NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070276

Metagenome / Metatranscriptome Family F070276

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070276
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 47 residues
Representative Sequence DLRKFVYWAVTAGQKFGPPLFFVPLPKSVNGFNYREIKKIQAGS
Number of Associated Samples 106
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.37 %
% of genes from short scaffolds (< 2000 bps) 94.31 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (56.098 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.512 % of family members)
Environment Ontology (ENVO) Unclassified
(31.707 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(42.276 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.67%    β-sheet: 0.00%    Coil/Unstructured: 58.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF00528BPD_transp_1 29.27
PF00300His_Phos_1 1.63
PF13522GATase_6 0.81
PF16363GDP_Man_Dehyd 0.81
PF04075F420H2_quin_red 0.81
PF13230GATase_4 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms56.91 %
UnclassifiedrootN/A43.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1072749All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300000881|JGI10215J12807_1137416All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300000955|JGI1027J12803_101216833All Organisms → cellular organisms → Bacteria → Proteobacteria1441Open in IMG/M
3300000956|JGI10216J12902_112253421All Organisms → cellular organisms → Bacteria2263Open in IMG/M
3300002244|JGI24742J22300_10113552All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300003993|Ga0055468_10202730All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300004156|Ga0062589_100517424Not Available1011Open in IMG/M
3300004157|Ga0062590_100838497Not Available851Open in IMG/M
3300004157|Ga0062590_102992908All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300004479|Ga0062595_101879180All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005332|Ga0066388_101474791Not Available1188Open in IMG/M
3300005334|Ga0068869_100861150All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300005334|Ga0068869_101700231All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300005345|Ga0070692_10116505All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300005367|Ga0070667_101914739All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005445|Ga0070708_100428292All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300005457|Ga0070662_101555642All Organisms → cellular organisms → Bacteria → Proteobacteria570Open in IMG/M
3300005539|Ga0068853_101915928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300005543|Ga0070672_100976521All Organisms → cellular organisms → Bacteria → Proteobacteria750Open in IMG/M
3300005548|Ga0070665_101998070All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300005718|Ga0068866_10981577All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300006196|Ga0075422_10553033All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300006576|Ga0074047_10024843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2839Open in IMG/M
3300006847|Ga0075431_101807085All Organisms → cellular organisms → Bacteria → Proteobacteria567Open in IMG/M
3300006853|Ga0075420_101628350All Organisms → cellular organisms → Bacteria → Proteobacteria553Open in IMG/M
3300006880|Ga0075429_101655124All Organisms → cellular organisms → Bacteria → Proteobacteria556Open in IMG/M
3300006917|Ga0075472_10454232Not Available636Open in IMG/M
3300006969|Ga0075419_11326905All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300009093|Ga0105240_11707304Not Available657Open in IMG/M
3300009100|Ga0075418_13060996All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300009147|Ga0114129_10045099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6199Open in IMG/M
3300009162|Ga0075423_12056007All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300009553|Ga0105249_12331318Not Available608Open in IMG/M
3300010396|Ga0134126_11323693Not Available797Open in IMG/M
3300010397|Ga0134124_12449588All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300011119|Ga0105246_11981000Not Available561Open in IMG/M
3300011119|Ga0105246_12257204All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300012232|Ga0137435_1177072Not Available656Open in IMG/M
3300012357|Ga0137384_10812635Not Available756Open in IMG/M
3300012515|Ga0157338_1018463Not Available791Open in IMG/M
3300012884|Ga0157300_1003596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1616Open in IMG/M
3300012884|Ga0157300_1106288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300012891|Ga0157305_10152325Not Available624Open in IMG/M
3300012899|Ga0157299_10114857Not Available716Open in IMG/M
3300012899|Ga0157299_10174931Not Available627Open in IMG/M
3300012905|Ga0157296_10137825All Organisms → cellular organisms → Bacteria → Proteobacteria715Open in IMG/M
3300012905|Ga0157296_10369104All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300012907|Ga0157283_10224129Not Available608Open in IMG/M
3300012907|Ga0157283_10377204All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium520Open in IMG/M
3300012907|Ga0157283_10386142All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300012910|Ga0157308_10049200Not Available1089Open in IMG/M
3300012910|Ga0157308_10470807All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300012911|Ga0157301_10006447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2202Open in IMG/M
3300012915|Ga0157302_10374070Not Available579Open in IMG/M
3300012958|Ga0164299_10395456Not Available886Open in IMG/M
3300012961|Ga0164302_10744177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300013100|Ga0157373_10491010Not Available886Open in IMG/M
3300013105|Ga0157369_10595094All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300013297|Ga0157378_10118420All Organisms → cellular organisms → Bacteria2438Open in IMG/M
3300013308|Ga0157375_10857396All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300014270|Ga0075325_1115365All Organisms → cellular organisms → Bacteria → Proteobacteria648Open in IMG/M
3300015200|Ga0173480_10647859Not Available655Open in IMG/M
3300015200|Ga0173480_10652970Not Available653Open in IMG/M
3300015371|Ga0132258_11383277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1778Open in IMG/M
3300015373|Ga0132257_102803886Not Available635Open in IMG/M
3300015373|Ga0132257_104360871All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300015374|Ga0132255_102141603Not Available852Open in IMG/M
3300015374|Ga0132255_104248062Not Available608Open in IMG/M
3300015374|Ga0132255_104803056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300018060|Ga0187765_11044113All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300018082|Ga0184639_10426177Not Available682Open in IMG/M
3300018469|Ga0190270_10156025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1863Open in IMG/M
3300018469|Ga0190270_12534204Not Available575Open in IMG/M
3300019356|Ga0173481_10033323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1670Open in IMG/M
3300021082|Ga0210380_10407039Not Available623Open in IMG/M
3300021510|Ga0222621_1101574Not Available610Open in IMG/M
3300022756|Ga0222622_10550466Not Available829Open in IMG/M
3300022880|Ga0247792_1092702All Organisms → cellular organisms → Bacteria → Proteobacteria612Open in IMG/M
3300022883|Ga0247786_1030272Not Available1052Open in IMG/M
3300022910|Ga0247768_1122409Not Available796Open in IMG/M
3300022915|Ga0247790_10140380All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300023057|Ga0247797_1048481Not Available607Open in IMG/M
3300023077|Ga0247802_1066119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300023266|Ga0247789_1013906All Organisms → cellular organisms → Bacteria1295Open in IMG/M
3300023274|Ga0247763_1190718Not Available579Open in IMG/M
3300025567|Ga0210076_1026228Not Available1246Open in IMG/M
3300025919|Ga0207657_11211284Not Available573Open in IMG/M
3300025921|Ga0207652_11617743Not Available552Open in IMG/M
3300025924|Ga0207694_10600168Not Available926Open in IMG/M
3300025926|Ga0207659_10216687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1537Open in IMG/M
3300025926|Ga0207659_11837505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300025931|Ga0207644_10330505Not Available1234Open in IMG/M
3300025935|Ga0207709_10040999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2776Open in IMG/M
3300025938|Ga0207704_11321785Not Available617Open in IMG/M
3300025941|Ga0207711_11167461Not Available711Open in IMG/M
3300025944|Ga0207661_12133955All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300025960|Ga0207651_10373004Not Available1207Open in IMG/M
3300026324|Ga0209470_1142798Not Available1054Open in IMG/M
3300027475|Ga0207607_100250Not Available911Open in IMG/M
3300027840|Ga0209683_10053989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1764Open in IMG/M
3300027894|Ga0209068_10498668Not Available702Open in IMG/M
3300027909|Ga0209382_11527104Not Available664Open in IMG/M
3300028379|Ga0268266_10945735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium834Open in IMG/M
3300028379|Ga0268266_11170527Not Available744Open in IMG/M
3300028380|Ga0268265_12064222All Organisms → cellular organisms → Bacteria → Proteobacteria577Open in IMG/M
3300028592|Ga0247822_10981560Not Available697Open in IMG/M
3300028608|Ga0247819_10912206All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon551Open in IMG/M
3300028717|Ga0307298_10244760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300028814|Ga0307302_10326463Not Available756Open in IMG/M
3300028884|Ga0307308_10318568Not Available745Open in IMG/M
3300030000|Ga0311337_10911201All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300030114|Ga0311333_10984370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria714Open in IMG/M
3300031232|Ga0302323_100064590All Organisms → cellular organisms → Bacteria3415Open in IMG/M
3300031726|Ga0302321_103446678Not Available514Open in IMG/M
3300031740|Ga0307468_100397626All Organisms → cellular organisms → Bacteria1050Open in IMG/M
3300031901|Ga0307406_10770970Not Available809Open in IMG/M
3300032000|Ga0310903_10583439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300032003|Ga0310897_10672362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300032012|Ga0310902_10678666Not Available692Open in IMG/M
3300032013|Ga0310906_11217444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300032017|Ga0310899_10128638All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300032174|Ga0307470_11832817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300033004|Ga0335084_10730296Not Available1008Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.06%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.44%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.63%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.63%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.63%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.63%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.63%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.81%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.81%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014270Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022910Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300023274Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300027475Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06.2A5a-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_107274913300000881SoilAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS*
JGI10215J12807_113741623300000881SoilKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT*
JGI1027J12803_10121683333300000955SoilFVYWAVTQGQRFGPPLFFVPLPTAVKGFDYREIKKIQAGS*
JGI10216J12902_11225342143300000956SoilKFIYWAVTQGQKLGPPLYFVPLPKTVQAFAFREIKRIQAGS*
JGI24742J22300_1011355223300002244Corn, Switchgrass And Miscanthus RhizosphereIVPTNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT*
Ga0055468_1020273013300003993Natural And Restored WetlandsSKAADLRKFVYWAVTQGQKFGPPLWFVPLPKTVQAFAYREIKKIQGGT*
Ga0062589_10051742423300004156SoilKLVYWAVTQGQQFGPPLLFQPLPVTVQAFAYREIKKIQGV*
Ga0062590_10083849713300004157SoilKLVYWAVTQGQKFGPPLLFEPLPVTVQAFAYREIKKIQGV*
Ga0062590_10299290823300004157SoilKAADLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS*
Ga0062595_10187918023300004479SoilQTLRQFVYWAVTAGQKFGPPLFFVPLPNAVKGFNYREIKKIQAGS*
Ga0066388_10147479123300005332Tropical Forest SoilGDKAQTLRQFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS*
Ga0068869_10086115023300005334Miscanthus RhizosphereNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT*
Ga0068869_10170023123300005334Miscanthus RhizosphereLRKFVYWAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQGST*
Ga0070692_1011650513300005345Corn, Switchgrass And Miscanthus RhizosphereLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA*
Ga0070667_10191473913300005367Switchgrass RhizosphereLRRFVYWSVTAGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS*
Ga0070708_10042829223300005445Corn, Switchgrass And Miscanthus RhizosphereIVPTNSGSKAADLRKFVYWAVTQGQKFGPPLFFVPLPNAVKGFNYREIKKIQSGS*
Ga0070662_10155564223300005457Corn RhizosphereELRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA*
Ga0068853_10191592813300005539Corn RhizosphereDVRKLVYWAVTQGQKFGPPLLFQPLPVTVQAFAYREIKKIQGV*
Ga0070672_10097652113300005543Miscanthus RhizosphereLRKFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS*
Ga0070665_10199807023300005548Switchgrass RhizospherePTNSGSKAADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGR*
Ga0068866_1098157723300005718Miscanthus RhizosphereSKAADLRKFIFWAVTQGQKFGPPLLFQPLPKTVQAFAYREIKKIQSSS*
Ga0075422_1055303313300006196Populus RhizosphereFIYWAVTQGQKFGPPLLFQPLPKTVQAFAYREIKKIQGGT*
Ga0074047_1002484353300006576SoilDKAQTLRQFVYWAVTAGQKYGPPLLFVPLPKAVNGFIYRELKKVQS*
Ga0075431_10180708513300006847Populus RhizospherePTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS*
Ga0075420_10162835023300006853Populus RhizosphereLRKFIFWAVTQGQRFGPPLLFQPLPKTVQAFAYREIKKIQGGT*
Ga0075429_10165512413300006880Populus RhizosphereVPTSSGDKSADLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS*
Ga0075472_1045423213300006917AqueousKAAELRKLMYWFVTQGQKLGPPLIFDPMPKQVQAFAYREIKKIQS*
Ga0075419_1132690513300006969Populus RhizosphereDLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS*
Ga0105240_1170730413300009093Corn RhizosphereKAADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGQ*
Ga0075418_1306099623300009100Populus RhizospherePTSSGDKAADLRKFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS*
Ga0114129_1004509973300009147Populus RhizosphereADLRKFVYWAVTAGQKFGPSLFFVPLPKAVNGFNYREIKKIQAGS*
Ga0075423_1205600723300009162Populus RhizosphereRKLVYWAVTQGQKFGPPLLFEPLPVTVQAFAYREIKKIQGV*
Ga0105249_1233131823300009553Switchgrass RhizosphereAADLRKMVYWAVTRGQQFGPPLLFAKLPVTVQAFAFREIKKIQAT*
Ga0134126_1132369313300010396Terrestrial SoilKFVYWAVTQGQKFGPQLFFVPLPNQVKAYDYREIKKIQGGQ*
Ga0134124_1244958823300010397Terrestrial SoilKAAELRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA*
Ga0105246_1198100023300011119Miscanthus RhizosphereVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS*
Ga0105246_1225720423300011119Miscanthus RhizosphereFIYWAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQASTK*
Ga0137435_117707213300012232SoilRKFIYWAITSGQKFGPPLLFAPLPKSVLAFNYKQIKKIQAST*
Ga0137384_1081263513300012357Vadose Zone SoilVIVPTNSGDKAVDLRKWVYWAVTQGQKFGPPLFFVPLPASVKGFDYREIKKIQSGS*
Ga0157338_101846323300012515Arabidopsis RhizosphereVLPTNSAKAADLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAFAYRELAKVKAGT*
Ga0157300_100359633300012884SoilKFVYWAVTAGQKFGPPLFFVPLPKAVNAFIYREIKKIQAGS*
Ga0157300_110628823300012884SoilRKFVYWAVTAGQKFGPPLYFVPLPKSVNGFNYREIKMIQAGS*
Ga0157305_1015232513300012891SoilTNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKAVNAFIYREIKKIQAGS*
Ga0157299_1011485713300012899SoilKFVYWAVTAGQKFGPPLYFVPLPKSVNGFNYREIKMIQAGS*
Ga0157299_1017493113300012899SoilNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKAVNAFIYREIKKIQAGS*
Ga0157296_1013782513300012905SoilSTFTYVILPTNSAKAADLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAFAYRELAKVKAGT
Ga0157296_1036910423300012905SoilIVPTQSNKAADLRRFIYWAVTQGQKFGPPLLFQPLPKTVQAFAYREIRKIQGGT*
Ga0157283_1022412913300012907SoilRKFIYWAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQAST*
Ga0157283_1037720413300012907SoilPTNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT*
Ga0157283_1038614213300012907SoilFIYWAITSGQKFGPPLLFEPLPKSVLAFNYKQIKKIQAST*
Ga0157308_1004920023300012910SoilWAITAGQKFGPPLLFVPLPRGVLAFDYKQIKKIQTAQ*
Ga0157308_1047080723300012910SoilVPTSSGDKAADLRKFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS*
Ga0157301_1000644713300012911SoilRKFVYWAVTQGQKFGPPLFFVPLPTSVKAFAYRELAKVKAGT*
Ga0157302_1037407013300012915SoilKAADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA*
Ga0164299_1039545633300012958SoilRKLVYWAVTQGQKFGPPLLFQPLPVTVQAFAYREIKKIQGV*
Ga0164302_1074417723300012961SoilFTYVIVPTNSGDKAADLRKLIYWTVTSGQKFGPPLYFVPLPKAVNGFVYREIKKIQSGA*
Ga0157373_1049101023300013100Corn RhizosphereADLRKFVYWAVTQGQKFGPPLFFVPLPDQVKAYDYREIKKIQGGR*
Ga0157369_1059509413300013105Corn RhizosphereTFTYVILPTSSAKAADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA*
Ga0157378_1011842013300013297Miscanthus RhizosphereDLRKFVYWAVTAGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS*
Ga0157375_1085739613300013308Miscanthus RhizosphereVIVPTNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT*
Ga0075325_111536523300014270Natural And Restored WetlandsTFTYVILPTSSAKAADLRKFVYWAVTQGQKFGPPLFFVPLPNTVKAFAYREIAKVKAAT*
Ga0173480_1064785913300015200SoilYWAVTGGQKYCPPLFFVPLPSSVQGFAYREIKKIQAGT*
Ga0173480_1065297013300015200SoilRKFVYWAVTQGQKFGPPLFFVPLPDQVKAYEYREIKKIQGGR*
Ga0132258_1138327713300015371Arabidopsis RhizospherePITTFTYVILPTSTAKAADLRKFVYWAVTQGQMFGPPLFFVPLPTSVKAYAYRELAKVKVAA*
Ga0132257_10280388623300015373Arabidopsis RhizospherePTNSSKAVPVRKLVYWAVTQGQKFGPPLLFEPLPVTVQAFAYREIKKIQGV*
Ga0132257_10436087123300015373Arabidopsis RhizospherePTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKAVNGYIYREIKKIQSGS*
Ga0132255_10214160323300015374Arabidopsis RhizosphereVTSGQKYGPPLLFQPLPQKVQAFDYKQIKKIKSQT*
Ga0132255_10424806223300015374Arabidopsis RhizosphereVIVPSNTKSAGDVRKLVYWAVTQGQKFGPPLLFQPLTVTVQAFAYREIKKIQAV*
Ga0132255_10480305623300015374Arabidopsis RhizosphereSSGDKAQTLRQFVYWAVTAGQKYGPPLFFVPLPKAVNGFNYREIKKIQTGS*
Ga0187765_1104411313300018060Tropical PeatlandPISTFTYVIVPTSMGDKAPTMRQFVYWAVTQGQKFGPPLFFVPLSTSVKAFAYREIAKIK
Ga0184639_1042617713300018082Groundwater SedimentDKAADLRKFVYWAVTAGQKFGPPLYFVPLPSSVNGFVYREIKKIQAGS
Ga0190270_1015602533300018469SoilAVTSGQKFGPPLLFQPLPDTVKAFAYREIKKIQGAS
Ga0190270_1253420423300018469SoilTGSSKAADLRKLVYWAVTRGQKFGPPLLFQPLPTPVQAFAFRELKKIQAT
Ga0173481_1003332313300019356SoilRKFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS
Ga0210380_1040703913300021082Groundwater SedimentRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGN
Ga0222621_110157413300021510Groundwater SedimentSGDKAADLRKFVYWAVTAGQKFGPPLYFVPLPAAVNGFIYREIKKIQAGS
Ga0222622_1055046613300022756Groundwater SedimentFIYWAVTAGQKFGPPLYFVPLPAAVNGFIYREIKKIQAGS
Ga0247792_109270213300022880SoilTYVILPTSSAKAADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA
Ga0247786_103027213300022883SoilAADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGR
Ga0247768_112240913300022910Plant LitterKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA
Ga0247790_1014038023300022915SoilADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA
Ga0247797_104848123300023057SoilNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIRAGT
Ga0247802_106611913300023077SoilNSGSKAADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGR
Ga0247789_101390633300023266SoilRKFVYWAVTQGQKFGPPLFFVPLPDQVKAYDYREIKKIQGGR
Ga0247763_119071823300023274Plant LitterLPTNSAKAADLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAFAYRELAKVKAGT
Ga0210076_102622823300025567Natural And Restored WetlandsVIVPTSSGSKAADLRKFVYWAITQGQRFGPPLFFVPLPNQVKAYDYREIKKIQGGQ
Ga0207657_1121128423300025919Corn RhizosphereAVTQGQKFGPPLLFEPLPVTVQAFAYREIKKIQGV
Ga0207652_1161774323300025921Corn RhizosphereVTSGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS
Ga0207694_1060016823300025924Corn RhizosphereADLRKFVYWAVTQGQKFGPPLFFVPLPDQVKAYEYREIKKIQGGR
Ga0207659_1021668733300025926Miscanthus RhizosphereAELRKFVYWAVTQGQKFGPPLFFVPLPTPVKAYAYRELAKVKAT
Ga0207659_1183750513300025926Miscanthus RhizosphereVTAGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS
Ga0207644_1033050533300025931Switchgrass RhizosphereKFVYWAVTSGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS
Ga0207709_1004099943300025935Miscanthus RhizosphereNAAKAAELRKFVYWAVTQGQKFGPPLFFVPLPTPVKAYAYRELAKVKAT
Ga0207704_1132178513300025938Miscanthus RhizosphereYWAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQGST
Ga0207711_1116746113300025941Switchgrass RhizosphereVILPTSSAKAGDLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA
Ga0207661_1213395523300025944Corn RhizospherePTDSGSQAADLRKFVYWAVTQGQKFGPPLFFVPLPDQVKAYEYREIKKIQGGR
Ga0207651_1037300423300025960Switchgrass RhizosphereKAADLRKFVYWAVTAGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS
Ga0209470_114279823300026324SoilDLRKVVYWAVTSGQQYGPKLLFQPLPTKVQAFDYKQIKKIQSST
Ga0207607_10025013300027475SoilILPTSSAKAADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA
Ga0209683_1005398933300027840Wetland SedimentKAAELRKFIYWAVTQGQKFGPALLFQPLPQPVQAFAFREIKKIQAST
Ga0209068_1049866823300027894WatershedsFIYWAVTEGQRYGPPLLFQPVPLVVQAFAYRQIAKILAPTA
Ga0209382_1152710413300027909Populus RhizosphereKFVYWAVTQGQKFGPPLLFQPLPKTVQAFAFREIKKIQVS
Ga0268266_1094573513300028379Switchgrass RhizosphereVIVPTNYGSKAADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGR
Ga0268266_1117052713300028379Switchgrass RhizosphereVPTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKSVNGFNYREIKKIQAGS
Ga0268265_1206422223300028380Switchgrass RhizosphereISTFTYVIVPTDSGSQAADLRKFVYWAVTQGQKFGPPLFFVPMPASVNGFVYREIKKIRAGT
Ga0247822_1098156013300028592SoilWAVTSGQKFGPPLLFQPLPDTVKAFAYREIKKIQGAS
Ga0247819_1091220623300028608SoilMVYWAVTRGQQFGPPLLFAKLPVPVQAFAFREIKKIQAT
Ga0307298_1024476023300028717SoilAADLRKFIYWAVTAGQKFGPPLYFVPLPKAVNGFVYREIKKIQAGT
Ga0307302_1032646313300028814SoilSSGDKAADLRKFIYWAVTAGQKFGPPLHFVPLPAAVNGFIYREIKKIQAGS
Ga0307308_1031856823300028884SoilVPTSSGDKAQTLRQFIYWAVTSGQKFGPLLFFVPLPKAVNAFIYREIKKIQSGT
Ga0311337_1091120113300030000FenSAKAKLLRTFVYWSVTEGQKFGPPLLFQPVPRVVQAFAYQQIAKIQVATP
Ga0311333_1098437023300030114FenLRKLIYWAVTSGQKLGPKLLFQPLPKQVQAFDYKQIKQIQG
Ga0302323_10006459083300031232FenYWAVTEGQKFGPPLLFQPVPRVVQAFAYQQIAKIQVATP
Ga0302321_10344667813300031726FenRKLIYWAVTSGQKLGPKLLFQPLPKQVQAFDYKQIKQIQG
Ga0307468_10039762613300031740Hardwood Forest SoilDLRKFVYWAVTAGQKFGPPLFFVPLPKSVNGFNYREIKKIQAGS
Ga0307406_1077097023300031901RhizosphereYVILPTSTAKAADLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA
Ga0310903_1058343923300032000SoilVVAVSSYVIVPTNSGDKAAGLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIRKIQAGT
Ga0310897_1067236223300032003SoilPTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS
Ga0310902_1067866613300032012SoilWAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQGST
Ga0310906_1121744423300032013SoilIVPTKANKAADLRRFVYWAVTRGQQYGPPLLFQPLPTTVKAFAYREIKKIQVT
Ga0310899_1012863823300032017SoilVIVPTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKAVNAFIYREIKKIQAGS
Ga0307470_1183281723300032174Hardwood Forest SoilVYWAVTAGQKFGPPLFFVPLPKAVNGYIYREIKKIQSGS
Ga0335084_1073029613300033004SoilDMRKLIYWAVTQGQKSGPPLFFVPLPKSVQAFAYREIKKIQAGT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.