Ga0123379_11012414 | 3300009738 | Marine | MKLESLVITNQHVVVNDLSNFAHTAHHARRIVLAG |
Ga0123368_10697451 | 3300009750 | Marine | VIVNHNVTVNDLSNFAHTAHHARRVVVAGNFNQILER* |
Ga0123360_10120911 | 3300009753 | Marine | VNHNVTVNDLSNFAHTAHHARRVVVAGNFNQILER* |
Ga0123366_10749001 | 3300009756 | Marine | MKLESLVIVNQHVTVNDLSNFAHTAHHARRVVPAGHLLN |
Ga0123367_12083161 | 3300009757 | Marine | LKLAYMKSESLVTVNQHVTVNDLSDFAHTAHHAQRVALA* |
Ga0123365_12266461 | 3300012394 | Marine | SESLVIVNHDVTVNDISNFAHTAHHARRVVTAGNLVGS* |
Ga0129329_10536621 | 3300012470 | Aqueous | SESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIRG* |
Ga0129328_10845322 | 3300012472 | Aqueous | MKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVGTRK |
Ga0129347_10199821 | 3300012504 | Aqueous | MKSESLVIVNQYVTVNDLSNFAHTAHHARRVASALNAIAEYRLAG |
Ga0129350_14757471 | 3300012523 | Aqueous | SESLVIVNHDVTVNDISNFAHTAHHARRVVTAGNFIIS* |
Ga0129331_10407591 | 3300012524 | Aqueous | MKLESLVIVNQHVTVNDLSNFAHTAHHARRVVLAGHYLGFLI |
Ga0157607_10970371 | 3300012711 | Freshwater | MKSESLVIVNYYVTVNDLSNFAHTAHHARRVVSAGNFIFGYKK |
Ga0157613_10354052 | 3300012720 | Freshwater | LVYMKSESLVIVNYYVTVNDLSNFAHTAHHARRVVSAGNFIFGYKKR* |
Ga0157532_1412261 | 3300012745 | Freshwater | MKLESLVIVNHHVTVNDLSNFAHTAHHARRVVSAGNYLLSYTLYFSY |
Ga0138281_10752961 | 3300012755 | Freshwater Lake | KSETLGIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVMF* |
Ga0138282_10372161 | 3300012766 | Freshwater Lake | SESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVMF* |
Ga0138279_12367541 | 3300012769 | Freshwater Lake | MKSESLVIVNNHVTVNDLSNFAHTAHHARRVVTAGN |
Ga0138280_11107251 | 3300012775 | Freshwater Lake | LELVYMESESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVMF* |
Ga0129343_12992471 | 3300012967 | Aqueous | KSESLVIVNHDVTVNDLSNFAHTAHHARKVVLGGNLISVDS* |
Ga0182088_10418821 | 3300016703 | Salt Marsh | LVIVNHDVTVNDLSNFAHTAHHARRVVLGGNLINVYF |
Ga0192917_10446781 | 3300018690 | Marine | SLVIVNHDVTVNDISNFAHTAHHARRVVTAGNFIMS |
Ga0193087_101251501 | 3300018964 | Marine | LVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIRMQK |
Ga0192926_103559901 | 3300019011 | Marine | SLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIMS |
Ga0193538_101400651 | 3300019020 | Marine | SLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIRIRKKVFVKDY |
Ga0193538_102897631 | 3300019020 | Marine | SLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFTIF |
Ga0193564_102572361 | 3300019152 | Marine | LVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIGMQN |
Ga0180032_11293891 | 3300019201 | Estuarine | VYMKSESLVIVNNHVTVNDLSNFAHTAHHARRVVTAVNVIED |
Ga0180037_11216771 | 3300019214 | Estuarine | MKLESLVIVNQHVTVNDLSNFAHTAHHARRVVLAGHY |
Ga0182086_10374041 | 3300020013 | Salt Marsh | LVIVNHDVTVNDLSNFAHTAHHARKVVLGGNLISVDS |
Ga0182086_12005511 | 3300020013 | Salt Marsh | ELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVLGGNLINVYF |
Ga0211545_100487702 | 3300020452 | Marine | MKLESLVTVNQHVTVNDLSNFAHTAHHARRVVSAGHYLGLFALV |
Ga0210303_10910271 | 3300021282 | Estuarine | KSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVMF |
Ga0210296_10740702 | 3300021305 | Estuarine | MKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIR |
Ga0210306_10770881 | 3300021312 | Estuarine | SESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVMF |
Ga0210309_10936511 | 3300021317 | Estuarine | SESLVIVNHYVTVNDLSNFAHTAHHARRVVMAGNLIRF |
Ga0206688_108741621 | 3300021345 | Seawater | ESLVIVNQHVTVNDLSNFAHTAHHARKVVPAGHLLGVLYDS |
Ga0206692_11245621 | 3300021350 | Seawater | SESLVIVNHNVTVNDISNFAHTAHHARRVVTALNLVLY |
Ga0206693_17789631 | 3300021353 | Seawater | KAESLVIVNQYVTVNDVSNFAHTAHHARRVVSAGNDI |
Ga0206690_104515981 | 3300021355 | Seawater | LVIVNHDVTVNDLSNFAHTAHHARKVVTAENSVLH |
Ga0206690_104867711 | 3300021355 | Seawater | MKLESLVIVNHYVTVNDLSNFAHTAHHARRILLAG |
Ga0206689_103678111 | 3300021359 | Seawater | MKLESLVIVNHYVTVNDLSNFAHTAHHARRIVVAGHLPYYL |
Ga0213860_100940111 | 3300021368 | Seawater | SNCRLELVYMKSESLVIVNHDVTVNDISNFAHTAHHARRVVTA |
Ga0210304_10895061 | 3300021849 | Estuarine | ELVYMKSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVMF |
Ga0210312_1158881 | 3300022367 | Estuarine | KSESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIRG |
Ga0210312_1174891 | 3300022367 | Estuarine | SESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFIIT |
Ga0232114_1206741 | 3300023676 | Seawater | KSESLVIVNHYVTVNDLSNFAHTAHHARRVVMAGNLIRF |
Ga0228680_10241051 | 3300023695 | Seawater | MKLESLVIVNQHVTVNDLSNFAHTAHHARRIVSAGHYLGLLALIYIANSL |
Ga0228656_10290071 | 3300024322 | Seawater | MKLESLVIVNQHVTVNDLSNFAHTAHHARRIVSAGHYLGL |
Ga0256338_10340641 | 3300024536 | Freshwater | MKLESLVIVNQHVTVNDLPNFAHTAHHARRVVTAVNT |
Ga0247558_1256171 | 3300026390 | Seawater | MKVESLVIVNEDVTVNDISNFAHTAHHARRVVFSGNLTEI |
Ga0247557_10215451 | 3300026403 | Seawater | RVIVNHHVTVNDLSNFAHTAHHARRVVPAGHLSVNLHVTN |
Ga0247556_10582171 | 3300026427 | Seawater | LESLVIVNQHVTVNDLSNFAHTAHHARRVVSAGHLLNYYDKKCFLRR |
Ga0247593_10973991 | 3300026449 | Seawater | MKLESLIIVNQHVTVNDLSNFAHTAHHARRIVSAGHYLGLLALIYIANSL |
Ga0247578_10068461 | 3300026458 | Seawater | MKMESLVIANQRIAVNDLSNVAHTAHHAXRVGLAGHFIR |
Ga0247568_10150261 | 3300026462 | Seawater | MKVESLVIVNEDVTVNDISNFAHTAHHARRVVFSGNLTEIVLIPLK |
Ga0208808_10230591 | 3300027238 | Estuarine | VYMKSESLVIVNHDVTVNDLSNFAHTAHHARRAVTA |
Ga0209092_105586011 | 3300027833 | Marine | MKSESLVTVNQHVTVNDLSNFAHTAHHARRAVPAGHLSDLLGCQIII |
Ga0247596_10743851 | 3300028106 | Seawater | LVIANQHVTVNDLSNFAHTAHHARKVGSAGNYLGMFT |
Ga0247582_11990021 | 3300028109 | Seawater | IVNHDVTVNDLSNFAHTAHHARKVVLSGNLINVYF |
Ga0256412_10143901 | 3300028137 | Seawater | MKLESLVITNQHVVVNDLSNFAHTAHHARRIVLAGHYL |
Ga0256412_10248501 | 3300028137 | Seawater | MKTESLVIANQYVAVNDLSNFAHTAHHARRVVPAGHLS |
Ga0247595_10519341 | 3300028333 | Seawater | KSESLVIVNQYVTVNDVSNFAHTAHHARRVVSAGNDI |
Ga0247597_10012331 | 3300028334 | Seawater | IVNQHVTVNDLSNFAHTAHHARRIVVAGHYLGLFVL |
Ga0206094_1017991 | 3300029659 | Soil | MKMESLVIVNQYVTVNDISNFAHTAHHARRVVLFGNLIGDAMVII |
Ga0308136_11354751 | 3300030728 | Marine | MKSESLVLVNQYVTVNDVSNFAHTAHHARRVVSAGNEI |
Ga0138302_18003511 | 3300030937 | Soil | MKVESLVIIRNYSMVNLKSNFAHTAHHARRVVRGGKLNSEYF |
Ga0073974_10394491 | 3300031005 | Marine | MKSESLVIVNHDVTVNDTSNFAHTAHHARRVVMAVNLVLYFVK |
Ga0308147_10312421 | 3300031558 | Marine | KSESLVIVNQYVTVNDVSNFAHTAHHARRVVSAGNEI |
Ga0308132_10850161 | 3300031580 | Marine | SESLVIVNQYVTVNDVSNFAHTAHHARRVVSAGNEI |
Ga0314779_10254331 | 3300032150 | Sediment | SESLVIVNHDVTVNDLSNFAHTAHHARRVVTAGNFVLV |
⦗Top⦘ |